(data stored in ACNUC7421 zone)

EMBL: CR954246.XERD

CR954246.XERD        Location/Qualifiers
FT   CDS_pept        527888..528814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="PSHAa0514"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /function="3.1.2 : DNA recombination"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85604"
FT                   /db_xref="GOA:Q3ILE1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE1"
FT                   /protein_id="CAI85604.1"
FT                   /translation="MTTLADDFSEPSTAPKSNNDYLETFLDCLYLEQGVSENTLSAYRS
FT                   DLDKFCQFLKGKNLMTVTGLDVESYLAHRVDLGLKPRSTARSISALKRFYQYFVREKLI
FT                   SDSPMLNIAQPKAGQSLPKTLSEAEVEALLSAPNTDEPMGLRDKAMLELLYATGLRVSE
FT                   LVGLRIEQINLRQAVVFVKGKGNKERLVPLGEEAMYWLEQFLKVGRAQMIKHATDFVFP
FT                   SKRGVGMTRQTFWHRVKHYAILASIESSLSPHTLRHAFATHLLNHGADLRVVQMMLGHS
FT                   DLSTTQIYTHVANERLKSVHAQHHPRA"
     gtgacaacgc tagctgacga cttttcagaa ccaagcacgg cacccaaaag caataacgac        60
     tacctagaaa cctttttaga ttgtttgtat ttagagcaag gggtgagtga aaatacacta       120
     tcggcgtatc gcagcgattt agataagttt tgccagtttt taaaaggcaa aaatttaatg       180
     actgtaaccg gcttagatgt tgaaagctat ttagcccata gagttgatct aggcttaaag       240
     ccgcgtagta ctgcgcgtag tattagtgcg cttaagcgtt tttatcagta ctttgtgcgc       300
     gaaaagttaa ttagcgactc gccaatgctc aatattgcgc aacctaaagc aggacagtct       360
     ttgcctaaaa cgctttcgga ggctgaagta gaggcactac tgagcgctcc caataccgat       420
     gagccaatgg ggctgcgcga taaagccatg cttgagttac tatatgcaac aggtttgcgg       480
     gttagtgagc ttgtagggct gcggattgaa caaattaatt tgcgccaagc tgtggtgttt       540
     gtaaaaggta aggggaataa agagcgttta gtgccactgg gcgaagaggc catgtattgg       600
     cttgagcagt ttttaaaggt gggacgggcg caaatgatta aacacgccac cgactttgtg       660
     tttccctcaa agcgaggggt tggcatgacc cgacaaactt tttggcatag agtgaagcac       720
     tatgctattt tggcatcaat tgagtcgtca ttgtcaccgc atacattgcg ccatgcattt       780
     gcaacccact tattaaatca tggggcagac ttacgtgtgg ttcaaatgat gttagggcac       840
     agtgatttat caaccaccca aatatatacg catgttgcaa atgagcgatt aaaatcggta       900
     catgcgcagc atcatccacg tgcttaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page