(data stored in ACNUC7421 zone)

EMBL: CR954246.THIS

CR954246.THIS        Location/Qualifiers
FT   CDS_pept        500388..500582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PSHAa0482"
FT                   /product="putative ThiS protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10382260"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85578"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN7"
FT                   /protein_id="CAI85578.1"
FT                   /translation="MNITINGELIAISSNKLINCLQDFGGVAPFAVAINGEFIPQSQHS
FT                   DYQLTEGDSIELLSPIQGG"
     atgaacataa caattaatgg tgagttaata gctattagca gtaataagct cattaactgt        60
     ttgcaagatt ttggtggtgt tgcaccattt gcggtggcga ttaatggtga gtttataccg       120
     caaagccagc atagcgatta tcaattaact gagggtgata gtattgagct gctctcgccg       180
     attcagggtg gataa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page