(data stored in ACNUC7421 zone)

EMBL: CR954246.TYRZ

CR954246.TYRZ        Location/Qualifiers
FT   CDS_pept        559119..560318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrZ"
FT                   /locus_tag="PSHAa0545"
FT                   /product="Tyrosyl-tRNA synthetase II"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12572618, 11834741; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85633"
FT                   /db_xref="GOA:Q3ILJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ9"
FT                   /protein_id="CAI85633.1"
FT                   /translation="MDLQTALAEIKRGTEEILIEDELVEKLKSGKKLKIKAGFDPTAPD
FT                   LHLGHTVLINKMKTFQDLGHEVVFLIGDFTGMIGDPTGKNVTRKPLTREDVLANAETYK
FT                   EQVFKILDPAKTTVAFNSTWMENLGAAGMIKLAARQTVARMLERDDFKKRYASGQSIAI
FT                   HEFLYPLVQGWDSVALEADVELGGTDQRFNLLMGRELQKDEGQKPQTVIMTPLLEGTDG
FT                   VQKMSKSLGNYIGITDAPNDMFGKIMSISDVLMWRYYDLLSGLSIAGINAQKERVEQGT
FT                   NPRDIKIELAKELIARFHSEADAQAAHDDFIQRFQKKALPDEIPELTVTIEQDSILIAN
FT                   LLKEANLVASTSEAMRMIKQGAVKLNGEDKITDTKLEIAKGSTAIYQVGKRKFANITVA
FT                   "
     gtggatttac aaaccgctct tgcagagata aaacgcggta cagaagagat attaattgaa        60
     gatgagttag ttgaaaaatt aaaatctgga aaaaaactaa aaattaaagc gggctttgat       120
     ccaaccgcgc ctgatttaca cttaggtcac acggtactta ttaataaaat gaaaaccttt       180
     caggacttag gtcatgaggt tgtattttta attggtgact ttaccggtat gattggcgac       240
     ccaacaggta aaaacgtaac gcgtaagccg cttactcgcg aagacgtgct tgctaatgct       300
     gagacttata aagagcaagt atttaaaatt cttgatccgg caaaaaccac ggtcgcattt       360
     aattctacct ggatggaaaa tttaggcgca gctggaatga tcaaacttgc agcacgccaa       420
     accgttgcgc gtatgttaga gcgtgatgat tttaaaaagc gttacgctag tggccagtct       480
     attgctattc atgagttttt atatccgtta gtgcaaggtt gggattcggt tgcacttgag       540
     gctgatgtag agctcggtgg tactgatcag cgctttaacc tgctaatggg tcgtgagcta       600
     caaaaagacg aaggccaaaa accacaaaca gtaataatga cgccgttatt agagggcacc       660
     gatggggtgc aaaaaatgtc taaatcgttg ggtaactata taggtattac cgatgcgcct       720
     aacgatatgt ttggtaaaat aatgtcgatt agtgatgtgc taatgtggcg ttactacgac       780
     ttattaagcg ggctgtcgat tgctggtatt aacgcgcaaa aagagcgtgt agagcaaggt       840
     acaaatcctc gtgatattaa aattgagtta gcaaaagagc ttattgcgcg ctttcatagt       900
     gaagccgatg cacaagcagc tcatgatgac tttattcagc gctttcagaa aaaagctctg       960
     ccggatgaaa tacctgaact aacagtaacc attgagcaag acagcatttt aattgctaac      1020
     ttgcttaaag aagctaactt agttgctagt acatcagaag caatgcgcat gattaagcaa      1080
     ggtgcagtta agctcaacgg cgaagataaa attacagaca ctaaacttga aatagcaaaa      1140
     ggcagtacgg ctatttacca agtaggtaag cgtaagtttg caaatattac tgtagcgtaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page