(data stored in ACNUC7421 zone)

EMBL: CR954246.SIRA

CR954246.SIRA        Location/Qualifiers
FT   CDS_pept        complement(10927..11166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="PSHAa0009"
FT                   /product="small ubiquitous RNA-binding protein"
FT                   /function="3.2.1.1.2 : Regulatory proteins (RNA
FT                   interaction)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11080457, 11244064; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85123"
FT                   /db_xref="GOA:Q3IJ25"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ25"
FT                   /protein_id="CAI85123.1"
FT                   /translation="MSFNNPDHQLDAIGLRCPEPVMMVRAAIRKMNDGETLLIIADDPS
FT                   TTRDIPSFCTFMDHTLVAKDAEQAPYRYVVKKGL"
     atgagcttta ataaccccga tcaccaatta gatgccatag gccttcgctg cccagagcca        60
     gtgatgatgg tacgcgctgc tattcgtaaa atgaatgatg gtgaaacgtt attaatcatt       120
     gccgacgacc catcaaccac gcgtgacatt cccagctttt gtacctttat ggatcacacg       180
     ctggtggcca aagatgccga acaagcaccg tatcgctatg tagtgaagaa agggttgtag       240
//

If you have problems or comments...

PBIL Back to PBIL home page