(data stored in ACNUC7421 zone)

EMBL: CR954246.SUHB

CR954246.SUHB        Location/Qualifiers
FT   CDS_pept        complement(339326..340129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="PSHAa0323"
FT                   /product="inositol-1-monophosphatase"
FT                   /function="3.2 : RNA metabolism"
FT                   /function="3.3.6 : Protein modifications"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8002619, 10747806; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85422"
FT                   /db_xref="GOA:Q3ILB4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB4"
FT                   /protein_id="CAI85422.1"
FT                   /translation="MHPMLNIAVRAARNAGKIILRASEDLSKVEVQQKGTNDLVTNIDK
FT                   EAEAIIRDTILRSYPDHCIVGEELGEHKGKDADYQWIVDPLDGTTNFIKGIPHFAVSIA
FT                   LKVKGRLDQAVIYDPIRGELFTASRGQGAQLNSKRLRVSKTVDLGGSILATGFPFKQKQ
FT                   HLDAYTEAFKALFIHTADIRRAGSAALDMAYVAAGRVDGFFEIGLKPWDTAAGELLVKE
FT                   AGGMVVDFAGGVNYNNSGNIICGAPKLTQAIIREIRPVLTESLLR"
     atgcatccaa tgttaaacat tgcggttcgc gctgcgcgta acgcaggcaa aattatactt        60
     cgtgcaagtg aagatttatc aaaagttgaa gttcaacaaa aaggcactaa cgatttagtg       120
     actaacattg ataaagaagc tgaagctata attcgcgaca ccattttacg ctcttaccct       180
     gatcactgca ttgttggtga agaattaggc gagcataaag gtaaggatgc agattaccaa       240
     tggattgttg acccgcttga tggcacaact aacttcatca agggtattcc tcattttgcg       300
     gtttctatcg cacttaaagt aaaaggtcgt ttagaccaag ccgttattta tgatccaatt       360
     cgtggtgagc ttttcactgc ctctcgtggt caaggcgcac aacttaatag caaacgttta       420
     cgcgtttcta aaacagttga tttaggcggt tcaatcttag ctactggctt ccctttcaag       480
     caaaaacaac acctagatgc atacacagaa gcgtttaaag ctttattcat acatacagct       540
     gatatccgtc gtgcgggctc tgctgcgcta gacatggctt atgttgctgc tggacgcgtt       600
     gatggctttt tcgaaattgg tttaaaacct tgggatactg ctgcaggcga gctattagta       660
     aaagaagcag gcggcatggt tgtagatttt gctggcggcg taaactataa caatagtggt       720
     aacattatct gtggcgcacc taagctaact caagcaataa ttcgcgaaat tcgccctgta       780
     ttaactgagt cattacttcg ttaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page