(data stored in ACNUC7421 zone)

EMBL: CR954246.TRMA

CR954246.TRMA        Location/Qualifiers
FT   CDS_pept        complement(261601..262704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="PSHAa0250"
FT                   /product="tRNA (Uracil-5-)-methyltransferase
FT                   (tRNA(M-5-U54)-methyltransferase) (RUMT)"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.1.1.35"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1999392, 1447162; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85353"
FT                   /db_xref="GOA:Q3ILM2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILM2"
FT                   /protein_id="CAI85353.1"
FT                   /translation="MAVIKIDTSQYDAQLSEKEQRIAAQFQRFGVDKLEVFSSEPINYR
FT                   QRAEFRVWHDGDDLFHIMFDQQTKDKIRVDSFDPAAPLVGEVMQVMIDNLKSCEILRRK
FT                   LFQIDYLSTLSGEILVSLLYHKPLDEHWLSEINTLKEKLSSKYKIDFIGRARKQKEMLG
FT                   DDYVTERLNVNGQELIYQQVENSFTQPNAKVNIKMLEWAQDLCKPLKNDLLELYCGNGN
FT                   FSIALAGSFNKVLATEISKSSVHSAQYNIAQNKVDNLDIIRMSSEEFTQAMNGERSFSR
FT                   LEGIDLNSYNCQTILVDPPRAGMDTLTCDLVANYESIIYISCNPETLERDLDHLTRTHE
FT                   VKRFAIFDQFPYTHHIESGVFLQKKNT"
     atggcagtta ttaaaataga cacctcacag tacgatgcgc agttaagcga aaaagaacag        60
     cgtattgctg cccaatttca acgttttggt gtggataaac ttgaggtatt tagctcagag       120
     ccgattaact accgccaacg cgctgagttt agagtatggc acgatggtga cgatctgttt       180
     catataatgt ttgatcaaca aactaaagac aaaattcgcg ttgatagctt tgaccctgcc       240
     gctcctttgg taggtgaagt gatgcaagta atgattgata atttaaagtc gtgtgaaatt       300
     ttgcgtcgta aactatttca gattgattac ttatctacgc taagcggtga gattttagtg       360
     agtctgttat atcacaagcc acttgatgag cattggctga gtgaaattaa cacgcttaaa       420
     gaaaagttaa gcagtaagta taaaattgac tttattggcc gtgcccgcaa acaaaaagaa       480
     atgcttggtg atgactacgt taccgaacgc ttaaacgtga atggccaaga actaatatat       540
     cagcaggtag aaaacagctt tacccagcca aatgccaaag taaacattaa aatgctagag       600
     tgggcgcaag acttatgtaa gccacttaaa aatgatttac ttgaacttta ttgtggtaac       660
     ggtaactttt ctattgcgtt agcgggctcg tttaataaag tactagcaac cgaaatatca       720
     aagtcgtcgg tacactcagc gcagtacaat atagcgcaaa acaaggtaga caatttagat       780
     attattcgta tgtcgagcga agagtttact caagccatga atggcgaacg cagtttttct       840
     cgtttagaag gtatagattt aaatagctac aattgccaaa ccattttagt tgatccgcca       900
     cgtgccggta tggataccct aacgtgtgac ttagtagcaa attacgaaag tattatttat       960
     atttcgtgta acccagagac actagagcgc gaccttgatc acttaacccg cacccatgaa      1020
     gttaaacgct ttgcgatttt tgatcagttc ccttatacgc accatattga gtcgggtgta      1080
     tttttacaaa aaaagaatac ttaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page