(data stored in ACNUC7421 zone)

EMBL: CR954246.SPED

CR954246.SPED        Location/Qualifiers
FT   CDS_pept        210227..211039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="PSHAa0199"
FT                   /product="S-adenosylmethionine decarboxylase, proenzyme"
FT                   /function="2.2.2 : Polyamines biosynthesis"
FT                   /EC_number="4.1.1.50"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10844697, 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85302"
FT                   /db_xref="GOA:Q3IFT4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFT4"
FT                   /protein_id="CAI85302.1"
FT                   /translation="MNKPFDKLKLHGFNNLTKSLSFSIYDICYAKTEQQRKEYIEYIDE
FT                   QYSADRLTDILGEVVDIIGANILNVARQDYEPQGASVTILVSEEPVEEQQNYDADEAPG
FT                   PLPDSVVAHLDKSHICVHTYPEAHPDDGICTFRADIEVSTCGIISPLKALNFLIHSLES
FT                   DVVTIDYRVRGFTRDINGVKHYIDHAISSIQNFMTEDTKEAYQMMDVNVYQENLFHTKM
FT                   MLKETDLNTYLFGLSTDDLSDEEEEEIRSKLTREMQEIFYGRNLPDLD"
     atgaacaaac ccttcgataa acttaaactt catggtttta ataatttaac taaaagttta        60
     agctttagta tttacgacat ttgctatgca aagaccgagc aacaacgtaa agaatatatt       120
     gaatatatcg atgagcagta cagtgcagat agactaaccg acattttagg tgaagttgtt       180
     gatattatag gtgctaacat tttaaatgta gcgcgccaag actacgaacc gcaaggtgca       240
     agcgtaacta ttttggtttc agaagagccg gtagaagagc agcaaaatta cgatgctgac       300
     gaagctccag gcccattacc agattcagtg gttgcccatt tagataaaag ccatatttgt       360
     gtacacacgt acccagaagc tcaccctgat gacggtattt gtacttttcg cgccgatatt       420
     gaagtgtcaa cgtgtggcat aatatcgcca cttaaagcgt taaacttcct tattcatagc       480
     ctagagtcag acgtagtaac aattgactac cgcgtacgtg gttttactcg cgatattaat       540
     ggcgttaagc actacatcga tcatgcaatt agctcaattc aaaacttcat gacagaagat       600
     accaaagaag cgtaccaaat gatggacgta aacgtgtatc aagaaaacct gtttcacact       660
     aaaatgatgt taaaagagac tgatttaaat acctatttat tcggcctttc tacggatgat       720
     ttgtcagatg aagaagagga agaaattcgc tctaaactga cccgtgaaat gcaagaaata       780
     ttctatggcc gtaacttgcc agacctagat taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page