(data stored in ACNUC7421 zone)

EMBL: CR954246.SLYDB

CR954246.SLYDB       Location/Qualifiers
FT   CDS_pept        complement(306021..306515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyDB"
FT                   /locus_tag="PSHAa0292"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FkbP family"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9350861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85391"
FT                   /db_xref="GOA:Q3IEX6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX6"
FT                   /protein_id="CAI85391.1"
FT                   /translation="MQISKNSAVEFHYTLSEAGEQIETSTNEAPLTYIHGSEGMLPGLE
FT                   NALEGKAAGEKFSVTLAPSESYGERVDNLVQRIPLKHLQTQSKVKVWKPGMTAMVSSDQ
FT                   GRHQVTIIKVGRFNADCDLNHPFAGKTLTFDVEVVSVREATSEEVSHGHVHAAGGCGHS
FT                   H"
     atgcaaatta gtaaaaattc agccgttgaa tttcattaca cccttagcga agccggtgag        60
     caaatagaaa ccagtactaa cgaagcgcct cttacttata ttcatggcag cgaaggcatg       120
     cttcctggtt tagaaaatgc gctggaaggc aaagccgctg gcgaaaagtt tagcgttaca       180
     ttagcgccaa gcgagtcata cggcgaacgt gttgataact tagtacaacg cattccgtta       240
     aagcatttac aaacacaaag caaagttaaa gtatggaaac caggcatgac cgcaatggta       300
     agctcggatc aaggtcgtca tcaggtaact attattaaag taggccgctt taatgccgat       360
     tgtgatttaa atcatccatt tgcaggtaaa acactgactt ttgatgttga agtagtgtcg       420
     gtacgtgaag ccaccagcga agaagtatcg catggccatg tgcatgcagc aggcggatgt       480
     ggtcactctc actaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page