(data stored in ACNUC7421 zone)

EMBL: CR954246.SSEA

CR954246.SSEA        Location/Qualifiers
FT   CDS_pept        478765..479595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="PSHAa0459"
FT                   /product="putative 3-mercaptopyruvate sulfurtransferase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.8.1.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85556"
FT                   /db_xref="GOA:Q3IFQ9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ9"
FT                   /protein_id="CAI85556.1"
FT                   /translation="MKNIITNEQLYTQLNDPTLILFDAGMLRPGITGNYVAKAVLPNAQ
FT                   RFDIKNELADRSNPLPNTLCSETQFTQAMQKAGVNHDSLVVIYEDAGLFSAARAWWMFK
FT                   AMGFNNVKVLSGGLAKWLELGLPVESNYTQASLKGDFIAQYRPDYFIDKKQVLSATKDA
FT                   NTVILDARAYERFTGKSSEPRAGMRSGHIINSYSLPLTSLLENGEAKSLDFIQAKFSEL
FT                   VGNATHLQFSCGSGVTACALALFADECGYSNLSVYDGSWSEWGADNSLPIAVGG"
     atgaaaaata taattaccaa tgagcagcta tatacgcaat taaatgatcc tacattaata        60
     ttatttgacg cgggtatgct acgcccgggt ataaccggta actatgttgc taaagctgtg       120
     ctgcccaacg cgcagcgctt tgatattaaa aatgaactag cagatcgttc taacccgtta       180
     cctaatactt tgtgtagcga aacgcaattt actcaagcaa tgcaaaaagc gggagtgaat       240
     cacgattcac tcgtggtgat ttatgaagat gcagggttat tcagtgcagc tagagcttgg       300
     tggatgttta aagccatggg atttaataac gttaaagtcc tcagtggcgg tttagctaag       360
     tggcttgaac tcgggcttcc ggttgaatca aactatacac aagcatcact aaaaggcgat       420
     tttattgctc aataccggcc tgattacttt attgataaaa aacaggtgct aagtgctact       480
     aaggatgcca atactgtcat tttagatgcg cgtgcttatg agcgatttac tggcaaaagt       540
     agtgagccaa gagcgggtat gcgcagcggt catattatta acagttattc gctaccttta       600
     actagtctat tagaaaatgg tgaagcaaaa tcactcgact ttatacaggc aaagtttagt       660
     gaattagtcg gtaatgcaac ccacttacaa tttagctgtg gctctggcgt tactgcctgt       720
     gcgcttgcgc tgtttgccga tgaatgcggc tatagtaatt taagtgtgta cgatggctcg       780
     tggagtgaat ggggcgctga taactcactg cctattgctg tgggtggcta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page