(data stored in ACNUC7421 zone)

EMBL: CR954246.ZUR

CR954246.ZUR         Location/Qualifiers
FT   CDS_pept        complement(508433..508870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="PSHAa0493"
FT                   /product="Zinc uptake regulation protein"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9680209; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85588"
FT                   /db_xref="GOA:Q3IG93"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG93"
FT                   /protein_id="CAI85588.1"
FT                   /translation="MNIESLVSKAKQVCDNRGARFTPIREKVFRLLASAQGGVGAYDLL
FT                   EQLKVTETGAKPATIYRALDFLAELGFIHKIESTNAFMLCHHFDHIHPVQLLICDTCGF
FT                   VKELHSTVISHELNSLAAEGGFVVSAQTIEAHGRCESCRAA"
     atgaatatag aatcactcgt aagtaaagca aaacaagtat gtgacaaccg tggtgcgcga        60
     tttacaccta tccgtgaaaa ggtatttcgt ttacttgcaa gtgcgcaagg tggtgtgggc       120
     gcgtatgatt tgctcgagca attaaaagta acagaaactg gcgctaaacc tgccacgata       180
     taccgtgcat tagatttttt ggctgagctt ggttttattc ataaaattga aagcaccaat       240
     gcatttatgt tgtgccatca ttttgatcat attcatcctg tacagttatt aatttgcgat       300
     acctgtggat ttgttaaaga actgcattca accgttattt cgcatgagct aaatagttta       360
     gctgcggaag gtgggtttgt tgtatcggcg caaacaatag aagcacatgg aaggtgtgag       420
     tcttgcagag ctgcatag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page