(data stored in ACNUC8465 zone)

HOGENOMDNA: CRPAR1_3

ID   CRPAR1_3; SV 1; empty ; DNA; empty ; UNC; 1099352 BP.
XX
AC   NC_006982;
XX
DE   Cryptosporidium parvum Iowa II chromosome 3, whole genome shotgun
DE   sequence.
XX
OS   Cryptosporidium parvum Iowa II
OC   Eukaryota; Alveolata; Apicomplexa; Coccidia; Eucoccidiorida; Eimeriorina;
OC   Cryptosporidiidae; Cryptosporidium.
XX
RN   [1]
RP   1-1099352
RX   PUBMED; 15044751.
RA   Abrahamsen,M.S., Templeton,T.J., Enomoto,S., Abrahante,J.E., Zhu,G.,
RA   Lancto,C.A., Deng,M., Liu,C., Widmer,G., Tzipori,S., Buck,G.A., Xu,P.,
RA   Bankier,A.T., Dear,P.H., Konfortov,B.A., Spriggs,H.F., Iyer,L.,
RA   Anantharaman,V., Aravind,L. and Kapur,V.;
RT   "Complete genome sequence of the apicomplexan, Cryptosporidium parvum";
RL   Science 304 (5669), 441-445 (2004)
XX
RN   [2]
RP   1-1099352
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (06-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1099352
RA   Abrahamsen,M.S., Templeton,T.J., Enomoto,S., Abrahante,J.E., Zhu,G.,
RA   Lancto,C.A., Deng,M. and Liu,C.;
RT   "Direct Submission";
RL   Submitted (02-APR-2004) Veterinary Pathobiology, University of Minnesota,
RL   1988 Fitch Ave., St. Paul, MN 55108, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CM000431.
XX
FH   Key             Location/Qualifiers
FT   source          1..1099352
FT                   /isolate="Iowa type II"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cryptosporidium parvum Iowa II"
FT                   /chromosome="3"
FT                   /db_xref="taxon:353152"
FT   gene            complement(<2886..>6047)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_10"
FT                   /db_xref="GeneID:3372319"
FT                   /locus_tag="cgd3_10"
FT   mRNA            complement(<2886..>6047)
FT                   /db_xref="GI:66356337"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_10"
FT                   /db_xref="GeneID:3372319"
FT                   /locus_tag="cgd3_10"
FT                   /transcript_id="XM_625316.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(2886..6047)
FT                   /locus_tag="cgd3_10"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide and low complexity repeats,
FT                   member of cryptosporidium SKSR gene family, telomeric
FT                   localized gene"
FT                   /db_xref="GI:66356338"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_10"
FT                   /db_xref="GeneID:3372319"
FT                   /translation="MKLKFIFLFIIALIISCLFCDIYAAEAPEENSPNNSNNPSNEYSQ
FT                   DADLTESLLILITNRFEANFTSEVLLKVVCIYILNMLRFIAVINPELSSSFFKLLNLVF
FT                   ATLHNYSLEDKKTLYTTQAKAAQLTYLCSKASELSIFSGINTSESNYAQMIDALFNVSS
FT                   KVISVFNRLLNLLKSLTVIEVSDYIRHLLHSLIEIGEDTLTEFQKAIEVYSSTPKKILN
FT                   TKIEFSKGISKSLFLELTFDDKPANARRVMLENKTRFSARNEEYKKYLLTGNSNLKPKD
FT                   LKEAKHVYENILDCGGLSPETIFYFESLILQASSILFIIVANAYKFYEEKIQPIQEKIN
FT                   SFLDTVYSQITLRGTELDLSEQKCLEIKQKIRELLKVESLTSNDILASSHTKTKSSKEI
FT                   VNILKEMYLQLIKTLTLLHKEKEKVASCKYLTFLLSELLKLFQFFGNSIKNLIKDFEET
FT                   KSGWEVKSLSDLKKSRKETLSYLRSSLTKYAELSKEQTKEREKRAKELQEKNQKEKEEK
FT                   RQKEKEEEERLLQEKKLRQEEVKKRKKARPKKTKTFPEATLHEALTIEQRQEVTEIPIK
FT                   VPSKVKKKSDKKEETLNKLKLLAEISEKSEEIRTVIKSERKSNASEKARKMNERKERQK
FT                   ACRERQRMEREEEERRKGDAHHKVKVLESEVKVSVSMLKEHFSSVTSKQNEELQVLIGA
FT                   VFGIMGEDEATGGAEGFNLIDQEEPSQPSQPSQPSQPSQPSQPLQPLQPSQPLQPSQPL
FT                   QPLKPSQHSQDSQLRTHTRTRRRADEPLQNAPTRPTIELFGQSPVFVSSRGLSEDLVAS
FT                   GLSHTLSGLSLDDMKDTSEDQDSKHTSSSNLISTSESKSGHKSKSRSRSKSRTRSKSRT
FT                   RTRSKSRTRSRSRTRSRSRSRSSSRTRSRSRSRSSSRSSSGHGSESWLGGTLQNQENSL
