(data stored in ACNUC7421 zone)

EMBL: CR954246.UBID

CR954246.UBID        Location/Qualifiers
FT   CDS_pept        complement(108538..110004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="PSHAa0105"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxylyase;
FT                   ubiquinone biosynthesis, third step"
FT                   /function="1.4 : Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /function="2.5.4 : Menaquinone and ubiquinone"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9658014, 11029449; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85214"
FT                   /db_xref="GOA:Q3IDJ8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDJ8"
FT                   /protein_id="CAI85214.1"
FT                   /translation="MKYKDLRDFIDLLEKRGELKRITQEIDPYLEMTEIADRTLRAKGP
FT                   ALLFENPKGYDIPVLANLFGTPKRVAMGMGQEDVSELREVGKLLAFLKEPEPPKGIKEA
FT                   LGQIPVYKQVLNMPAKEVKKAPCQEVILQGDEVDLTKLPIQHCWPGDAAPLITWGLTVT
FT                   KGPYKKRQNLGIYRQQLLGKNKIIMRWLSHRGGALDFQEWCKENPGQPYPVSVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSKTEVVKSISNDLQVPASAEIVLEGYIMPGEMAP
FT                   EGPYGDHTGYYNEVDDFPVMTVTHMTHRKNPIYHSTFTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAIVTMKKQYPGHAKRVMMGVWSYLRQFMYTKFVIVCD
FT                   DDINARDWEDVIWAITTRMDPARDTTLIENTPIDYLDFASPVSGLGSKMGMDATNKWPG
FT                   ETNREWGEPIEMDKATKDRVDDIWQSLNIL"
     atgaaataca aagatcttcg tgattttatc gatttacttg aaaaaagagg tgagcttaaa        60
     cgcatcactc aagaaatcga cccgtatctt gaaatgaccg aaatagccga ccgtacatta       120
     cgtgctaaag gccctgcgtt attatttgaa aaccctaaag gttacgatat tccggtattg       180
     gctaacttat ttggcacacc caagcgtgtt gccatgggta tgggccaaga agatgtaagc       240
     gaattacgtg aagttggcaa gcttttggct tttttaaaag aaccagagcc accaaaaggc       300
     attaaagaag cgctagggca aatacctgtt tataaacaag tgcttaatat gccagcaaaa       360
     gaagtaaaaa aagccccctg ccaagaagtt attttacaag gtgatgaggt cgatttaact       420
     aagctgccta ttcaacattg ctggccaggt gatgctgcac cgttaattac ttggggcctt       480
     accgttacta aagggcctta taaaaagcgc caaaatttag gaatataccg ccaacaactg       540
     ttaggcaaaa ataaaattat tatgcgctgg ttgtctcacc gtggcggcgc gcttgatttt       600
     caagaatggt gtaaagaaaa tccaggccaa ccgtacccgg tatctgtggc attgggcgcc       660
     gatccggcga ctatattagg tgcagtaacc cctgtacccg acacattaag cgagtacgct       720
     tttgcaggct tactgcgcgg cagtaaaact gaagtagtta aatcaatatc aaacgattta       780
     caagtacccg caagcgccga aatagtactt gaaggctaca taatgccagg tgaaatggca       840
     cctgaaggtc cgtatggcga tcacactgga tattataacg aagttgatga ctttccggtg       900
     atgacagtaa cccatatgac ccaccgtaaa aaccctattt accacagtac ctttaccggc       960
     cgcccgcctg atgagcctgc tattttaggg gtggcattaa acgaagtatt tgtacctatt      1020
     ttacaaaaac aattccctga aattgttgat ttttacttgc caccagaagg ctgctcgtac      1080
     cgcatggcta ttgttaccat gaaaaaacaa tatcctggcc atgcaaaacg cgtaatgatg      1140
     ggagtgtggt cttacttacg tcaatttatg tataccaagt ttgttattgt gtgcgatgac      1200
     gatattaacg cccgagattg ggaagatgtt atttgggcaa ttactacgcg tatggacccc      1260
     gctcgcgaca ccactttaat agaaaacaca ccaattgatt atttagattt tgcgtcaccg      1320
     gtttctggcc ttggctctaa aatgggtatg gatgcaacga acaaatggcc tggcgaaaca      1380
     aaccgtgaat ggggcgagcc gattgagatg gataaagcca ccaaagatcg cgtagacgac      1440
     atttggcaga gcctcaacat tctctaa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page