(data stored in ACNUC7421 zone)

EMBL: CR954246.UGD

CR954246.UGD         Location/Qualifiers
FT   CDS_pept        464254..465420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="PSHAa0444"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9383197; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85541"
FT                   /db_xref="GOA:Q3IEI5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI5"
FT                   /protein_id="CAI85541.1"
FT                   /translation="MKVTVVGTGYVGLSNAMLLAQHNEVIALDIDEQKIALLNNKQSPI
FT                   VDFHISEYLQRDDISFTATTNKSMAYCNADFIIIATPTDYDTHTHNFNTSSVEAVINDA
FT                   LAYNPHAVIIVKSTVPVRFTQRMKAQLGVDNIIFSPEFLREGKALYDNLHPSRIVVGEQ
FT                   SERAAVFANLLKQGAIKQDIAVLFTESTEAEAIKLFSNTYLAMRVAYFNELDTYAEAHG
FT                   LNSKQIIQGVGLDPRIGNHYNNPSFGYGGYCLPKDTKQLLANYKDIPNNMICAIVDANT
FT                   TRKNFIADSIIKRNPKVVGIYRLVMKTGSDNFRASAIQGIMKRIAASNVQMVVYEPELK
FT                   EDVFYNSRVIRNLNEFKQISDVVVSNRMVEELSDITDKVYTRDLFGSD"
     atgaaggtaa cagttgtagg tactggttat gttggtttgt cgaacgccat gttactagcc        60
     cagcataacg aggttatagc acttgatata gatgagcaaa aaatagccct tttaaataat       120
     aagcaatcgc cgatagtcga ttttcatata agtgaatatt tacaacgaga tgatataagt       180
     tttactgcaa caactaataa aagcatggcg tactgtaacg ctgactttat tattatagcg       240
     acccctaccg attacgatac ccacactcat aattttaata ccagctctgt tgaggccgtg       300
     ataaacgacg ctttggctta taatccacac gcggtaataa ttgttaaatc gacagtgcca       360
     gtgcgtttta cgcagcggat gaaagcgcag ctgggcgtag acaatattat attttctcct       420
     gaatttttac gtgaaggtaa ggcgctttac gataacctac acccatcacg cattgtggtt       480
     ggtgagcaaa gtgagcgtgc tgctgtattt gctaatttac ttaagcaagg ggcgattaaa       540
     caagatatag cagtgttgtt tactgagtcg accgaagctg aagccattaa attattttca       600
     aatacctatc ttgcaatgcg ggtcgcatat tttaacgaac ttgatacgta tgccgaagcg       660
     catggattaa atagtaaaca aattatacaa ggggttggac ttgaccctcg cattggtaat       720
     cattataaca atccatcgtt tggctatggt ggctattgtt tgccaaaaga taccaagcag       780
     ttattagcaa attataaaga catacccaac aatatgattt gcgctattgt tgatgccaac       840
     accacacgta aaaattttat agcggattca attattaaac gaaatcctaa agtcgttgga       900
     atttacaggc tcgttatgaa aacgggatct gataacttta gagcgtctgc tattcaaggg       960
     atcatgaagc gaattgcagc cagtaatgtg caaatggtgg tgtatgagcc agagcttaaa      1020
     gaagatgttt tttataactc tcgcgttatt agaaacttaa atgaatttaa acaaatatct      1080
     gatgtagttg tttctaaccg tatggttgaa gagttgagtg atattacaga taaagtatac      1140
     acacgcgatt tatttggtag tgattga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page