(data stored in ACNUC7421 zone)

EMBL: CR954246.SRMB

CR954246.SRMB        Location/Qualifiers
FT   CDS_pept        complement(524696..525922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srmB"
FT                   /locus_tag="PSHAa0510"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2461520; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85600"
FT                   /db_xref="GOA:Q3IG81"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG81"
FT                   /protein_id="CAI85600.1"
FT                   /translation="MQFSEFDLDNKLLDAINKMGYETPTSIQQQAIPEALQGRDILASA
FT                   PTGTGKTAAFLIPAIQYLLDFPRRDPGFARVLVMTPTRELAYQIHEQCELLAKRTNLKI
FT                   GVVTGGINYGTHKEIFEKNNDILIATPGRLMEYLETENFHAEHVEMLIIDEADRMLDMG
FT                   FKKEMSRICDEAKNRRQCFLFSATLEGDSVERFAETTLNDPALLEAESSRKEKAKIHQW
FT                   VHLADDYHHKLELLVNTLNGPDVTKAIVFVKTRERLETLIGELTTNDVKAAWLRGEMPQ
FT                   DKRMKAMENFHSGKTRILVATDVAARGIDVADISHVINFDLPRTADIYVHRIGRTGRAG
FT                   KKGIAISLVEAHDIGILYKIERYIEQKLKRRVIKGLEPKHKEAKPPAKKRKDPVKMKAK
FT                   KKAKVKKKK"
     atgcaatttt ctgaatttga tcttgataac aagctactcg acgccattaa taaaatgggt        60
     tacgaaacgc caaccagcat tcaacaacaa gctattcctg aagcacttca ggggcgtgac       120
     attttagcat ctgcgcctac aggtacaggt aaaacagccg cctttttaat tccggctatt       180
     caatatttat tggattttcc gcgtcgtgat cctggttttg cgcgcgtatt agtaatgacg       240
     ccaactcgtg agctagctta tcaaattcat gaacaatgcg aactacttgc taaacgtact       300
     aaccttaaaa ttggggtagt aacaggcggt attaactatg gtacgcataa agagattttt       360
     gaaaaaaata atgacatttt aatcgccacc ccagggcgtt taatggaata tttagaaacc       420
     gaaaactttc atgctgaaca cgtagaaatg cttattattg atgaagccga ccgcatgcta       480
     gacatgggct ttaaaaaaga aatgagccgt atttgtgatg aagctaaaaa tcgtcgtcag       540
     tgctttttat tttcagcaac ccttgaaggc gacagtgttg aaagatttgc tgaaacaacg       600
     ctaaacgatc cagcattgct tgaagctgaa tcgtcacgca aagaaaaggc taaaattcac       660
     cagtgggtac atttagccga cgactatcat cataaacttg agctgttagt taataccctt       720
     aatggcccag acgtaactaa agccatagtg tttgttaaaa cccgtgagcg tcttgaaacg       780
     ctaattggtg aactaacaac taacgacgtt aaagcagcct ggttacgcgg cgaaatgccg       840
     caagacaaac gcatgaaagc gatggaaaac ttccatagcg gcaaaacccg tatattagtt       900
     gctaccgatg tagcggcgcg cggtatcgac gtggctgata ttagccatgt aataaacttt       960
     gacctaccac gcacagccga tatatacgta catcgtattg gccgtacggg ccgcgctggt      1020
     aaaaaaggca tcgctatttc actggttgaa gcgcacgata ttggcattct ttataaaata      1080
     gagcgctata ttgagcaaaa acttaaacgc cgtgttatta aaggattaga gccaaagcat      1140
     aaagaagcta agccgccggc taaaaagcgt aaagatccgg ttaaaatgaa agcgaagaaa      1200
     aaagctaagg ttaaaaagaa aaagtaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page