(data stored in ACNUC7421 zone)

EMBL: CR954246.SECE

CR954246.SECE        Location/Qualifiers
FT   CDS_pept        224525..224902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="PSHAa0216"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11867527, 11976315, 12167867, 12941690, 12950181; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85319"
FT                   /db_xref="GOA:Q3ILQ6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ6"
FT                   /protein_id="CAI85319.1"
FT                   /translation="MSTNVETPSSAMESVKWLVAIVLLAGAVVGNHMFADQSVLLRAIG
FT                   VVVAIAAGLAIASQTAKGRTFLTFAKEARIEVRKVIWPTRQETIHTTLIVMVATAIMAL
FT                   ILWGLDGILFRAVGFLTGLEI"
     atgagcacga atgtagaaac gccatcaagt gcgatggagt cagtaaagtg gttagtagca        60
     atagtgctac ttgcaggcgc agttgttggt aatcacatgt ttgcagatca gtctgtatta       120
     ctacgtgcga ttggcgttgt agttgcaata gcagctggtt tagcaattgc ctcgcaaaca       180
     gctaaaggac gtactttcct tacttttgct aaagaagcaa gaattgaagt gcgcaaagta       240
     atttggccaa cgcgtcaaga aactatccac acgacattaa ttgtaatggt tgcaacagcg       300
     ataatggcac ttatcctttg gggattagat ggcattttat tccgcgctgt aggcttttta       360
     actggattgg agatctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page