(data stored in ACNUC7421 zone)

EMBL: CR954246.UBIH

CR954246.UBIH        Location/Qualifiers
FT   CDS_pept        583881..585071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="PSHAa0563"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /function="2.5.4 : Menaquinone and ubiquinone"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1339425; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85650"
FT                   /db_xref="GOA:Q3ILI3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI3"
FT                   /protein_id="CAI85650.1"
FT                   /translation="MPKQFDVVVIGGGLAGASCALSVAKINPALSIAVVEANEVSNDYH
FT                   PSFDDRSIALAQQSVEYLQGLNLFALNSPYATAIKKVSVSDRHHFGKADINCEEFAKDA
FT                   LGYVVEVNPFGRSLHQLLNAQINISLYCPDSVSAIEQQLHNNIVTLQSGEQIAAKLLVI
FT                   ADGAQSPTRSLFGLKFNTQAYKQGAIIANIEVAGGHNNHAFERFTQHGPMALLPMSNNR
FT                   YSLVWCMQQQHVEQHMAQSEDDFISALQSAFGYRGGQFTKVGMRANYPLVYGQVESLIA
FT                   HRTVVIGNAAHAIHPIAGQGFNLGLRDVQVLSNLISQSPNDLGSYAFTREYAQQRSADI
FT                   NNVMTLTDGLVRLFSNSSRILALGRSIGLFSMDLFPSLKAPLAKQLMGQVKQGQGL"
     gtgcctaagc agtttgatgt tgttgttatt ggtggcggtt tagccggtgc tagctgtgcg        60
     ttaagtgtgg ctaaaataaa tcccgcgctt agtattgctg ttgttgaggc gaatgaagta       120
     agtaatgact atcacccgag ctttgatgat agaagcatag cacttgctca gcagtcggta       180
     gagtacttgc aaggcttaaa tttatttgcg ttaaattcac cgtacgctac agcaattaaa       240
     aaagtaagtg tgtctgatcg tcaccatttt ggtaaagcag atattaactg tgaagagttt       300
     gctaaagatg cccttggtta tgtggttgaa gtaaacccgt ttggccgctc gttacatcaa       360
     ttattaaacg ctcaaataaa tatcagttta tattgccctg atagcgtaag tgccattgag       420
     cagcaattac ataataatat agttactttg caaagtggcg agcaaatagc cgccaagctg       480
     ttagttattg ccgacggtgc acagtcgcca actcgcagct tatttggact taagtttaac       540
     actcaagctt ataagcaagg ggctattatt gccaatatag aagtagctgg tgggcataat       600
     aaccatgctt ttgagcgatt tacgcaacat ggccccatgg cgctattacc tatgagcaac       660
     aaccgctatt cactggtgtg gtgtatgcag caacagcacg ttgagcagca catggcacaa       720
     agtgaagacg actttataag cgcactacaa agtgcctttg gttatcgcgg tggtcaattt       780
     actaaagtgg gtatgcgtgc taattacccc ttagtgtatg gccaagtaga atcgcttatt       840
     gcacaccgca cggtagtaat aggtaatgct gcgcatgcaa ttcatcccat tgcagggcaa       900
     gggtttaatc taggcctgcg agatgtacaa gtacttagta acttaatttc ccagagccca       960
     aatgacttag gcagttatgc atttactcgc gagtatgcac agcagcgcag cgctgatata      1020
     aataacgtga tgaccctaac agatggttta gtaaggcttt tttcaaattc atcacgcata      1080
     ctggcacttg gccgtagtat tgggttgttt tcgatggatt tattcccctc tttaaaagcg      1140
     ccattagcta agcagttaat ggggcaagtt aaacaaggtc aaggtttatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page