FT                   EEIISKMYVSSSYEEFSLSSSSAHSRFSGMFSNTESVDPLSSQAMLFFNVRMPNFKHIT
FT                   ESSTEEEIKKALDLCGSEISRLNSEVSSSVSGQDFLSVKCVQKSFISEFIRLLLLLKSK
FT                   SNSTS"
FT                   /protein_id="XP_625316.1"
FT   gene            <7861..>8991
FT                   /db_xref="ApiDB_CryptoDB:cgd3_20"
FT                   /db_xref="GeneID:3372324"
FT                   /locus_tag="cgd3_20"
FT   mRNA            <7861..>8991
FT                   /db_xref="GI:66356339"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_20"
FT                   /db_xref="GeneID:3372324"
FT                   /locus_tag="cgd3_20"
FT                   /transcript_id="XM_625317.1"
FT                   /product="hypothetical protein containing a signal peptide"
FT   CDS_pept        7861..8991
FT                   /locus_tag="cgd3_20"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein containing a signal peptide"
FT                   /db_xref="GI:66356340"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_20"
FT                   /db_xref="GeneID:3372324"
FT                   /translation="MRLRIKVYLIFLVGIFTTKICSSLTIKEIEAIGNNDHSRTNSSFT
FT                   TDSELISSDEDSNLTDDQTILKSYSSSKDQSLYSNSQIIEYDDVSGNLGIIAIITNKRQ
FT                   TCRIISGNFNKRNETKNTLYLLFDTTNKNFVSIFVPRLIDFTLKGKQGLVTLIYNEEIF
FT                   LLNKLLLINSNGEISTTKHPWKLVIEVNSDYNKLQSLPYDLRNKHYIKLPPDGWDANDD
FT                   SVYPKNIKSIKPLSILSKNMNQIKELRIPHFSVGVIPTALFLKLNTGEYMSIIVPNNTV
FT                   FFVDIDDCSIHSKDGHYYNICGGYSVYCNRWLFTNRPWKSRIIIQSNFEELLVITKSKL
FT                   QVLENVEQLSNTSKITENFRNNIKNNKCGKYFCSRN"
FT                   /protein_id="XP_625317.1"
FT   gene            complement(<9337..>10665)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_30"
FT                   /db_xref="GeneID:3372323"
FT                   /locus_tag="cgd3_30"
FT   mRNA            complement(<9337..>10665)
FT                   /db_xref="GI:66356341"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_30"
FT                   /db_xref="GeneID:3372323"
FT                   /locus_tag="cgd3_30"
FT                   /transcript_id="XM_625318.1"
FT                   /product="hypothetical protein with 11 transmembrane
FT                   domains"
FT   CDS_pept        complement(9337..10665)
FT                   /locus_tag="cgd3_30"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 11 transmembrane
FT                   domains"
FT                   /db_xref="GI:66356342"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_30"
FT                   /db_xref="GeneID:3372323"
FT                   /translation="MEKIIKSDYDSLLEIDLYSEDEVDGDLIITDNIFMYDQICYLKNC
FT                   LVVLLLIWHFLHAIIFGGDISPSITRFKIGDNGIFALVLNILVPCIFFVQGWLKAFEIH
FT                   KQTSFIKRLHIEFLIPIFIYVLFYLVSILFKNDTHLENLTNEEFGNLLSKSGYFNPGFL
FT                   STFLLLFLINLVLDSTALVIVPHFYVNNSLIFYKVNNSLISRNYKSGNVSNEMDRKYFS
FT                   VLKNFSFYKLIYCLLMVLLYDSLLDFLNNMEPKNLIHKSKISNIFSVLILLIMCKIFKN
FT                   SPRIFYYVCFIGSFINLIICSSFGSYINCHFSASLISSFHFLLNVFFTGTLISCMNLEI
FT                   FKKWQFSIFFTLCSVLCHFTSADYSRSIISPLIFPSIFSIKSRFLTVSQIFSSIFAILS
FT                   ISIQLFKCFSSKSKTKSLRAINSTILLCFSLMLCISSIKLFFE"
FT                   /protein_id="XP_625318.1"
FT   gene            complement(<11446..>12927)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_40"
FT                   /db_xref="GeneID:3372329"
FT                   /locus_tag="cgd3_40"
FT   mRNA            complement(<11446..>12927)
FT                   /db_xref="GI:126644362"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_40"
FT                   /db_xref="GeneID:3372329"
FT                   /locus_tag="cgd3_40"
FT                   /transcript_id="XM_001388051.1"
FT                   /product="casein kinase I"
FT   CDS_pept        complement(11446..12927)
