(data stored in ACNUC7421 zone)

EMBL: CR954246.THIG

CR954246.THIG        Location/Qualifiers
FT   CDS_pept        500588..501379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PSHAa0483"
FT                   /product="thiazole biosynthesis protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85579"
FT                   /db_xref="GOA:Q3IFN6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN6"
FT                   /protein_id="CAI85579.1"
FT                   /translation="MPNNDYLTIYGEQIKSRLLIGSALYPSPAVMNESIVASGAEIVTV
FT                   SLRRQQSAAAGDDFWQLIKNTGLKILPNTAGCHSVKEAITLAKMCREVFATDWIKLELI
FT                   GDDYNLQPDPFALLEATKILIDDGFKVLPYCTDDLVLCQRLNALGCEVLMPWGAPIGTG
FT                   KGLLNSYNLKTIRERLPEATLIVDAGLGLPSHACQALELGYDAVLLNSAIAGAGCPITM
FT                   SRAFKAAVEAGRFAYNAKAMPEKDVAAPSTPTMGMPFWHQE"
     atgccaaata atgactattt aactatttat ggtgagcaaa taaaaagccg attactaata        60
     ggctcggcgc tttacccgtc gcctgcagtg atgaatgaat cgattgttgc atcgggcgct       120
     gaaatagtca cggtgtcgct taggcgtcag caaagtgcgg ctgcgggtga tgatttttgg       180
     cagttaataa aaaatactgg gcttaaaatt ttaccaaata cagcaggatg tcatagtgtt       240
     aaagaggcca ttacgcttgc taaaatgtgc cgtgaagtgt ttgctaccga ttggattaag       300
     cttgaactga taggggacga ttacaacttg cagcccgatc cgtttgcact gttagaagca       360
     actaaaatac tgatcgacga tggctttaaa gtactgccat attgcacaga cgatttagtg       420
     ctgtgccagc gtttaaatgc tttaggctgt gaagtattaa tgccatgggg tgcacccatt       480
     ggtacaggta aaggcttgtt aaacagttat aatttaaaaa caatcagaga gcgcttacct       540
     gaggcaacgt taatagtgga tgctggttta ggtttgccct cgcatgcctg ccaagcactt       600
     gaactagggt atgatgcagt attattaaat tcggcgattg ccggagcggg ttgccctata       660
     accatgagcc gagcatttaa agccgcggta gaggctggac gttttgcata taacgccaaa       720
     gcaatgcctg aaaaagacgt tgcagcccct tcaaccccga ctatgggtat gccattttgg       780
     catcaagaat aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page