(data stored in ACNUC7421 zone)

EMBL: CR954246.THIO

CR954246.THIO        Location/Qualifiers
FT   CDS_pept        499379..500380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="PSHAa0481"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85577"
FT                   /db_xref="GOA:Q3IFN8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN8"
FT                   /protein_id="CAI85577.1"
FT                   /translation="MFYNIAVVGFGLTGRLAALELSKQHRVTVFEADDEHSQNSAGKVA
FT                   AAMLAPLAESVLCEADLALMGLDSIKRWPGIIDKLDSEVFFQQQGTLVVAHQQDKGDLL
FT                   SFAQRLKPLANYTGESVNSQQIEMLEPELANRFSQGLFLPCDGQIDNQAFYQASFTQLN
FT                   KRKVKFVFNQRVTINDNKINNREFDYIIDCRGLGAKDDKPLRGVRGEVARLYAPEVSLT
FT                   RPVRLMHPRYPIYIAPKPNNEYVIGATEIESQDTGPATVRSALELLSAAYTVHSGFAEA
FT                   RLLNIQTGLRPAFSDNRPQVTHVGRVISINGLYRHGYMLAPSLVANALLCIE"
     atgttttaca atatagcggt agtggggttt ggtttaaccg gtaggttggc ggcgcttgag        60
     ctgagtaagc aacaccgagt tactgtattt gaggcagatg atgagcactc tcaaaacagc       120
     gcaggcaagg tggctgcggc tatgcttgct cctcttgctg agtcggtatt gtgcgaggct       180
     gatttagctt taatggggct tgattctata aagcgttggc ctgggattat agataagctt       240
     gatagtgagg ttttttttca gcagcagggc acattagttg tcgcgcatca gcaagataaa       300
     ggcgatttac taagctttgc tcagcggcta aaaccgttag ctaattatac cggggagtcg       360
     gtgaattccc agcaaattga aatgttagag cctgagcttg ctaatcgttt tagtcaggga       420
     ttatttttac cctgtgacgg gcaaatagat aatcaggcat tttatcaagc cagctttaca       480
     cagctcaaca aacgcaaagt aaagtttgta tttaatcaac gggtaacgat taacgataat       540
     aaaattaata accgagagtt tgattatatt attgattgcc gagggcttgg cgcaaaagat       600
     gacaagcctc tgcggggcgt gcgtggagaa gtagctaggt tatacgcgcc agaggtgagt       660
     ttaacgcgac ccgtgcgctt aatgcatccg cgttacccca tttatatagc gcctaaaccc       720
     aataatgaat atgtaattgg cgcgactgaa atagagtcgc aagatacagg cccagccaca       780
     gtgcgctctg ctttagagtt actttcggca gcttatacgg tgcacagcgg ttttgccgaa       840
     gcgcggctat taaatattca aacaggatta cgcccggcat ttagcgataa ccgcccacaa       900
     gtaacacacg ttgggcgagt tattagcatt aatggcttat atcgtcatgg ttacatgtta       960
     gcgccaagtt tagtggcaaa tgccctttta tgcatagagt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page