FT                   /locus_tag="cgd3_40"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="casein kinase I"
FT                   /db_xref="GI:126644363"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_40"
FT                   /db_xref="GeneID:3372329"
FT                   /translation="MVSQISSPLSNTTVCSIWKIERLIGGGSFGDIYLAVNTETNEEVA
FT                   IKAESTMSRHPQLIYETKVLKLLQGGVGIANVYHCELDREVNHQIMAMELLGPSLEDLF
FT                   NLCHRRFTMKTILMIADQMLQRVEYIHSKNFIHRDIKPDNFLIGRGRGSRNIYVIDFGL
FT                   AKRFRDPKTLQHIPYRENKNLTGTARYASINAHLGIEQSRRDDLEAIGYVLMYFCRNGT
FT                   LPWQGIRANNKEEKYKKIMEKKMGTSVETLCKSYPPEFATYLHYCRVLRFEDRPDYTYL
FT                   RKLFRDLMQREGYVDDGDFDWTKLDSNSSKKVETSSMQTNNCVKTTGKSLIPQIQPNVS
FT                   LDKSVFDQKKQSKSNKRYIHSSSSRKANNSGAPANSNIIQRECSPVEQKSNMENKGEKN
FT                   PNETANSNICNNLTSANSGKRISDIGDQAQDHSMSLSPNPTLTRRKSKAKNKDIHEYRN
FT                   TKYQDTSSKKHNMKTHNTQKPSKLKRGFCSCTKVV"
FT                   /protein_id="XP_001388088.1"
FT   gene            <14255..>17881
FT                   /db_xref="ApiDB_CryptoDB:cgd3_50"
FT                   /db_xref="GeneID:3372322"
FT                   /locus_tag="cgd3_50"
FT   mRNA            <14255..>17881
FT                   /db_xref="GI:66356343"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_50"
FT                   /db_xref="GeneID:3372322"
FT                   /locus_tag="cgd3_50"
FT                   /transcript_id="XM_625319.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        14255..17881
FT                   /locus_tag="cgd3_50"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with C-terminal region conserved in plasmodium"
FT                   /db_xref="GI:66356344"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_50"
FT                   /db_xref="GeneID:3372322"
FT                   /translation="MSLFATVSFALSFGKFRNIDLLQSGFYRLRSRLYFLNDGVAYSAI
FT                   PRNIIYSKQQKLDLKWEGILEDGSVLSRPFQINYVDDVADLNETIIFTSDVKLHVPSTK
FT                   PFSSFFSDSSQTDSNEIFRSTFANSQVSIAPFFLEVDLFYSENLEQILPLDSGSMSEES
FT                   NSEDSEHYQPSDEKFSSLCYNVYRINNVANGIVEYLPIIFDEFHFCNTSCLILSQITRI
FT                   FASFDSHYSENKTQYIPRFSSTKPLPVIPSFLLSTSKNEENSELSDKDLLKNCNRTFKY
FT                   DENKNSHSTNVRSKVQVGSFTIRGMLIQKMAQTFVESSKKLKEEDNDKTSDDLKLNENL
FT                   EVSTKETNELPDLANNKELNDIQETLEICDDVKGNEEKDQNTNQKAIIGIDEVFPSIVT
FT                   RDPMFIESSKFRLELISSLTNLHLQLAANMHYITKKCCSSQRAKLMGSFLVIPSLELPG
FT                   GSKLNVEPLINLSESNYEENGASIPFCVVREKIDQIDEHKISRISSEIQLKEANEFKHS
FT                   LTIASDGSSIGILPEQRLSDSALCLVKLPTTIWALTPLNWQLNYIRGITPPIFRRSPTS
FT                   HIVTSDPLISHEPILPFQNVIEAPFGIAQYSCKINLELEKISFQIFETWNRLVSILPFV
FT                   LHKLEQTCKMEHIRKTMFLWNETIFFENLSINELYSPSLKPEPSSKFPEFLGNRSFPIT
FT                   PPVVLSVNSSPPYNNLPNNGELNKKNSGFFSIFPILTGGVGLSSQNSTAFVLKPIDYYS
FT                   KVADLLRNDIVFKSIPTPNAIEEVCLPPLHEIASNSDNQSNTKNDVLDDNMLNNISTEH
FT                   LKSSKYNEWLPILFIQRYTKPSTLINCYKHPISPISTNSEINNLIVDHSKAIINNGVGT
FT                   ITHCGQLCRLGINNDPAINARNIVNRKIEQESNKTFGSRCFDYDQNVEKETNHDNETPK
FT                   IPMIKTETPFLESSKELTKDLHIMIFVHGLQGSAFDMRNVRNIISLYYPDVLCLLSTCN
FT                   EDYTDGPIEEMGKRLSDEVIAAVSPFSKSLKKLSFVGHSLGGIIIRAALPHLHMFSSQF
FT                   YLYWSLSTPHLGCISNNSKLINAGVWIMKKWSSSQCISQLALSDAPNYEETFIYKLATE
FT                   QSELFSKFKHIVFCSSHQDMYAPYDSARAEYSPDGPSVYKVMVESLLKNIDPSRIVKVD
FT                   VDFHLPQKNLDTFIGRAAHIQVIENQFFVKILVSRFPEWFIA"
FT                   /protein_id="XP_625319.1"
FT   gene            complement(<17922..>18671)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_60"
FT                   /db_xref="GeneID:3372320"
FT                   /locus_tag="cgd3_60"
FT   mRNA            complement(<17922..>18671)
