(data stored in ACNUC7421 zone)

EMBL: CR954246.SMF

CR954246.SMF         Location/Qualifiers
FT   CDS_pept        28157..29245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PSHAa0025"
FT                   /product="conserved protein of unknown function ; Smf
FT                   protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85139"
FT                   /db_xref="GOA:Q3IDI0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI0"
FT                   /protein_id="CAI85139.1"
FT                   /translation="MDQSSGKLAHWLAFYMCKGLGIKTLLALSKNHSLESLFGLSHQQL
FT                   LQLGLSANQATNLLHTNWQQITHYEQLILHNNITVISIFDAAYPEDLKQIASAPLLLFC
FT                   KGDVSFLTSPQIAIVGSRNATPTGLEIAAEFAYQLTLAGITITSGMARGIDGAAHKGAL
FT                   AGSGKTIAVLGTGVDIYYPKQHKLLTNQVLEQGLLVSEFLPGTAANAHNFPRRNRIISG
FT                   LSLGVLIVEAEIKSGSLITVRYALEQNKEVFAVPGSIKNPLAQASHFLIKQGAKLVENV
FT                   SDILDEVSFAYQSGFLTPEQSTQTNKDSQCEVLNSIGFEVTSVDDIVRRAQWPIDKVQA
FT                   RLLDLELDDQIERVLDGYIRVC"
     atggatcagt catctggcaa gctagcccac tggcttgcct tttatatgtg taaagggttg        60
     ggtattaaaa cccttttagc actatctaaa aaccattccc ttgagtcatt gtttggctta       120
     tctcatcagc aattactgca attaggacta agtgctaatc aagctactaa tttgttgcac       180
     actaattggc agcaaattac gcattatgaa cagttaatcc tacacaataa tataacggtt       240
     attagtattt ttgatgccgc ttaccccgaa gatttaaaac aaatagccag tgcgccttta       300
     ttgctttttt gcaaaggcga tgtgtcgttc ttaactagcc cacaaatagc catagttggg       360
     agccgtaacg ccactcccac cgggctggaa atagctgctg agtttgcata tcaacttacc       420
     ttagctggaa tcactattac ttcaggcatg gcccgcggta tagacggagc tgcgcataaa       480
     ggggccttag ctggcagcgg aaaaaccatt gccgtgctgg gtaccggtgt tgatatttac       540
     taccctaagc agcataagct acttacaaat caagtattag agcagggctt gcttgtaagt       600
     gagtttttac ctggtactgc cgcgaatgcg cataattttc cgcgtcgtaa tcgtattata       660
     tcggggttgt cgctgggggt acttattgtt gaagctgaaa ttaaaagcgg ttcgctcatt       720
     accgtacgct atgcgctgga gcaaaataaa gaagtatttg ctgttcccgg atcgattaaa       780
     aacccacttg cccaagcgag tcatttttta attaagcaag gtgctaagct cgtggagaat       840
     gtaagtgata ttcttgatga ggtgagcttt gcttatcaaa gtggtttttt aactccagag       900
     cagtcaaccc aaaccaataa agactcccag tgtgaggtgt taaatagtat tggctttgag       960
     gtaaccagtg ttgatgacat tgttcgccgt gctcagtggc caattgataa agtgcaagcc      1020
     agattgctgg acttggagct agatgatcaa atagagcgag ttttagatgg ttacatcagg      1080
     gtctgttga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page