(data stored in ACNUC7421 zone)

EMBL: CR954246.YAJC

CR954246.YAJC        Location/Qualifiers
FT   CDS_pept        335876..336211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="PSHAa0320"
FT                   /product="putative preprotein translocase IISP family,
FT                   membrane subunit"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12068816; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85419"
FT                   /db_xref="GOA:Q3ILB7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB7"
FT                   /protein_id="CAI85419.1"
FT                   /translation="MSLFISNAHASTGSASAGGGMEMLIMLAIFGLVFYFLIYRPQAKR
FT                   VKEHKSLMSAMAKGDEVLTQGGLVGKIVKIADDKDFVVISLNEQAEVTVQKSAVTAVLP
FT                   KGTMKSL"
     atgagtttat ttatttcgaa tgcccacgca agtactggtt ctgcatctgc cggtggcgga        60
     atggaaatgc taataatgtt agctattttc ggtttggttt tttacttttt gatttatcgc       120
     ccgcaagcta agcgtgttaa agagcataaa agcttaatga gcgcgatggc taaaggtgat       180
     gaagtactta cccaaggcgg tttagtgggt aaaatagtaa aaattgcaga tgataaagat       240
     tttgttgtta tctcattaaa cgagcaagca gaagtaacag tacaaaaatc agccgtaact       300
     gcggtattgc caaaaggcac aatgaagtcg ctataa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page