FT                   /db_xref="GI:66356345"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_60"
FT                   /db_xref="GeneID:3372320"
FT                   /locus_tag="cgd3_60"
FT                   /transcript_id="XM_625320.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(17922..18671)
FT                   /locus_tag="cgd3_60"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356346"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_60"
FT                   /db_xref="GeneID:3372320"
FT                   /translation="MLSKEEILDEIILERLNSAISRVSRCMSCKLNKSKYFDIVENILI
FT                   CKRCLKNSQKFKVVGAHKITSKEIDLLEKNIDQLSFKTNKRAGFSFKNFFSKYFGIKKH
FT                   SYNSILKEKERMEASRLESENYSDFEWDLFSKEQNFLRRNTFDFCSIYEDEKLVSLPFA
FT                   SNKKYASVDCDGRYVFTNENLNYNFRPLDDDLNCRYKNIGYESSGGLSVNCNDKTYEYN
FT                   ENYYITQDHLNTNNKPNVTSKNPFDLF"
FT                   /protein_id="XP_625320.1"
FT   gene            <18835..>19488
FT                   /db_xref="ApiDB_CryptoDB:cgd3_70"
FT                   /db_xref="GeneID:3372321"
FT                   /locus_tag="cgd3_70"
FT   mRNA            <18835..>19488
FT                   /db_xref="GI:66356347"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_70"
FT                   /db_xref="GeneID:3372321"
FT                   /locus_tag="cgd3_70"
FT                   /transcript_id="XM_625321.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        18835..19488
FT                   /locus_tag="cgd3_70"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66356348"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_70"
FT                   /db_xref="GeneID:3372321"
FT                   /translation="MKVLDGQILKGGVISFSNESKGKSEKLLPLKIVQNKYNKHKKNEP
FT                   KRKLLTPFKNESISDFCKRVDSDSRQYLMEKDREALRMQKSMKNKKKREKRSLKNLEKS
FT                   QAKNTNLNEISELESNFSLNNTNRPSFGDVIDSPPLISSKIKDKLEKSKKETKTCSDLS
FT                   EYVNQVRKAYSEIKMKRINESNKLFQNKKKNSERVLNDFGDGWVGIGKFRRQEE"
FT                   /protein_id="XP_625321.1"
FT   gene            complement(<19612..>21099)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_80"
FT                   /db_xref="GeneID:3372325"
FT                   /locus_tag="cgd3_80"
FT   mRNA            complement(<19612..>21099)
FT                   /db_xref="GI:66356349"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_80"
FT                   /db_xref="GeneID:3372325"
FT                   /locus_tag="cgd3_80"
FT                   /transcript_id="XM_625322.1"
FT                   /product="S-adenosylhomocysteinase"
FT   CDS_pept        complement(19612..>21099)
FT                   /locus_tag="cgd3_80"
FT                   /gene_family="HOG000227986" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S-adenosylhomocysteinase"
FT                   /db_xref="GI:66356350"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_80"
FT                   /db_xref="GeneID:3372325"
FT                   /translation="YKMESRIKDISLAEFGLQDMEIAKTDMMGLVELQRKYRDSKPLKG
FT                   ARITGSLHLTIETSVLVETLYELGAEIRWCSCNIYSTQDHAAAALVKKNIATVFAWKNE
FT                   TIEDYWVCLNDAMTWRNPNDKDKICGPNLIVDDGGDATLILHEGVKAEIEYEKYNKIPE
FT                   YLETELDENGKQLSMDLKCMYKVLKMELLKNPFRWRGMLKDLYGVSEETTTGVLRLKIM
FT                   ESEGKLLLPAINVNDSVTKSKFDNTYGCRQSLLHGLFNGCIQMLAGKKIVVLGYGEVGK
FT                   GCAQGLSGVGARVIVTEIDPICALQASMEGYQVSVLEDVVSEADIFITATGNKDVITVE
FT                   HMRKMKENAYIANIGHFDDEIDVYGLENYPGIKVIEVKQNVHKFTFPDTQKSVILLCKG
FT                   RLVNLGCATGHPPLVMSMSFTNQVLAQMDLWKSRELVDRSKNTRFFVKKLSKELDEYVA
FT                   RLHLDVLGIKLTKLTETQAKYINVSINGPYKSEDYRY"
FT                   /protein_id="XP_625322.1"
FT   gene            <22028..>24250
FT                   /db_xref="ApiDB_CryptoDB:cgd3_90"
FT                   /db_xref="GeneID:3372318"
