(data stored in ACNUC7421 zone)

EMBL: CR954246.THIF

CR954246.THIF        Location/Qualifiers
FT   CDS_pept        502940..503686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="PSHAa0485"
FT                   /product="putative adenylyltransferase; thiamine
FT                   biosynthesis protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9632726, 8432721; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85581"
FT                   /db_xref="GOA:Q3IFN4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN4"
FT                   /protein_id="CAI85581.1"
FT                   /translation="MNELSDKEMLRYSRHILLKEVGLAGQLKLKSASVAVVGAGGLGSP
FT                   ALLYLAAAGIGKLILIDDDAVELSNLQRQVLYKVNHLGQKKVVAAGKVLASLNNQITII
FT                   THAEKLTQDNSAALLNNADIVLDCSDNFTTRYSVNRFCVQHKTPLISGAALATKGQLIS
FT                   LDLRNANSPCYGCIFPQSDIAPLINCDNAGVISPLLGIIGSMQAQLTLNMLLSHSSDCV
FT                   FMSINALTLQQQQFKVVKDIDCKECR"
     atgaatgaac ttagcgataa agaaatgctg cgctatagtc gtcatatatt gcttaaagaa        60
     gtgggacttg cagggcagtt aaagcttaag tcggcaagtg ttgcagtagt aggtgcgggc       120
     ggcttaggca gccccgcatt actgtattta gctgctgcgg gtattggtaa gcttatttta       180
     attgatgatg atgcggttga gctttcgaac ttacagcgtc aggtgctgta taaagtgaat       240
     cacttagggc aaaaaaaggt ggttgcagca ggtaaagtgc ttgcaagtct gaataaccaa       300
     atcactataa ttactcacgc cgaaaagctt actcaagata atagcgcagc actactcaat       360
     aatgcggata ttgtgttgga ttgcagtgat aactttacca ctcgttacag tgttaatcgc       420
     ttttgtgtac agcataaaac cccattaatc tccggtgcgg cactggcaac aaaagggcag       480
     ctgattagct tagacttaag aaatgctaat agcccgtgtt atggctgtat ttttccacaa       540
     agcgatattg cgccgcttat caattgtgat aacgccggag taattagtcc gctgttaggt       600
     attatcggct caatgcaggc gcagctgaca ctcaatatgt tattaagtca ttctagcgat       660
     tgtgtgttta tgagtattaa tgcactcact ttgcagcagc aacaatttaa agtggtgaaa       720
     gatatcgact gtaaggagtg taggtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page