(data stored in ACNUC7421 zone)

EMBL: CR954246.THIC

CR954246.THIC        Location/Qualifiers
FT   CDS_pept        497369..499321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="PSHAa0480"
FT                   /product="thiamine biosynthesis protein thiC"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85576"
FT                   /db_xref="GOA:Q3IFN9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN9"
FT                   /protein_id="CAI85576.1"
FT                   /translation="MSNTAKKSSRRETRAAASEYIYNLTGQPFPNSHKVYVEGTQNNIR
FT                   VGMREITLSDTYIGGSDENPVYEPNEPLRVYDTSGPYTDPNFKLDVRQGLAKFREQWIE
FT                   SRGDTELLESVTSRFTQQRMADEGLDHLRFEHLPKIRRGKAGKNVTQMHYARQGIITPE
FT                   MEYVAIRENMGRKKIHAELLAAQHKGESFGASIPDFITPEFVRDEIARGRAILPNNINH
FT                   PETEPMIVGRNFLVKVNANIGNSSVSSSIEEEVEKMVWSTRWGADTVMDLSTGRYIHET
FT                   REWVVRNSPVPIGTVPIYQALEKVNGVAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVLL
FT                   RYVPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYTHFEDICEILKQYDICFSLGDGLR
FT                   PGSIADANDEAQFSELRTLGELTKLAWKHDVQVFIEGPGHVPMHMIKANMDEQLKHCDE
FT                   APFYTLGPLTTDIAPGYDHITSGIGAAQIAWYGCAMLCYVTPKEHLGLPNKEDVKEGLI
FT                   TYKIAAHAADLAKGHPGAQERDNALSKARFEFRWHDQFNIGLDPERAREYHDETLPQES
FT                   GKVAHFCSMCGPKFCSMKISQEVREYAKDLEARGIDPANAADTITIKMIDVEAQMKAKS
FT                   DEFKKTGSEIYHKAI"
     atgtcgaata ctgcaaaaaa atcatcgcgt cgtgaaacgc gagccgctgc atctgaatat        60
     atttataact taacgggaca accgtttcct aattcgcaca aagtgtatgt tgagggtacg       120
     caaaacaaca ttcgtgtagg aatgcgtgaa ataaccctaa gcgatactta tataggcggc       180
     agtgatgaaa atccagtgta tgagccaaac gaaccgttac gtgtttacga cacatcaggc       240
     ccgtataccg atccaaactt taagcttgat gtacgccaag gcttagcaaa gtttcgtgaa       300
     caatggattg aaagccgcgg tgataccgag ttacttgaat cagttacttc acgttttacg       360
     caacaacgta tggcagatga agggcttgat catcttcgtt ttgagcattt accaaaaata       420
     cgccgcggta aagcgggtaa aaatgtcacg caaatgcatt acgctcgcca aggcattatt       480
     acccctgaaa tggaatacgt agcgatacgc gaaaacatgg gtcgcaaaaa aattcatgct       540
     gaactattag ccgcgcagca taaaggtgag tcatttgggg ccagtattcc tgattttatt       600
     acgcctgaat ttgtacgcga cgaaattgcg cgtggccgcg ctatattacc caacaatatt       660
     aaccaccccg aaaccgaacc tatgattgta gggcgtaact ttttggtaaa agtaaacgct       720
     aatattggta attcatcggt aagctcatcg attgaagaag aagtagagaa aatggtgtgg       780
     tctactcgct ggggcgccga taccgttatg gatttatcaa ccgggcgtta tattcatgaa       840
     actcgcgaat gggtagtacg taactcgcct gtacctattg gcacagttcc tatttatcaa       900
     gcgctggaaa aagtaaacgg cgtagcggag gacttaacct gggagatttt tcgcgatacg       960
     ttaatagagc aagctgaaca aggtgtcgat tactttacta ttcatgcagg tgtgctactg      1020
     cgttacgtac caatgaccgc aaaacgagta accggtattg tgtcgcgcgg tggctctatt      1080
     atggcaaagt ggtgtttagc gcaccataaa gaaaactttt tatacaccca ctttgaagat      1140
     atttgcgaaa ttttaaagca atacgatatt tgtttttcgc ttggcgatgg cttgcgccca      1200
     ggctcgattg ctgatgccaa cgatgaagct caatttagcg aattgcgcac cctaggtgag      1260
     ttgactaagt tagcctggaa acacgatgta caagtattta tagaaggccc cgggcatgtg      1320
     ccaatgcata tgattaaggc caatatggat gagcaactta aacattgcga cgaagcaccg      1380
     ttttacacct taggcccgtt aactactgat attgcacctg ggtatgacca tatcacctca      1440
     ggtattggtg cagctcaaat agcatggtac ggctgcgcta tgctgtgtta cgtaacacct      1500
     aaagagcatt taggtttgcc aaataaggaa gacgtaaaag aaggtttaat tacctataaa      1560
     attgctgccc atgccgccga tttagcaaaa ggtcaccccg gtgcgcaaga gcgtgataat      1620
     gccctatcaa aagcgcgctt tgagtttaga tggcatgacc aatttaatat tggtttagac      1680
     cctgagcgtg cccgcgaata tcacgatgaa acactcccgc aagagtcggg taaagtagcg      1740
     catttttgct ctatgtgtgg ccctaagttt tgctcaatga aaatcagtca agaagtacgc      1800
     gaatatgcaa aagatttaga agcgcgtggc attgaccctg ctaatgctgc agatacgatt      1860
     acaataaaaa tgattgatgt agaagcacaa atgaaagcta agtcggacga gtttaaaaaa      1920
     accggatcag aaatatatca taaagcgata taa                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page