FT                   /locus_tag="cgd3_90"
FT   mRNA            <22028..>24250
FT                   /db_xref="GI:66356351"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_90"
FT                   /db_xref="GeneID:3372318"
FT                   /locus_tag="cgd3_90"
FT                   /transcript_id="XM_625323.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        22028..24250
FT                   /locus_tag="cgd3_90"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66356352"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_90"
FT                   /db_xref="GeneID:3372318"
FT                   /translation="MGINKLLPFLIILLLSISEVYSEQNDEYIAESQVDEDYLIEDFDT
FT                   EDEDSRSLFSLNNIQNDIWSDRFVNGFSSIELENNNSGVIHLLNNNSNIKLGSDEYVIT
FT                   SSNVPNYDSLIVFVEDISQLLNSNEENREIKNQNLLIVTNDTENEILIKSSRLSNGFVC
FT                   MGILNGTEIWSREFCEIVQGFKIDEISCNCKGSFIYSFAESRDQNRALQMQYSKFNFPE
FT                   FGSGGNIQAHHVNDAYLSRVSRNDDPNSNHGDKVPFPPLHGSIGGRSGNVNMQKKETKK
FT                   SPTNNEITFEQNELMQYYHSGSTNKYIINNQDGSHTYDKSKLNELNHQNSINKETSQIN
FT                   SNLIENNSIHKNPWNVNNYNELIKKSSSISNNNNNNNNNNNNKLHTDFSTPKVDSITIN
FT                   MEIKNISFDSLNNSLYKQSFISKFINSLSKALNLIPNKFRIVNIWNEENPSLRGGNSGS
FT                   IGITINIITSSPDEIIIKVKNLKNQICEFSKIFEFYLISISKNIGLKSVSNEIITDKTK
FT                   EKKEKEINSDIESPRTLPIIFTMNLRTRKPYINQKEAFTLLEDELSKSMKIPKSSIDIP
FT                   EFTYKQLNDPLTNESYLMIHTEIWVHPEKQIREEYTSLLTNIYSNIIHNKRSSFSSIFL
FT                   CSKHEIKEIPHIRAHPIEDEQTSNQVNNSPEFSGEKIGISKEAEPTDEGRISKIGRFYQ
FT                   INQNHQKNQSNPHSKKAESIENIQNEYNQDTNESNQINPVIYLFKE"
FT                   /protein_id="XP_625323.1"
FT   gene            <24398..>25591
FT                   /db_xref="ApiDB_CryptoDB:cgd3_100"
FT                   /db_xref="GeneID:3372317"
FT                   /locus_tag="cgd3_100"
FT   mRNA            <24398..>25591
FT                   /db_xref="GI:66356353"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_100"
FT                   /db_xref="GeneID:3372317"
FT                   /locus_tag="cgd3_100"
FT                   /transcript_id="XM_625324.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        24398..25591
FT                   /locus_tag="cgd3_100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66356354"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_100"
FT                   /db_xref="GeneID:3372317"
FT                   /translation="MVAWKKTILFQYIYVTILLGISLIFVCAEEVQNVSEFSQALPNTE
FT                   LNFGYNQGQALVESNIRFPTIGSFFSWLGSFNSLYVKYERTFEEIATSIPPKEDLESQI
FT                   TLMTTYSFLLQCLKTMGELNSIYEASILETNSDMLSDDSSSSVSNLLKECLIPFKDLLL
FT                   KSFIALQDQAFDSGKTYSPALLKSSELIMELYEICWSIFTTILGYITMFQQSMNILLRN
FT                   RSENQEKLKFLENKQEKSSLEQLQSNIYTRRLVDISREEKLISLVLTLFEGDFSVSINI
FT                   LELESLITTENKRSISELEESIKNLEKSIKCDVNSEENSNMLLVKALKEELDSRTNDLV
FT                   RQTSGPPIYLQRYDQELTEIFTKLNLEGSQSDSTNEQNEADDETKVKVEEADPKEVQ"
FT                   /protein_id="XP_625324.1"
FT   gene            <25952..>28111
FT                   /db_xref="ApiDB_CryptoDB:cgd3_110"
FT                   /db_xref="GeneID:3372316"
FT                   /locus_tag="cgd3_110"
FT   mRNA            <25952..>28111
FT                   /db_xref="GI:66356355"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_110"
FT                   /db_xref="GeneID:3372316"
FT                   /locus_tag="cgd3_110"
FT                   /transcript_id="XM_625325.1"
FT                   /product="asparagine synthetase B like"
FT   CDS_pept        25952..28111
FT                   /locus_tag="cgd3_110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="asparagine synthetase B like"
FT                   /db_xref="GI:66356356"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_110"
