(data stored in ACNUC7421 zone)

EMBL: CR954246.SLT

CR954246.SLT         Location/Qualifiers
FT   CDS_pept        15000..16886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="PSHAa0012"
FT                   /product="secreted lytic murein transglycosylase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8765311; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85126"
FT                   /db_xref="GOA:Q3IJ22"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ22"
FT                   /protein_id="CAI85126.1"
FT                   /translation="MKKYLLNAMAAVFIFPLHCVEANIDNDAFLDAEKKVRYGDYQDFK
FT                   MAISNLDHPLKPYVEKVYWQRHPDIKHQAEIEDYLTIYQHTPLEWPVRKAWLSYLEKHN
FT                   KKAAYIRNYRKTSDTELTCTYLDYQLDLGAPEKAIFNQVTDLWTVGKSQPKACDGLFSL
FT                   WRKKGYMSKEAVWQRVTMAAEGGTQSLLPYLKTLLPSNEGYLADLYLKVRRDPSAAAGL
FT                   YRYKNKSVKEGQIALYGVKRLIWRDKELALKAWEKLEQIFTYSDAAKADVYYTFALSLA
FT                   SSGHKQASFWLNKVPKDRQDSKLIQWQLGNMLKTQDWEGIAAFFTGKDNLSLGQQYWLA
FT                   YSYAKRGEQQKADAIWKTVAANRDYYGFLAAARLGLPVDLNNQPLVVDQALVNKVKNAP
FT                   GYKRAKAFYELERFTSARREWNYLTNTSSDEEKLAASILSTELGWHDSTIFTLAKIKAW
FT                   DNVEQRFPFAFQDVFERYSKRSKIDVAWSIAIARRESSFAPDARSSANARGLMQLLPST
FT                   ADYVNKGSVSSRRLYQPQTNIRLGTRYLQYLKKKNHGNEILATASYNAGYHRIKRWLPD
FT                   EAIPAELWIELIPYRETRDYVKNVFAYRQVYHTRLHREGNILAPLLEMKMGG"
     atgaaaaaat atttattaaa tgctatggca gcggttttta ttttccctct tcactgcgtt        60
     gaggcaaaca tcgataacga tgcattttta gacgctgaaa aaaaagttcg ctatggtgat       120
     taccaagact ttaaaatggc tataagtaat cttgatcatc cattaaagcc ttatgttgaa       180
     aaagtatatt ggcaacgaca tcccgatata aaacaccaag cagaaataga ggattacctc       240
     actatttatc agcatacgcc gctagagtgg ccagtgcgta aagcatggtt aagctattta       300
     gaaaagcata ataaaaaagc agcgtatatt cgcaattacc gtaaaacttc tgatactgaa       360
     ctgacttgta catatttaga ttatcaactt gatttaggtg cgccagaaaa agcgatattt       420
     aaccaagtaa ctgatttatg gacggtaggc aagtcgcaac ctaaagcgtg cgatgggctt       480
     ttttcgttat ggcgtaaaaa aggctatatg agtaaagagg ctgtttggca gcgggtgact       540
     atggcggcag aaggcggtac tcaaagccta ttaccttatt taaaaacatt actacccagt       600
     aatgaaggtt acttagctga tttatactta aaagtacgcc gcgatccaag tgctgcagcc       660
     ggattataca gatacaaaaa taagtcggtt aaagaagggc aaattgctct ttatggtgta       720
     aagcgtttaa tttggcgcga taaagagctt gctttaaaag catgggaaaa gctagagcaa       780
     atatttactt acagcgatgc agctaaagca gatgtgtatt atacctttgc actgtcgctt       840
     gcttccagcg gacataaaca agcaagcttt tggctaaaca aagtgccaaa agatcgccaa       900
     gacagcaaac taattcagtg gcaactcggt aatatgctta aaacccaaga ctgggagggt       960
     attgcagcct tttttactgg taaagataac ttaagtcttg gccagcaata ctggttagcg      1020
     tacagctacg caaaacgtgg tgagcaacaa aaagcagacg ctatttggaa aacagtagca      1080
     gctaatcgcg attattatgg ttttttagcc gcggcacgat tagggttacc ggttgattta      1140
     aataaccaac ctttagttgt tgatcaggcg cttgttaata aagtaaaaaa tgccccgggc      1200
     tacaagcgtg cgaaagcttt ttatgagctt gagcgcttta cctcggcacg tcgcgaatgg      1260
     aattacctaa caaacacctc gagtgacgaa gaaaagttag ctgcttcaat actctccaca      1320
     gagctgggtt ggcatgacag cactattttt acactggcaa aaataaaagc gtgggataac      1380
     gtagagcagc gttttccgtt tgcgtttcaa gatgtatttg agcgctacag taagcgcagt      1440
     aaaatagacg tggcgtggag tattgccatt gcgcgccgtg aaagctcatt tgcccccgat      1500
     gcacgttcat cagcaaatgc gcgagggtta atgcagttat tgcccagtac tgccgattac      1560
     gtaaataaag gcagtgtgtc gagccgccgc ttatatcaac cacaaacaaa tataagatta      1620
     ggtacgcgct atttgcagta tttaaaaaag aaaaaccacg gcaatgaaat attggcaacg      1680
     gcttcatata acgcagggta tcatcgtatt aaacgctggt taccagatga agctattcca      1740
     gcagagctat ggattgaatt gatcccgtat agagaaactc gcgattatgt taaaaacgta      1800
     tttgcctaca ggcaggttta tcatacgcgt ttacaccgcg agggaaatat actggcgccg      1860
     ctactcgaaa tgaaaatggg cggataa                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page