(data stored in ACNUC7421 zone)

EMBL: CR954246.SNAA

CR954246.SNAA        Location/Qualifiers
FT   CDS_pept        complement(217080..218804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snaA"
FT                   /locus_tag="PSHAa0210"
FT                   /product="putative sodium/sulfate symporter"
FT                   /function="1.2.2 : Anions"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10939241; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85313"
FT                   /db_xref="GOA:Q3ILR2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR2"
FT                   /protein_id="CAI85313.1"
FT                   /translation="MVDQLILTGIMLTLVGCLFGTRLNPAWLFVGAIGSSYLAGLIDLE
FT                   SMLVNYTNPSLITLVLLILVSIAIEKTTLIQKLAQSLSSGSLVKSVTKLGLSTAFLSSF
FT                   TNNTAVVASLITAIKDNPNHSPSKLLLPLSYTAILGGTITLIGTSTNLIVNGFAVDAGM
FT                   APLGFFDFTLVGLGALSVGLITILVMLKYLPDNGKSDQEVVPFYLEGKVQAGSKLIGRT
FT                   VEENGLRELKDLFLGEIIRDNQRICAVTPQQIIKQNDILLFVGDIKSVPLLTRFDGLKV
FT                   VHDNHQKDIEHLVEVVVSQSSKFIGKTVKEARFREQFHAAVIAIRRGHDRLQGGLGQVR
FT                   LQAGDSLILAPGKNFYSLPNLKREFVYISGFDLQTHLAPKQSNIVLLSFAAVLGLSIIG
FT                   LVPLVKGLLVLLIGFMLCGTIKLSEVKRRFPIELLAVVGSAIGLAKLMIGTGLAGQISA
FT                   AMFVVLGDFGPYSAFIAIFLMTVLFTELITNNAAAALSFPVAYSLAVGFNVDPLPFIMA
FT                   VAFGASASFISPFGYQTNLMVYSAGNYRLKDYVVMGLPLSIIYSITVLTLIPLVFPF"
     atggtagatc agctcatttt aacaggcatt atgcttactt tagtcgggtg cctttttggc        60
     actcggctta atcctgcatg gctatttgtg ggagccattg gcagcagcta cttagcaggg       120
     ctaatagatt tagaaagcat gttagttaat tatactaacc cgtcgctaat tactttggtg       180
     ttattaatat tagtgtcaat tgcgattgaa aaaaccaccc ttattcaaaa attagcgcaa       240
     tcactatcga gcggtagttt agttaaatca gtgactaaat tggggctttc gaccgcgttt       300
     ttatcgtcgt ttaccaataa cactgccgtg gttgcctcct taattaccgc gataaaagac       360
     aaccccaacc actcgccatc aaagttatta ttaccgctat cgtacaccgc tattttaggc       420
     ggcactatta cccttattgg cacatctacc aacttaatcg taaatggttt tgccgtagat       480
     gcgggcatgg cgccactggg cttttttgac tttaccttag taggtttggg cgcattaagc       540
     gtgggcttaa tcactatttt agtcatgtta aaatacttac ccgacaacgg taaaagcgac       600
     caagaagtcg tgccttttta tcttgaaggt aaagtacaag ccggttcaaa gttaattggc       660
     cgcaccgtag aagaaaatgg cctgcgtgaa cttaaagact tatttttagg cgaaataatt       720
     cgcgataacc aacgtatttg tgcggtcacg ccacagcaaa taattaaaca aaacgacata       780
     ttactttttg tgggcgatat aaaatcagtc cccctactta cgcgtttcga tggtttaaaa       840
     gtagtgcacg acaatcatca aaaagacata gaacacttag tagaagttgt tgtaagtcag       900
     tcttcaaaat ttattggtaa aaccgtaaaa gaagcccgct ttagagagca gtttcatgcg       960
     gccgttattg ctattcgccg cggccacgat cgcctgcaag gtggtttagg gcaagtgcgt      1020
     ttacaagcag gcgactcact aatactcgcc ccgggtaaaa acttttacag cttgcctaat      1080
     ttaaagcgcg aatttgtgta tatatcgggg tttgatttac aaactcacct agcgcctaaa      1140
     cagtcaaaca ttgtgctgct aagctttgcc gctgtactgg gcttaagtat tattggctta      1200
     gtgccgctag ttaaaggctt attagtatta ctgattggct ttatgctttg cggtactatt      1260
     aagcttagcg aagtaaaacg tcgctttcct attgagttac tcgccgtagt aggcagcgcc      1320
     ataggcttag caaaactaat gataggcacc ggacttgctg ggcaaatatc ggcggctatg      1380
     tttgtagtac ttggcgactt tggcccatac agcgccttta tcgcaatatt tttaatgaca      1440
     gtattattta ccgagctgat aaccaataac gccgctgcag cattgtcgtt tccggttgcc      1500
     tattcacttg ccgttggctt taacgtagac ccactgccat ttattatggc ggttgcgttt      1560
     ggcgcatcag caagttttat atcgccgttt ggttatcaaa ctaaccttat ggtttacagc      1620
     gcgggtaact atcgtttaaa agattatgta gtgatgggct tgcccctttc tattatttat      1680
     tcaataacag tattaacctt gatcccgcta gtatttccgt tttaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page