FT                   /db_xref="GeneID:3372316"
FT                   /translation="MIECLFSPEKQETGRRQILNEEKLRIFDTNINISKCETDFRKGNK
FT                   ERSESLIHLDHETHCIKNDKIPDLEIEISISGIGSFMRIFVVGVIEYCKFQESLKGIDL
FT                   VKIVSIENVVTELMDILNYHSLETGKGFSCLAYVRIKEERFLVFGRDRFGDSSLIISVG
FT                   SRGEEIIISNIESDLLSFQEDVQSIEVPVNGMFLLDLSKLEFKSFPWKVTPSYMTSGYW
FT                   NEEGQKTLESLEVDSKRLLESLRLVFVKEMEKRLTFEVFDDKVFVYMGMLFSGGLDSTV
FT                   LLYLLLEWLFSNLEHLESNIFKRFFSNNQFSEIQFSQDNLFFIVELINTSFAPCEAPDR
FT                   LTGLASYYEILELFENYLRKYRNVSIRLICVDNSGDALTKEEKNILKCIAPCKTHLDFN
FT                   IGGALFFALGGKGVLVDKESFNEEWWQEIIFENEDSSIWNGIFEKKVPFSEATIESTKN
FT                   NESTEHPKDSNFQRKCPYCSFREHSKCQNKCCKSCCRKIQQNLIKPIGESFPACRIHKM
FT                   KTADFSKIPSTQRFIDPKNYYLSELNIDRVLFPQEKEYVKGLIIAEDNKLLYRSKSKFL
FT                   IIGSGADEFLGGYGRHITAKKHNGLQGIRKEMLFDINRLWIRNLGRDCRLALFNNRTLF
FT                   AVFLQPIVIDSIGKLSFENICGSRFEVTKPLLRFIANKLGVQFSSKFKKRAVQFGTRSS
FT                   RQTNLKHFDSNRKATADATYVPVNI"
FT                   /protein_id="XP_625325.1"
FT   gene            <28315..>29001
FT                   /db_xref="ApiDB_CryptoDB:cgd3_120"
FT                   /db_xref="GeneID:3372338"
FT                   /locus_tag="cgd3_120"
FT   mRNA            <28315..>29001
FT                   /db_xref="GI:66356357"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_120"
FT                   /db_xref="GeneID:3372338"
FT                   /locus_tag="cgd3_120"
FT                   /transcript_id="XM_625326.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        28315..29001
FT                   /locus_tag="cgd3_120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356358"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_120"
FT                   /db_xref="GeneID:3372338"
FT                   /translation="MEAHSIISNEISEEIQDLKNKLLEWTSGINGMLELGVEKLNDQVS
FT                   RDINMIKDSSIRIDGLEKRIKDTQELSEIKKVVEIEKEEFKKCFNTNTIALSEKLKRLE
FT                   KQLQEDRQRFEQEKLVYEADLKVAKQQSLEREKSCRIYSENLGLNIGKVNGNNRFTFTC
FT                   IDENFPEREFFFDLFYNEKAQLYEGICCNPQVSDFEPNIELLNSKSITFRQFICKMRKS
FT                   FKQLIK"
FT                   /protein_id="XP_625326.1"
FT   gene            complement(<29064..>30170)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_130"
FT                   /db_xref="GeneID:3372339"
FT                   /locus_tag="cgd3_130"
FT   mRNA            complement(<29064..>30170)
FT                   /db_xref="GI:66356359"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_130"
FT                   /db_xref="GeneID:3372339"
FT                   /locus_tag="cgd3_130"
FT                   /transcript_id="XM_625327.1"
FT                   /product="DRG like OBG family GTpase fused to an RNA
FT                   binding domain TGS domain, Fun11p"
FT   CDS_pept        complement(29064..30170)
FT                   /locus_tag="cgd3_130"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DRG like OBG family GTpase fused to an RNA
FT                   binding domain TGS domain, Fun11p"
FT                   /db_xref="GI:66356360"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_130"
FT                   /db_xref="GeneID:3372339"
FT                   /translation="MGILERIADIEAEMARTQKNKKTEYHLGRLKAQLAKLKTELIEAG
FT                   SGGKGKGEGFDVAKQGDARVILIGFPSVGKSTLMHELTGTETAVAAYEFTTLTCVPGIM
FT                   KYNEAKIQLLDLPGIIEGAATGRGRGRQVIAVAHSADLVLMVIDSTKDDSQRRKLEYEL
FT                   EAIGIRLNKKPPQIVVKPKKIGGVTFNSTVPLTHLDNKMVVSILNEYKIYNADVLIKED
FT                   CTVDEFIDCIEGNRRYVPCLYVHNKIDNLKLSEIDELARQPNSVVISSQKRWNLDTLVE
FT                   QIWGKLGLVRLYTKKKGEFPDFSDPLIMTPQRGVINVETAVKLIHKDLINEFKHALVWG
FT                   TSVKHNPQCVGLSHKLQDEDVIQLVKTR"
FT                   /protein_id="XP_625327.1"
