(data stored in ACNUC7421 zone)

EMBL: CR954246.TYPA

CR954246.TYPA        Location/Qualifiers
FT   CDS_pept        176578..178401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PSHAa0167"
FT                   /product="GTP-binding protein TypA/BipA (Tyrosine
FT                   phosphorylated protein A); involved in LPS core synthesis"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12654836, 12675808; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85271"
FT                   /db_xref="GOA:Q3IFK9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFK9"
FT                   /protein_id="CAI85271.1"
FT                   /translation="MSIEKIRNIAIIAHVDHGKTTLVDKLLEFSGTLETRGGNEERVMD
FT                   SNDIERERGITILAKNTAISWNGYHINIVDTPGHADFGGEVERVLSMADSVLLIVDAQE
FT                   GPMPQTRFVTQKAFAQGLKPIVVINKIDKPSARPDWVMDQIFDLFDNLGATDEQLDFKV
FT                   IYASAINGWATLDLDEPSDNMDAMFQMIVDEVSPPDADPEGDFQMQISQLDYNSYVGVI
FT                   GVGRIKRGSVAPNQQVTIISADGTKRNGKIGTVQSYLGLDRIETDRGYAGNIVTVTGIG
FT                   ELKISDTVCCPTNVEALPPLSVDEPTVTMTFSVNNSPFCGKEGKFVTSRNIRERLDKEL
FT                   VHNVALRVEDTASPDSFRVSGRGELHLGILIENMRREGYELAVSRPEVILRTVDGVLEE
FT                   PFETVTIDCQEEHQGSVMEQVGLRKGELTNMSPDGKGRMRLDFIIPSRGLIGFQTDFMT
FT                   LTSGSGLMYHTFDHYGPHKGGSIGVRKNGVIIANATGKALTNALFNLQERGRLFIGHGV
FT                   EVYEGMVIGIHNRDNDLTVNALKGKQLTNVRASGTDEAQTLSPPLNYSLEQALEFIDED
FT                   ELVEVTPLNIRIRKRHLTENERKRAGRAPKS"
     atgagtatcg aaaagataag aaatatagca attatcgccc acgttgacca cggtaaaact        60
     acactggttg acaaactgct tgagttttca ggcacattag aaacacgcgg cggtaatgaa       120
     gagcgcgtga tggattcaaa cgatatagaa agagaacgtg gtattaccat tttagcgaaa       180
     aacaccgcta tttcatggaa cggctaccac attaatatcg tagatactcc aggacacgcc       240
     gatttcggtg gtgaagtgga acgcgtactt tcaatggctg actcagtatt actaattgtt       300
     gacgctcaag aaggcccaat gccacaaacg cgttttgtta cgcaaaaggc atttgcgcaa       360
     ggtttaaagc caatcgtagt aattaacaaa atcgacaagc caagtgcacg tcctgattgg       420
     gttatggatc aaatctttga tttattcgat aacttaggcg ccactgacga gcagttagat       480
     tttaaagtaa tctatgcatc agcaatcaac ggctgggcaa cattagattt agacgagcca       540
     tctgataaca tggatgccat gttccaaatg atcgttgacg aagtatcacc accagatgca       600
     gatcctgaag gtgacttcca aatgcagatt tctcaacttg attacaactc atacgtgggt       660
     gtaattggtg ttggtcgtat caagcgtggt tctgttgctc caaaccaaca agtaactatt       720
     attagtgctg atggtactaa acgtaacggt aaaattggta cagtacaaag ctacttaggc       780
     cttgaccgta tcgaaactga ccgtggttat gcaggtaaca ttgttactgt aaccggtatt       840
     ggcgagctta agatttcaga tactgtttgt tgtcctacta acgttgaagc attaccacca       900
     ctaagtgttg atgagccaac agtaacaatg acattctctg taaataactc acctttttgt       960
     ggtaaagaag gtaagtttgt aacgtcacgt aatattcgtg agcgtttaga caaagaatta      1020
     gtacacaacg tagcacttcg cgttgaagat actgctagcc cagatagctt ccgtgtttct      1080
     ggccgtggtg agttacacct aggtatctta atcgaaaaca tgcgtcgtga aggttacgag      1140
     cttgcagtat ctcgtccaga ggtaattttg cgtactgttg acggtgtatt agaagaaccg      1200
     tttgaaacag taacaattga ctgtcaagaa gagcatcagg gttctgtaat ggagcaagtt      1260
     ggcctacgta aaggtgagct tactaacatg tctccagatg gcaaaggccg tatgcgttta      1320
     gactttatta tcccaagccg tggcttaatt ggtttccaaa ctgatttcat gacacttact      1380
     tcgggttctg gtcttatgta ccatacgttc gatcattacg gtcctcataa aggcggttca      1440
     atcggtgttc gtaaaaacgg cgtaatcatt gcaaatgcta caggtaaagc actgactaac      1500
     gcattgttta acttacaaga gcgcggccgt ttattcatcg gccacggtgt tgaagtttac      1560
     gaaggtatgg ttatcggtat tcataaccgt gataacgacc ttacagttaa cgcccttaaa      1620
     ggtaagcagt taactaacgt acgtgcatct ggtacagatg aagcacaaac gctttctcca      1680
     cctttaaact attcacttga gcaagcgctt gagtttattg atgaagatga gttagttgaa      1740
     gtaacgccac taaacattcg tattcgtaag cgtcatctta cagaaaacga acgtaaacgt      1800
     gcgggtcgtg ctcctaagtc ataa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page