(data stored in ACNUC7421 zone)

EMBL: CR954246.UVRD

CR954246.UVRD        Location/Qualifiers
FT   CDS_pept        complement(131383..133548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="PSHAa0122"
FT                   /product="DNA-dependent ATPase I and helicase II; highly
FT                   similar to PSHA_1_2804"
FT                   /function="3.1.1 : DNA replication"
FT                   /function="3.1.2 : DNA recombination"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12527299, 12788954; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85226"
FT                   /db_xref="GOA:Q3IDF8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF8"
FT                   /protein_id="CAI85226.1"
FT                   /translation="MDVSQLLDGLNDKQRDAVAAPLQNMLVLAGAGSGKTRVLVHRIAW
FT                   LMQVEQASTYSIFAVTFTNKAAKEMRTRVEETLKAPVGGMWIGTFHGLSHRILRAHHRE
FT                   AKLPEAFQILDSDDQLRMIKRLLKSMNIDDKKWPAKQFGWYISAKKDEALRPKDIQAYD
FT                   INEQMMLRVYAAYQEACDRAGLVDFAEILLRSYEVLKNNPTLLRHYQQRFAHMLVDEFQ
FT                   DTNTIQYAWLKLLAGDSNSIMIVGDDDQSIYGWRGAKIENIKRFLTDFSAETIRLEQNY
FT                   RSTATILKASNALIQNNSERMGKSLWTDGNEGEPISIYAAFNELDEARFVSSKLRSWLN
FT                   AGNALQDAAILYRSNAQSRVLEEAMLQEGLKYRIYGGMRFFERQEIKDALSYLRIIGNR
FT                   QDDAAFERVINTPARGIGDKTLSHIRDCARAESLPLWYAAKAIVEQQHLSGRASGAVSK
FT                   FVELVEHIEDKISDLTLHEQAKYVIQTSGLMAMYQAEKGEKGRARVENLEELISACDQY
FT                   ELPEEEEYSSPLQGFLAHTSLESGEGQAEEHEDAVQMMTLHSAKGLEFPLVFMVGVEEG
FT                   MFPSQQSNEESGRLEEERRLCYVGMTRAMDKLYISHAESRRLYGQEKYHTPSRFLREIP
FT                   EDCVEEIRIKTQVSRPPAAGRFSASVSHAAFEDSGFNLGQRVLHAKFGIGTVLNYEGAG
FT                   AQSRVQVNFDDLGSKWLVTAYARLQAI"
     atggacgttt cacaattact cgatggctta aacgacaaac aacgcgatgc cgttgcagcc        60
     ccactacaaa acatgctggt attagcaggt gctgggtctg gtaaaacacg agtgttggtt       120
     catcgtattg cttggctaat gcaagttgag caagcctcaa cgtatagtat ttttgcggtt       180
     acctttacta ataaagcagc taaagagatg cgtactcgcg ttgaagagac gctaaaagcg       240
     ccggttggtg gtatgtggat tggtactttc catggtttgt cgcaccgtat tttacgcgcg       300
     caccaccgtg aagcaaaatt acccgaagca tttcaaattt tagactcaga cgatcagcta       360
     cgtatgatca aacgtttatt aaaatcgatg aatattgatg ataaaaaatg gcccgctaaa       420
     cagtttggtt ggtacataag cgctaaaaaa gatgaagcac ttcgccctaa agatattcaa       480
     gcctacgata ttaacgagca aatgatgctg cgcgtgtacg cggcgtatca agaagcatgc       540
     gacagagcag gcttagtcga ttttgccgaa atactactgc gcagctacga agtactcaaa       600
     aataacccta cactactgcg ccattatcaa cagcgctttg cacacatgtt agtagacgag       660
     tttcaagaca ccaacaccat acaatacgca tggttaaaac tacttgctgg cgactccaat       720
     agtattatga ttgttggcga tgacgatcag agtatctatg gttggcgcgg tgcaaaaata       780
     gaaaacatta aacgtttttt aactgacttt agcgcagaga ccattcgtct tgagcaaaac       840
     tatcgctcaa ccgccactat attaaaagcc tcaaatgccc tgatccaaaa taactcagag       900
     cgtatgggta aaagcttatg gaccgacggt aacgagggcg aacctatttc tatttacgcc       960
     gcatttaacg agctagacga agcgcgtttt gtaagtagta aactgcgtag ttggttaaat      1020
     gccggcaatg cgctgcaaga tgcggctatt ttatatagaa gtaatgcgca atcacgtgta      1080
     cttgaagaag ccatgctaca agaaggccta aagtatcgta tttatggcgg catgcgattc      1140
     ttcgaacgcc aagaaattaa agacgccctg tcgtacttac gcataatagg taaccgtcaa      1200
     gacgatgctg catttgaacg agtaattaat actccagctc gtggtattgg cgataaaacg      1260
     ctaagccata tacgcgactg tgcacgcgcc gaatcgttac cactttggta tgcagcaaaa      1320
     gcaattgtag agcaacaaca tttatctggc cgcgcttctg gtgcagtgag taagtttgtc      1380
     gaactagtag agcatattga agataaaatt agcgatctaa cgctacatga gcaagctaaa      1440
     tacgttattc aaacttctgg gttaatggca atgtaccaag ccgaaaaagg tgaaaaaggc      1500
     cgtgcccgag tagaaaactt agaagaactt attagcgctt gcgatcagta cgaattgcct      1560
     gaggaagaag aatatagctc tcctctacaa ggctttttag cgcatacctc gcttgaatct      1620
     ggtgaaggac aagcagaaga gcacgaagac gccgtacaaa tgatgacatt gcactcagct      1680
     aaaggtttag aatttccgtt agtgtttatg gttggcgtag aggaaggtat gttcccttct      1740
     caacaaagta atgaagagtc tggccgttta gaagaagaac gccgcctttg ttatgtaggt      1800
     atgacccgcg ctatggataa actatatatt agccatgccg aaagccgtcg tttatatgga      1860
     caagaaaaat accatacacc atcgcgcttt ttacgggaaa ttcccgagga ctgtgttgaa      1920
     gaaattcgta ttaaaaccca agtatctcga ccacccgctg cagggcgttt tagcgcatca      1980
     gttagtcacg ctgcatttga agatagcggc tttaacttgg ggcaacgtgt actgcatgct      2040
     aaatttggta ttggtacagt acttaattac gaaggtgcgg gtgcgcaatc tcgcgtacaa      2100
     gtcaactttg atgatttagg tagtaagtgg ttagtaacgg catatgcaag actacaagct      2160
     atataa                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page