FT   gene            <30561..>34973
FT                   /db_xref="ApiDB_CryptoDB:cgd3_140"
FT                   /db_xref="GeneID:3372315"
FT                   /locus_tag="cgd3_140"
FT   mRNA            <30561..>34973
FT                   /db_xref="GI:66356361"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_140"
FT                   /db_xref="GeneID:3372315"
FT                   /locus_tag="cgd3_140"
FT                   /transcript_id="XM_625328.1"
FT                   /product="b-tubulin specific chaparone"
FT   CDS_pept        30561..34973
FT                   /locus_tag="cgd3_140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="b-tubulin specific chaparone"
FT                   /note="transmembrane domain within N-terminus, no
FT                   plasmodium orthologs"
FT                   /db_xref="GI:66356362"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_140"
FT                   /db_xref="GeneID:3372315"
FT                   /translation="MTKLCEEDEINREILSYSNENDYLSDINNLIDLIHGKLVFYKEIE
FT                   CNEYKKIAKDFLKRIDKYQEQPYVLDTYLEKICYPLSNCIAEFLENNSLVLHNTVLSIN
FT                   KYQEENINSNSQQTLRITEDLDVNIDRRHQKNILRLSDCIYNLCKIRGPKVISLYFPSN
FT                   VNFLEVVIDYISLREKYQLNLECNHESNSNLVLDSSMDLNYNEEFEDLNSLDDQDNWYF
FT                   IYVLYVWLSTLVLIPFSFEVLDSKYMLKESHLFLRILENVIPKILENKYCITNEAASIV
FT                   FAKITCRTDFILLWKNTNNKFSILLSKGMDETPDSLGILIWMKYLIKLAPIESIEIFID
FT                   QIIKYLNIPNNPESSQNSQNLHDRIYNSYKSTSCRTICITRLIIRCIQNDVLLKHFTDF
FT                   ENILNWTLDFLLEQNKSENNLLRHTSSKCIAKILNSIQGNNRAKEILNDILMLNKEKEE
FT                   NLERIEIFKKLSPNELEGKCLTIAELLRSRLTFFFEHYLPEILEFLQYCLNYEYWIGNR
FT                   SFGVQIRDSACYIIWSLARGVPPKVLKPYSNKIISSIIPLTVFDSQINGRRSSCAALQE
FT                   LIGRIGGENVPFGISIVTIADFFSISSIKSSFLDVSTRIGSLDTTNNDDLGSQVLPNYK
FT                   FKKYGNLEESENSIYPFATILSDYLVQNVFIHPNIKFRLLSAIALSKLVPYCHHFCFFN
FT                   ILPHVSKLSTSQNNGVDLSSWNKDLNIFSSNSIFRHSSLLIISVLISKGKILKSKGITF
FT                   WDLFVKPIQKDENTRNGFIKETPISKNSNLIPAEFTWSDYIRNIPILIEKERLYRGKGG
FT                   DLTRKGVLNLIVSLSKSTEIIQFKKATFSRFLQTICESIRHLSFSIQISGCSALDAIIK
FT                   WRMTKSKDSPEFLEIKKLLTDFVQALSSDTTDIHIMALRGIILSIGIIFPHVVNLIEET
FT                   LINDIANCLVGIFNKDKLILSNDEGANNTLNEPIESFNELIFSSKYDVECRRNSIWSLG
FT                   VICYCIIGTEISSKNMILDLCHNTLVQGCFDYSTDKRGDVGSWIRELSMETIACLYYNN
FT                   VFIDDSKYEKILPAFVFNIFNYSDKLRVKAILLLWKILYLHFTNSDSIQGNSIEYTNIN
FT                   MYWIYYRIFHGIPFELFEICQIKEMKEIKLENLCEKNSLKYRLFESCQLILHDVLKDYA
FT                   LIHSKNYIDELKTFFATKSNPLNLGCYYFDMLDSIEKVPHSLYPYLDFENQFLFCLSNR
FT                   NFQILSSSSTNIFKNCLFPFILEEKLQRSALLGLTNWISHSSSMSSSSSSINPYQAINY
FT                   ELNVFLKSTSDFSAATISIFYNIEKLLRLLSTCNQDAAFLCGCMTLHVLQFILVLLTWE
FT                   IFPQEKTVMRGILTTILQVLGNTKDFQIIKISSAVLVHFSFSIQVSEDDELAQKAMESL
FT                   SDLVSHQYPNIRAYTTDYIYNNVCHIQSSKKIESILEYIRETNWTQSYSKEELEKIKIQ
FT                   FRDLCQLEN"
FT                   /protein_id="XP_625328.1"
FT   gene            <35164..>36642
FT                   /db_xref="ApiDB_CryptoDB:cgd3_150"
FT                   /db_xref="GeneID:3372314"
FT                   /locus_tag="cgd3_150"
FT   mRNA            <35164..>36642
FT                   /db_xref="GI:66356363"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_150"
FT                   /db_xref="GeneID:3372314"
FT                   /locus_tag="cgd3_150"
FT                   /transcript_id="XM_625329.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        35164..36642
FT                   /locus_tag="cgd3_150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356364"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_150"
FT                   /db_xref="GeneID:3372314"
FT                   /translation="MVLFQWQSEYEYLLHRICDLLDQCKQMGFLHISTDYRNVFTSNST
