(data stored in ACNUC7421 zone)

EMBL: CR954246.TESB

CR954246.TESB        Location/Qualifiers
FT   CDS_pept        152407..153264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="PSHAa0141"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="2.4.1.2 : Degradation"
FT                   /EC_number="3.1.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1645722; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85245"
FT                   /db_xref="GOA:Q3IF28"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF28"
FT                   /protein_id="CAI85245.1"
FT                   /translation="MSQVLDDLLSLLTLEEIEQGLYRGQSQDLGFGAVFGGQVMGQALS
FT                   AAKETLPEGRIVHSLHSYFLRPGDATKPIVYDVEAIRDGKSFSTRRVSAIQYGKPIFYM
FT                   TASFQGAEEGLSHQATMPDVPLPEELRSSLEFYKENAEQIPAAIRNQFISEMPIEIRPV
FT                   TFHNPFKPEAMEPVKHIWFKANGEMPDDQRIHNYLLAYASDFEFLPTALQPHGVSFMQP
FT                   NMQVATIDHAMWFHRPFRMDDWILYSVDSPSASSGRGLVRGQFFDRQGNLIASTMQEGV
FT                   MRQR"
     atgagccaag tattagatga tttattgtcg ttgttaacac ttgaagaaat tgagcaaggt        60
     ttgtatcgag ggcaaagcca agatttaggt tttggtgctg tatttggcgg ccaagttatg       120
     ggccaagcgc tatctgctgc aaaagaaacg ctaccagagg ggcgtattgt acattcactc       180
     cactcttact ttttacgccc aggcgatgcc actaagccta ttgtgtatga tgtagaagct       240
     attcgcgatg gtaaaagctt tagcactcgt cgggttagtg ctattcagta cggtaagcct       300
     attttttaca tgacagcgtc ttttcaagga gctgaagaag ggctgtcgca tcaggcgact       360
     atgcctgacg tacctttacc cgaagagctg cgttcatcgt tagagtttta taaagaaaac       420
     gccgagcaaa tacccgcagc tatacgcaat caatttatta gtgaaatgcc aatagaaata       480
     cgtccggtga cctttcataa cccatttaaa cctgaagcaa tggagcctgt taagcacatt       540
     tggtttaaag ctaacggtga aatgccagac gatcaacgta ttcataatta cttattagcg       600
     tacgcgtctg attttgaatt tttaccaact gctttgcagc cgcatggtgt gtcttttatg       660
     caacctaata tgcaagttgc cacgattgac catgcaatgt ggtttcatcg accatttaga       720
     atggatgatt ggattttata ctcagttgac agcccaagtg caagttctgg tcgagggtta       780
     gtaagagggc aattttttga ccgccaaggc aacttaattg cctcaacaat gcaagaaggg       840
     gttatgcgcc agcgctaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page