(data stored in ACNUC7421 zone)

EMBL: CR954246.TUFA

CR954246.TUFA        Location/Qualifiers
FT   CDS_pept        239981..241165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="PSHAa0227"
FT                   /product="protein chain elongation factor EF-Tu;
FT                   GTP-binding factor"
FT                   /function="3 : Information transfer pathways"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /function="3.3.4 : Elongation"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85330"
FT                   /db_xref="GOA:Q3ILP4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP4"
FT                   /protein_id="CAI85330.1"
FT                   /translation="MAKAKFERVKPHVNVGTIGHVDHGKTTLTAAITNVLAKVYGGVAK
FT                   DFASIDNAPEERERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPLIQGSALKALEGEKEWEDKIVELANALDSYIPEPQRDIDKPFIMPIEDVFSIQ
FT                   GRGTVVTGRVEAGIIRINDEIEIVGIRDTTKSICTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREDVERGQVLAKPGSIKPHTTFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   DVQLPEGVEMVMPGDNVKMTVTLIAPIAMDEGLRFAIREGGRTVGAGVVANIVA"
     atggcaaaag caaagtttga acgcgtaaaa ccgcatgtaa acgtaggtac aatcggccac        60
     gttgaccacg gtaaaactac actaactgca gcaatcacta acgtacttgc aaaagtatac       120
     ggcggtgttg ctaaagattt cgcatcaatc gataacgctc cagaagagcg cgaacgtggt       180
     atcactattt caacgtctca cgttgaatac gatacaccta cacgtcacta cgcacacgta       240
     gattgtcctg gtcacgccga ttatgttaaa aacatgatca ctggtgctgc tcaaatggat       300
     ggcgctatct tagtagttgc tgcgactgat ggccctatgc cacaaacgcg tgagcacatc       360
     ctactttctc gtcaagttgg cgttccttac atcatcgtgt tcatgaacaa atgtgacatg       420
     gttgatgacg aagagctact tgagctagta gaaatggaag ttcgtgaact tctttcagaa       480
     tacgatttcc caggtgatga cttaccacta attcaaggtt cagcacttaa agcgcttgaa       540
     ggcgagaaag agtgggaaga taagattgtt gagcttgcaa acgcacttga ttcttacatt       600
     ccagagccac agcgtgacat cgataagcca ttcatcatgc ctatcgaaga cgttttctca       660
     atccaaggcc gtggtactgt tgtaactggt cgtgttgaag ctggtattat ccgcatcaac       720
     gacgagattg aaattgttgg tatccgtgat acaactaagt caatctgtac tggtgttgaa       780
     atgttccgta aactgcttga cgaaggtcgt gctggtgaga acattggtgc acttttacgt       840
     ggtactaagc gtgaagacgt tgaacgtggt caagtactag ctaagcctgg ttcaatcaag       900
     ccacacacta cttttgaatc agaagtatac gtactttcaa aagatgaagg tggtcgtcat       960
     actccattct tcaaaggtta ccgtccacag ttctacttcc gtacaactga cgtaactggt      1020
     gacgtacagt taccagaagg cgtagaaatg gtaatgcctg gtgataacgt taagatgaca      1080
     gtaactctaa tcgcgccaat cgcgatggac gaaggtcttc gtttcgctat ccgtgaaggt      1140
     ggtcgtactg taggcgctgg cgttgttgca aacatcgtag cgtaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page