(data stored in ACNUC7421 zone)

EMBL: CR954246.TGT

CR954246.TGT         Location/Qualifiers
FT   CDS_pept        334722..335849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="PSHAa0319"
FT                   /product="Queuine tRNA-ribosyltransferase(tRNA-guanine
FT                   transglycosylase)(Guanine insertion enzyme)"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8323579, 1706703; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85418"
FT                   /db_xref="GOA:Q3ILB8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILB8"
FT                   /protein_id="CAI85418.1"
FT                   /translation="MKFELDTTDGKARRGRLIFDRGVIETPAFMPVGTYGTVKGMTPDE
FT                   VKATGAQVCLGNTFHLMLRPGTEIIKQHGGLHKFMNWDFPILTDSGGFQVFSLGAMRKI
FT                   TEEGVLFSSPVNGEKIMMTPESSMQVQRDLGSDIVMIFDECTPYPATEKEAKDSMELSL
FT                   RWAKRSKEGHGDNPSALFGIIQGGMYPELRAQSQAGLEEIGFDGYALGGLSVGEPKNEM
FT                   INILDHCAYKMPADKPRYLMGVGKPEDLVESVRRGIDMFDCVMPTRNARNGHLFITTGV
FT                   VKIRNAVHKTDTGPLDPECDCHTCGNYSRAYLHHLDKCNEILGARLNTIHNLRYYQRVM
FT                   EGLRNAISAGKLDEFVQDFYARRGQDVPELADITN"
     atgaaatttg aattagacac tacagacggt aaagcgcgcc gcggccgctt gatttttgac        60
     cgtggtgtaa tagaaactcc agcatttatg cctgtaggta cttacggtac tgttaaaggc       120
     atgacaccgg atgaagtaaa agcaacaggc gcgcaagttt gtttaggtaa tacgtttcac       180
     ctaatgctgc gcccaggcac tgaaatcatt aagcaacacg gtggtttaca taagtttatg       240
     aattgggatt tcccgattct aactgactca ggtggcttcc aggtgttcag cctaggtgct       300
     atgcgtaaaa ttaccgaaga aggcgtatta tttagctccc cagtaaatgg cgagaaaatt       360
     atgatgacgc cagaatcatc aatgcaagta cagcgcgact tgggttcaga tatcgtgatg       420
     atttttgacg aatgtacacc ataccctgct accgaaaaag aagctaaaga ttcaatggaa       480
     ttgtcacttc gctgggctaa acgctcaaaa gaaggccatg gcgacaaccc atctgcactg       540
     tttggtatta ttcaaggtgg tatgtaccca gagttacgtg cacaatcgca agccggactt       600
     gaagaaatag gctttgatgg ctatgcatta ggtggtttat cggtaggtga gccgaaaaac       660
     gaaatgatca atattcttga tcattgcgcg tacaaaatgc cagcagacaa accacgttat       720
     ttaatgggtg taggtaagcc agaagactta gttgagtcgg tacgccgtgg tattgatatg       780
     tttgactgtg ttatgccaac ccgtaacgct cgtaatggtc atttatttat aaccacaggt       840
     gtggttaaaa tacgtaacgc agtacataaa acagatactg gcccgcttga ccctgagtgt       900
     gattgccata cctgtggaaa ctactcacgt gcctatttac atcaccttga taaatgtaac       960
     gaaattttag gcgcacgatt aaacactatt cataacttac gttattatca acgtgttatg      1020
     gaaggcttac gtaacgcaat tagcgcaggt aagttagatg agttcgttca ggatttttat      1080
     gctcgccgtg gccaagacgt gccagagctt gcagatataa caaattaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page