(data stored in ACNUC7421 zone)

EMBL: CR954246.VISC

CR954246.VISC        Location/Qualifiers
FT   CDS_pept        585068..586234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="PSHAa0564"
FT                   /product="putative monooxygenase, FAD/NAD(P)-binding
FT                   domain"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85651"
FT                   /db_xref="GOA:Q3ILI2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI2"
FT                   /protein_id="CAI85651.1"
FT                   /translation="MKQAQVCIVGGGSVGLTLALGLAKAGISVVVLDAAPKQTPPTDEY
FT                   GMRVSALSIASQTLLEQLNVWPHIVALRASAYTHMDVRDADSFGKIAFNSEQLELDHLG
FT                   HIVENDIICYALIKELEQQPNATLMFDTCYQQIHQSESDVFVTLKSGEPIIAKLLVAAD
FT                   GANSAIRKQFNMALSFKDYDHHALVATVKTQEPHANTARQVFLPSGPLAFLPLSDANTH
FT                   SIVWSTNPTHCEELLAMDDNQFNKAIMAAIDGQCGLCEVQSVRAAFPLKMRYAQQWVAG
FT                   KVVLIGDAAHTIHPLAGLGMNLGLKDAAYLIELLTSDNKEFASTRTLRDYERTRKLDAQ
FT                   KHIAMMYSLKELFAGANPIKKLIRGVGLSMVDNLGPIKHLFAKEAIGK"
     atgaaacaag cacaggtatg tattgtaggt ggtggcagcg tagggcttac cttagcgctt        60
     gggttggcaa aagcgggtat aagcgtagtc gtacttgacg ctgcgccaaa gcaaacaccg       120
     ccaactgacg agtacggcat gcgcgtaagt gcgctgagta ttgcgagtca aaccttgctt       180
     gaacaattaa acgtatggcc acacatagtt gctttgcgtg ctagtgccta tacccatatg       240
     gatgtgcgcg atgccgacag ctttggcaaa atagctttta atagtgagca actagagctt       300
     gatcatttag gtcatatagt tgaaaacgat attatttgct acgcgcttat aaaggagctg       360
     gagcagcagc caaatgctac gctgatgttc gacacttgtt atcagcaaat acaccaaagc       420
     gaatcggatg tatttgttac tttaaaaagt ggtgagccaa tcattgcaaa gctgctggtg       480
     gccgccgatg gtgcaaattc ggcaattcga aagcagttta atatggcgct gagctttaaa       540
     gactacgacc accatgcatt ggtggctaca gttaaaaccc aagagccaca cgccaatacc       600
     gcacgccaag tgtttttacc aagcgggcca ttagcatttt taccgttgag cgatgccaac       660
     acccattcaa ttgtgtggtc tacaaaccca acgcattgtg aagagctatt agcaatggac       720
     gacaaccagt ttaacaaagc cattatggcg gcaatagacg gccaatgtgg tttgtgtgaa       780
     gtgcaaagtg tacgcgctgc atttccactt aaaatgcgtt atgcccagca atgggttgca       840
     ggtaaagtcg tattaattgg cgatgctgca catacgattc atccgcttgc aggcttgggg       900
     atgaacctag gcctaaaaga tgccgcttat ttaattgagt tactaacaag tgataataaa       960
     gaatttgcca gcacgcgtac tttacgtgat tacgagcgaa cccgtaaact cgatgcgcaa      1020
     aaacacattg ccatgatgta ctctttaaaa gagttatttg ccggtgctaa cccaattaaa      1080
     aaactaattc gtggagttgg gctttcaatg gttgataact taggcccaat aaagcatttg      1140
     tttgctaaag aagcgatagg aaagtaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page