(data stored in ACNUC7421 zone)

EMBL: CR954246.YGGH

CR954246.YGGH        Location/Qualifiers
FT   CDS_pept        complement(568935..569660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggH"
FT                   /locus_tag="PSHAa0553"
FT                   /product="tRNA (m7G46) methyltransferase, SAM-dependent"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.1.1.33"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730187; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85641"
FT                   /db_xref="GOA:Q3ILJ1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ1"
FT                   /protein_id="CAI85641.1"
FT                   /translation="MSESSNTNLEQAKQEGKYIRTIRSFVKREGRLTKGQAAAIEKCWP
FT                   IMGLEHKNGMLDLSEVFGNNNDVVLEIGFGMGKSLVEMAKNAPHLNFIGIEVHRPGVGA
FT                   CLMDADEAGITNLRIFEHDAVEVLADCIADESLTTLQLFFPDPWHKKRHHKRRIVQGEF
FT                   VEKLRSQLKMGGVFHMATDWENYAEHMLEVMQAAPGFKNQSTTNDYVPRPDLRPLTKFE
FT                   QRGHRLGHGVWDLMFERTK"
     atgagtgaat caagtaacac taatcttgag caagcaaagc aagaaggtaa gtatatccgc        60
     actattcgta gttttgtaaa gcgcgaaggt cgtttaacca aaggccaagc tgccgctatc       120
     gaaaaatgct ggccaataat gggcttagag cataaaaatg gcatgcttga tttaagcgaa       180
     gtttttggca ataacaatga tgtagtgcta gaaattggtt ttggtatggg caaatcactg       240
     gttgaaatgg caaaaaatgc cccgcattta aactttattg gcatagaagt acaccgccca       300
     ggcgttggtg cttgtttaat ggatgctgat gaagcgggta ttactaatct gcgtattttt       360
     gaacacgatg cggttgaagt tttagccgat tgtatagcag atgaaagttt aacaacctta       420
     caattgtttt tccctgatcc ttggcataaa aagcgtcacc ataaacgccg tattgtacaa       480
     ggcgagtttg ttgaaaaatt acgttcacag ttaaaaatgg gcggtgtttt tcatatggct       540
     accgactggg aaaattatgc tgagcatatg cttgaagtaa tgcaagctgc gcctggcttt       600
     aaaaaccagt caacaacaaa cgactacgta ccacgccctg atttacgccc gttaaccaag       660
     tttgagcaac gcggccatcg tttaggtcat ggtgtgtggg atttaatgtt tgaacgcact       720
     aagtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page