(data stored in ACNUC7421 zone)

EMBL: CR954246.YIFB

CR954246.YIFB        Location/Qualifiers
FT   CDS_pept        139196..140707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifB"
FT                   /locus_tag="PSHAa0130"
FT                   /product="putative regulator"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85234"
FT                   /db_xref="GOA:Q3IDF6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF6"
FT                   /protein_id="CAI85234.1"
FT                   /translation="MSLARIYSRAQVGINAPEVIVEVHLGNGLPAFHIVGLPEASVKES
FT                   KDRVRSALENSKFGFPDQRITVNLAPADLPKDGGRFDLAIAVGILVASGQIVCSDIHKY
FT                   EFYGELALNGEIRGVNAILPSVLAAKEQDRCCFLPLANDSLASLVNGVKRKAVSSIAEV
FT                   WGDLLNQQPLPLNIQYPDCTQAPDFLLDLSDVKGQPGAKRVLEIAAAGGHNLLFLGPPG
FT                   TGKSMLAQRMATIMPTMSDDEAIATAALYSIIGQSIDLTNWRQRPFRNPHHTCSAVALV
FT                   GGSSNPKPGEISLAHNGVLFLDELPEFERKVLDSLREPMETGTVTISRVARQMEFPAQF
FT                   QLITALNPSPTGCHNDKRATPDQVMRYLSRVSGPFIDRIDLQIELPRLTSVELQSSKPE
FT                   ETSAVVRARVEAAYYLQLKRQGKVNARLNNKEMSIHCDLASTELQFLARASEKLALSPR
FT                   SYHRIIKVARTISDLKGAERISLDELKEALNYRAFERLLAQLTKY"
     atgtcgttag ctcgcatata ttctcgtgct caggtgggca taaatgcccc cgaagtgatt        60
     gttgaggtgc atttaggtaa tggtttgcct gcttttcata ttgtcggttt gcccgaggct       120
     tcggttaaag aatctaaaga cagagtgcgt agcgcacttg aaaattctaa gtttggtttt       180
     cccgatcaac gtattactgt taatttagcc cctgccgatt taccaaaaga cggtggccga       240
     ttcgatcttg ctattgccgt aggtatttta gtcgcctcag ggcaaatagt gtgctctgac       300
     attcataaat atgagtttta tggggagctg gcacttaacg gtgagatacg tggcgtaaat       360
     gctattttgc cctcggtgct tgctgctaaa gagcaggacc gttgctgttt tttaccactg       420
     gcaaatgata gcttagccag tttagttaac ggggttaaac gcaaagccgt aagctctatt       480
     gcagaagtgt ggggcgattt acttaatcag caaccactgc cgttaaatat acaataccca       540
     gattgtacgc aagctcctga ttttttgctt gatttaagtg atgtgaaagg ccagcctggg       600
     gcaaagcgag tactcgaaat tgccgctgca ggaggccata acttactatt tttaggaccc       660
     cctggtacgg gtaagtcaat gctggctcaa cgtatggcaa ccattatgcc aaccatgtca       720
     gatgatgaag caattgctac tgcggcgctt tattctatta ttggccagtc gattgattta       780
     actaattggc gacaacggcc atttcgcaat cctcaccata cctgctctgc cgttgcatta       840
     gtcggtggct cgtcaaaccc taaaccgggt gaaatttcat tggcgcataa tggcgtgctt       900
     tttttagatg agttgccaga gttcgaacgt aaagtgctcg attcgctgcg tgaacctatg       960
     gaaactggta ctgtcactat ttcgcgtgtg gcaaggcaaa tggagtttcc ggcgcagttt      1020
     cagcttatta cggcgctaaa ccccagccct acaggttgcc ataatgataa gcgggcaacg      1080
     cctgatcaag taatgcgtta tttgtcgcgt gtttcggggc cgtttattga ccgtattgac      1140
     ttacaaattg aattaccaag gctaacgagt gttgagttac aaagtagcaa acccgaagaa      1200
     accagtgcag tagtaagagc gcgagtagag gctgcttatt atttgcagct aaaacgccaa      1260
     ggtaaagtga atgcgcggtt aaacaataaa gaaatgagta tacattgtga tctcgcttcc      1320
     actgagttgc agtttttagc cagagcgagt gaaaaactgg cattatcgcc acgctcatac      1380
     catagaataa ttaaagtagc gcgtactatt agtgatttaa aaggggcgga gcgtattagc      1440
     ttagatgagc taaaagaagc acttaactac cgcgcctttg agcgcttact agcgcaatta      1500
     actaagtact aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page