(data stored in ACNUC7421 zone)

EMBL: CR954246.XERC

CR954246.XERC        Location/Qualifiers
FT   CDS_pept        complement(93298..94245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="PSHAa0090"
FT                   /product="site-specific recombinase"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10760161; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85199"
FT                   /db_xref="GOA:Q3IDS2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS2"
FT                   /protein_id="CAI85199.1"
FT                   /translation="MSDNPAPNISDLSDNWRTPITLFSDYLKFERQYSAHTVNQYVSQL
FT                   GFAALYFSKLCDDWFSVQGEHIRRYSMALRSKQLSGRTISLKLSCIRSLYKFLKAKNIA
FT                   KQAHYHNPAVGIKGPKFAKPLPKNLDVDQMARLLEIPDDEPLAIRDKAMMELMYSSGLR
FT                   ISELVGANLQDISAANGEILVRGKGNKERLIPVGSKALNALKKWLIIRPQFANPDEVAV
FT                   FLSSKKNRISVRQVRLRMQEWGIKQGISSQVHPHKLRHSFASHILESSGDLRAVQELLG
FT                   HSSLSATQVYTHLDFQHLAKVYDNTHPRAKKRTD"
     atgagtgaca accctgcgcc aaatatcagc gacttaagcg ataactggcg cacgcctatt        60
     actttattta gcgactattt aaagtttgaa aggcaatact cagcgcacac tgttaaccaa       120
     tatgtcagcc agcttggctt tgcagcgctt tactttagta agctctgcga cgactggttt       180
     agtgtacagg gtgagcatat tcgccgttac agcatggcac tgcgctcaaa acaattaagt       240
     ggccgcacta ttagtttaaa gctcagttgt attcgcagtt tatataaatt cttaaaagct       300
     aaaaatattg ctaaacaagc gcattaccat aacccggcgg taggcataaa agggcctaag       360
     tttgctaagc ctttgcctaa aaatctcgat gtagatcaaa tggcacgctt gctcgaaata       420
     cccgacgacg aacctctggc cattagagac aaagccatga tggagcttat gtactcatca       480
     ggtttacgta ttagcgagtt agttggtgct aacctacaag atataagcgc cgcaaatggt       540
     gaaatattag tacgcggtaa aggcaataaa gaacgcttaa ttccggtagg cagtaaagcg       600
     ctaaacgcgc taaaaaaatg gctcataata cgccctcaat ttgcaaaccc tgacgaagtg       660
     gcggtatttt taagtagcaa aaaaaatcgc atttcggtac gccaagtacg tttaagaatg       720
     caagaatggg gcatcaagca aggcattagc tcgcaagtgc atccgcacaa attgcgccac       780
     tcgtttgctt cgcatatttt agagtcatct ggcgatttac gcgcggtaca agaactgctc       840
     gggcacagta gtttgtcggc cactcaagtg tatactcatt tagattttca gcatttagcc       900
     aaggtgtacg acaacacgca cccaagggca aaaaagcgaa ctgattag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page