(data stored in ACNUC7421 zone)

EMBL: CR954246.TRXA

CR954246.TRXA        Location/Qualifiers
FT   CDS_pept        complement(120291..120617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="PSHAa0113"
FT                   /product="thioredoxin 1, redox factor"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85222"
FT                   /db_xref="GOA:Q3IDJ0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ0"
FT                   /protein_id="CAI85222.1"
FT                   /translation="MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSE
FT                   VAEEFDGRVTIAKLNIDQNAGTPPKFGIRGIPTLLLFKDGQVAATKVGALSKTQLIEFL
FT                   ENNL"
     atgagcgaga aaataatcca aattactgac gatagctttg aagctgacgt attacaatca        60
     gacaagcctg tactagtaga cttttgggct gagtggtgcg gaccttgtaa aatgatcgcc       120
     cctatcctta gtgaagttgc tgaggaattt gatggtcgcg ttaccatagc taaacttaat       180
     atcgatcaaa atgcgggtac accgcctaaa tttggtattc gtggtatccc tacattactt       240
     ctttttaaag atggccaagt tgctgcaact aaagttggcg cactttcaaa aactcaatta       300
     atcgagtttt tagaaaacaa tctttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page