(data stored in ACNUC7421 zone)

EMBL: CR954246.THIDE

CR954246.THIDE       Location/Qualifiers
FT   CDS_pept        501391..502917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiDE"
FT                   /locus_tag="PSHAa0484"
FT                   /product="putative phosphomethylpyrimidine
FT                   kinase/thiamin-phosphate pyrophosphorylase"
FT                   /function="2.5.10 : Thiamine"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.5.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85580"
FT                   /db_xref="GOA:Q3IFN5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN5"
FT                   /protein_id="CAI85580.1"
FT                   /translation="MNNVVWTIAGSDSGGGAGIQADIKAMQSFGVHGCTAITALTAQNS
FT                   LGVEAINAVSTDIIESQLLALEKDMKAKVIKIGMLANVQQIQLISEHISHYKAKWPVPP
FT                   VIVYDPVAIASSGDLLTEEDTVSAIKECLLPLVDVITPNTHETQLLTGVYLIGPAAIKE
FT                   AANKLLSWGAKAVVIKGGHWDYPSGYCIDYCINNFTQKGEEYWLGNEKIQTPHNHGTGC
FT                   SMASVIAACLAKDYPLKDAFILAKAYINQGLKVAVRYGEGIGPVAQTSFPTNLADYPQV
FT                   IEAGSWLGDELDFDVPLDFNMAADFAPCESKSLGLYAVVDSVDWLEKCLQQGVKTVQLR
FT                   VKNKDDAQLDELVAKAVALGEQYNAQVFINDYWQLAIKHGAYGVHLGQQDLENTNLAAI
FT                   KNAGLRLGLSTHGFYEMLRAHNYRPSYLAFGAIYPTTTKDMTGQIQGLEKLFKFVPLMQ
FT                   SYPTVAIGGIDLKRASQVAKTGVGSVAVVRAISEADDYVQAISALQAAIN"
     atgaataacg tagtatggac gattgccggc tctgattctg gcggtggcgc aggtattcaa        60
     gccgatataa aagcaatgca aagttttggt gtgcatgggt gcactgctat tacagcactg       120
     actgcgcaaa atagtttagg tgttgaggca attaatgccg tatctaccga tattattgaa       180
     tcgcagcttt tagcactcga aaaagacatg aaagccaaag ttattaaaat tggaatgtta       240
     gctaacgtgc agcaaattca attgatcagt gaacatataa gccattataa agccaaatgg       300
     ccagtgccgc ctgttattgt ttacgatcct gtggctattg cctccagcgg tgatttatta       360
     acagaggaag acacagtaag tgcgattaaa gaatgcttat taccgctggt ggatgtaata       420
     accccaaata cgcacgaaac tcagttatta actggcgtgt acttaattgg ccccgcggca       480
     ataaaagaag ctgccaataa gttattaagc tggggcgcaa aagctgtggt tataaaaggc       540
     ggacattggg attatccaag cggctactgt atagattact gcataaataa tttcactcaa       600
     aaaggcgaag aatactggct gggaaatgaa aaaattcaaa cgccacataa tcatggtaca       660
     ggctgcagta tggcctcggt tattgctgct tgcttagcaa aagactaccc gttaaaagat       720
     gcgtttattt tagctaaagc ttatattaat caaggcttga aagtagcggt gcgctacgga       780
     gaaggaattg gcccagtagc acaaacctca tttccaacca acttagccga ttacccccaa       840
     gtaatagaag cgggcagttg gttaggtgat gaactcgatt ttgacgttcc gcttgatttt       900
     aatatggctg cagattttgc accctgcgaa agtaaatcat taggtttata cgcagtggtt       960
     gatagtgttg actggctaga aaagtgctta caacaaggcg ttaaaactgt gcagttacga      1020
     gttaaaaata aagacgatgc acaacttgac gaattagtgg caaaagcggt ggcactgggg      1080
     gagcaatata atgcgcaggt atttataaac gactattggc aacttgcaat taagcatggt      1140
     gcatatggtg tgcatttagg ccaacaagat ctagaaaaca ctaatttagc ggcgattaaa      1200
     aatgcagggc ttaggctcgg gctttctaca catggcttct atgaaatgct ccgcgcacat      1260
     aattaccgcc caagttattt ggcatttggc gctatttatc ctaccactac caaagatatg      1320
     acagggcaaa tacagggact ggaaaagtta tttaaatttg tccccttaat gcaaagctac      1380
     ccaacagtgg caattggcgg tatagattta aagcgcgcca gccaagttgc taaaacaggc      1440
     gttggtagtg tggctgtggt acgtgcaatt agcgaagccg atgattatgt gcaggcaata      1500
     agtgcgttgc aagcggcaat aaattaa                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page