(data stored in ACNUC7421 zone)

EMBL: CR954246.SMG

CR954246.SMG         Location/Qualifiers
FT   CDS_pept        29531..30004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="PSHAa0026"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85140"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDH9"
FT                   /protein_id="CAI85140.1"
FT                   /translation="MFEVLMYLFENYIHNDAGLFIEPNELTDELLRAGFNQAEIFKALD
FT                   WLEQLAELQHSDTSPYLITDSPQTMRIFTDHECKMLDVQCRNFLMFVERIGVTNGITRE
FT                   MVMDRLAALDKSFIGLDDLKWVVLMVLFNIPGAEVACEQMEDLIFDQPGDLLH"
     atgtttgaag tgcttatgta tctttttgaa aactatattc acaacgacgc tgggctcttc        60
     attgaaccta acgaattgac cgatgaatta ttacgagctg gttttaatca agccgaaata       120
     tttaaagcac tagattggct agagcagcta gccgaattac agcatagtga cacatcacca       180
     tatttaatca ctgactcgcc acaaacaatg agaatattta ccgaccacga atgcaaaatg       240
     ctggatgtgc agtgccgtaa ttttttaatg tttgttgaac gcattggcgt tactaatggt       300
     attacccgtg aaatggtaat ggaccgctta gcagcgctag ataaatcttt tatagggtta       360
     gacgatttaa agtgggtggt gttaatggtg ctatttaata tacccggagc agaagtggct       420
     tgtgagcaaa tggaagatct tatatttgac cagcccggcg acttacttca ctaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page