(data stored in ACNUC7421 zone)

EMBL: CR954246.TRKH

CR954246.TRKH        Location/Qualifiers
FT   CDS_pept        19070..20521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="PSHAa0015"
FT                   /product="potassium transport protein, requires TrkE (Trk
FT                   family)"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85129"
FT                   /db_xref="GOA:Q3IJ19"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ19"
FT                   /protein_id="CAI85129.1"
FT                   /translation="MQFRTIIKILGQLVALFSITMVPPAIVSLIYKDGGGVPFVLAFIF
FT                   SVTIGLMAYYPNRHEDGDLKAREGFLIVVLFWLVLGAFASLPLIFLQEPNLSLADAVFE
FT                   AFSGLTTTGATVLTGIEYLPKSVLFYRQQLQWFGGMGIIVLAVAILPMLGVGGMQLYRA
FT                   EIPGPVKDSKMTPRIADTAKHLWYIYVSITLACTLAYWIAGMDWFDAISHAFSTVAIGG
FT                   FSTYDASMGHFDSPVINFICVFFLIIAAINFSLHYAAVASRNISVYIRDPEFKVFLCIQ
FT                   LALVVICFTVLSSHEVYANGDETLDQALFHAVSISSTAGFATDNFSAWPLFLPILLIFS
FT                   SFIGGCAGSTGGGMKVVRVFLLYLQGVRELNRLVHPRAIYSIKLGSKALPDKVVEAVWG
FT                   FFSAYALVFIIIMLALMGTGMDNITAFSATAACLNNLGPGLGDVASHYGSISDGAKWLL
FT                   TIAMVFGRLEIFTLLVLFTPTFWRG"
     atgcaatttc gtaccattat aaaaatcctt gggcaacttg ttgcactgtt tagtattacc        60
     atggtgcctc cggcaatcgt gtctttaatt tataaagacg gtggtggtgt tccttttgtt       120
     ttggctttta tttttagtgt cactattggc ttaatggctt attaccctaa ccgccacgaa       180
     gatggcgatt taaaagcgcg ggaagggttt ttaattgttg tgttgttttg gttggtactt       240
     ggcgcgtttg catccttacc gctgatattt ttacaagagc caaacctatc actggctgat       300
     gcggtatttg aagcgttttc ggggttaacc accaccggag caacggtact aaccggtata       360
     gagtacttgc ctaaatcggt attattttat cgccaacaac tacagtggtt tggcggtatg       420
     gggatcattg tattggcggt tgctatttta cctatgctag gggttggtgg tatgcagcta       480
     tatcgcgccg aaataccagg gccagtaaaa gactctaaaa tgaccccgcg aattgccgac       540
     accgcaaagc acctttggta tatatatgtg tcaattacgc ttgcgtgtac cttggcatat       600
     tggattgcag gtatggattg gtttgacgca ataagccatg cgttctcaac ggtcgccatt       660
     ggtgggtttt ctacttatga tgcctctatg gggcattttg atagcccagt aattaacttt       720
     atttgtgtgt tctttttaat tattgcagcc attaactttt cactgcatta cgctgcggta       780
     gcaagtagaa atatcagtgt ttatattcgc gaccctgagt ttaaagtgtt tttatgtatt       840
     cagttagcgc tggtggtgat ttgctttacc gtgctttcgt ctcatgaagt gtatgcgaat       900
     ggcgatgaaa cactcgacca agcgctattt catgctgttt caattagcag tacggcagga       960
     tttgccaccg ataacttttc ggcttggcca ttatttttac caatactgct tatattttcg      1020
     agctttatag gtggctgtgc gggctctacc ggtggcggta tgaaagtggt gcgcgtattc      1080
     ttactatact tacaaggcgt gcgagagctt aataggctag tgcatcctcg ggctatatat      1140
     tctatcaagt taggcagcaa agcgttgcca gacaaagtag tagaagctgt atgggggttt      1200
     ttctcagcgt acgcattggt gtttataatt attatgctag cgctgatggg aaccggtatg      1260
     gataacatta cagcattttc tgctactgca gcgtgtttaa ataaccttgg cccgggctta      1320
     ggagatgttg catcgcacta tgggtctatt agtgatggtg ctaaatggtt gcttactatt      1380
     gctatggtat ttggccgttt agaaatattt actttattag tgctgtttac gcctacattt      1440
     tggcgcggat aa                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page