(data stored in ACNUC7421 zone)

EMBL: CR954246.TRKA

CR954246.TRKA        Location/Qualifiers
FT   CDS_pept        complement(22631..24007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PSHAa0020"
FT                   /product="Trk system; major constitutive K+ transport
FT                   system; potassium transport inner membrane protein subunit;
FT                   six transmembrane channel"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10214935, 10490030, 11301020; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85134"
FT                   /db_xref="GOA:Q3IDH2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH2"
FT                   /protein_id="CAI85134.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGEQNEITVVDIDGNRLRELQDKYDL
FT                   QGVAGHGAHPDVLRRAGAEDADMIIAVTSSDEVNMVACQVAYSIFNTPTKIARIRSEQY
FT                   LKYREKLFHNDDLPVDHYIAPEALVTKYIRRLIDYPGALQVLQFADGMLSLVAVKAYYG
FT                   GLLVGYALSTLKQHIPNVETRVAAIYRQGKAIKPLGTTIIEADDEVFFIAATKHIRAVM
FT                   NELQRLERSYKNIMIAGGGNIGAGLARSLEKNHSVKLIERSKERAEQLSEMLDNTIVFC
FT                   GDASDQELLSEEHIDQVDVFIAVTNDDEVNIMSAMLAKRMGAQKTMVLIQRSAYVDLVQ
FT                   GGDIDIAISPQEATISALLTHVRRGDIVNVYSLRKGAAEAIEAVAHGDENTSKVVGRTV
FT                   RDIKLPAGTTIGAVVRNDDVLIAHDDTIIMSGDHVIMFLIDKKHINIVEKLFQVSAIFL
FT                   "
     atgaaaataa tcatactcgg agctggccaa gtaggcggca cactagctga aaatttagtt        60
     ggtgaacaaa acgaaataac ggtcgttgat attgacggca accgcttacg cgagcttcaa       120
     gataagtatg acctacaagg cgttgctggt cacggcgctc acccagatgt acttcgcaga       180
     gccggtgcgg aagacgccga tatgattatc gcggtaacca gttcagatga agtaaacatg       240
     gttgcctgcc aagttgcgta tagtattttt aataccccga ctaaaatagc ccgaattcgt       300
     tctgagcaat atttaaagta tcgtgaaaag ctgtttcata acgatgactt gccggtcgat       360
     cactatattg ctcctgaggc attagtaact aagtacattc gccgcttaat agactaccca       420
     ggcgcattgc aagtgctgca gtttgccgat ggcatgctct ctttggttgc tgtaaaagct       480
     tactatggcg gtttattagt aggttatgcg ctatctacgc ttaaacagca tattcccaat       540
     gtggaaactc gtgtagccgc tatttatcgc caaggaaaag cgataaaacc tctaggcaca       600
     acaattattg aagccgatga tgaagtgttt tttatagcag ccactaaaca catccgcgcc       660
     gttatgaacg aactccaaag gttagagcgt tcatataaaa acattatgat tgctggtggc       720
     ggtaatatag gcgcaggcct agcgcgctca ctggaaaaaa atcacagtgt aaaattaatt       780
     gagcgcagca aagagcgcgc cgagcaactc tctgaaatgc tcgacaacac gattgttttt       840
     tgcggagatg cgtcagacca agagctattg tcagaagagc atatagatca ggttgatgtg       900
     tttattgctg taaccaacga tgatgaagta aatataatgt cggccatgct agcaaaacgt       960
     atgggcgcac aaaaaaccat ggtacttatt caacgcagtg catacgttga cttagtacaa      1020
     ggcggcgata ttgatattgc aatttcacca caagaagcca ctatttcggc attacttact      1080
     catgttcgcc gcggcgatat tgttaacgta tattcactac gcaaaggtgc agctgaagct      1140
     attgaagctg ttgcccatgg tgatgaaaat acatctaaag tagttggccg aactgtaagg      1200
     gatataaaac tcccagcagg tactactatt ggtgctgtag tacgtaacga cgacgtgctt      1260
     attgcccacg acgataccat tattatgtcg ggcgaccatg tcatcatgtt cttaattgat      1320
     aaaaagcaca ttaatattgt agaaaaacta tttcaggtga gcgctatatt tttatag         1377
//

If you have problems or comments...

PBIL Back to PBIL home page