FT                   FQNYILIGSSSMREFMKEMIEKMTPFYTPGILSYLAACCVDDINLSHLFSLLRLHNIME
FT                   YYPKSINEHKQRATILTAIFGELYAIKNDFEEGKLKLNDFKRGHVNNSENEQSIELLKM
FT                   TINQLGGLILDSGRDRATFIKEAFCAPSFAPPKSDIFSINNDELLNNHLQTQVMVNRVS
FT                   NVNKGDPLLVSALLCGSSLSIWQRIHLLYDPDRNQAKDSIVYAVIYAAPLMDRMRQLVF
FT                   TSLLQSFCRPQWCNSLLPQLSDKMRRFNNQNTEIIQLIVRGFLLSGVTIWSYESPQQIY
FT                   DISTSCALTAREKDALLKIFRLVDEKALAQESLEESSIAPSFESVIRELSRQFYTSSNW
FT                   DIDDTGFVKSLNERQSYNKLGNSIEGALKLAETDYEFMHRPLNIVSDRVKFYQAMQHFQ
FT                   ANLNDPLASFESKSDALIQLSSFEDIEANLFNVN"
FT                   /protein_id="XP_625329.1"
FT   gene            <37073..>39127
FT                   /db_xref="ApiDB_CryptoDB:cgd3_160"
FT                   /db_xref="GeneID:3372313"
FT                   /locus_tag="cgd3_160"
FT   mRNA            <37073..>39127
FT                   /db_xref="GI:66356365"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_160"
FT                   /db_xref="GeneID:3372313"
FT                   /locus_tag="cgd3_160"
FT                   /transcript_id="XM_625330.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        37073..39127
FT                   /locus_tag="cgd3_160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356366"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_160"
FT                   /db_xref="GeneID:3372313"
FT                   /translation="MYAKEDFGNANISQFIRLNNRLRANGFLSIPFLPDLTSPARSLIL
FT                   NRNQVEEDNNEGTNYLRYANPGVRLSEKLVQTSMISQNLNDVTTPQNLSQIGETERQND
FT                   KFEITPGIRKYTDSEYSGLNTDDLRTVGSILHGICADRDNSFENEQNVNSVTEIAREHS
FT                   VSGRNKMDFPFDMPSNYSSKYGMKPDGNFRLGSSIELSFTTEQPESLSMAAKPESIETN
FT                   QRLIVDGNKLISTIHNLLYELESRGEHTVETINSERSQKNGLIEKLNLLRRKYEALEKE
FT                   NESLRMINRVLTEEEQSNRKNRVQGRETPQGSAISKLEREKQQLLVENSRLKQDILKLQ
FT                   EDDDKSRDKADQFLRSVKNNLDNERDSNRASTFNHTGTSSNISGTTLTTLEKKKILQSH
FT                   YLYSIIVGFEKSISYWKLQANGQNNLDSKNGQDSFEGNETNLGNSNDTISEKSFFEFCQ
FT                   ENNISTSELMKRDKNLWTRGLYMLQNTDRSELESIVRWSCRLLNISNFRNIPIQIGQLL
FT                   AKKSTSATPKITHIFESASSKKISSQNNSQEVISIELHDRFYNHFKTLFDVLDDQDVIQ
FT                   ASNAIYIQLRDFKKFFKTICSTLSLDYKTTSPNECLKILTDLININHSKKAPNTQPQIQ
FT                   SFQENSSNVHNIIESLKIVLDVDSNDQILPTLKQHLESQSAIILSLSKS"
FT                   /protein_id="XP_625330.1"
FT   gene            <39380..>40180
FT                   /db_xref="ApiDB_CryptoDB:cgd3_170"
FT                   /db_xref="GeneID:3372312"
FT                   /locus_tag="cgd3_170"
FT   mRNA            <39380..>40180
FT                   /db_xref="GI:66356367"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_170"
FT                   /db_xref="GeneID:3372312"
FT                   /locus_tag="cgd3_170"
FT                   /transcript_id="XM_625331.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        39380..40180
FT                   /locus_tag="cgd3_170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356368"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_170"
FT                   /db_xref="GeneID:3372312"
FT                   /translation="MDFEDIPFEEIIRKEKIAESFEKRKSAESEKKNANGSYKSCKEFE
FT                   KNDEIDQRLKKYGRITSKNSPMEVSSRRQILPEKLENERNYIRNKHDSSKKGNDPRFND
FT                   SCGKLNTDLFHKSYDFLDDMRQREFNQIKNTLDLYKIMTKSKELGTWNKVKKSSKFKNS
FT                   DVNHLTQDQIDNLKLKYQKLVSEKDHRKNLYLKQQTISQHRKQEQTKIESGKKPFFLKQ
FT                   KDINLSIQHDKYKNLNKKQISMLEQKINRKNVSKFKPPTSLRKI"
FT                   /protein_id="XP_625331.1"
FT   gene            complement(<40303..>40815)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_180"
FT                   /db_xref="GeneID:3372333"
FT                   /locus_tag="cgd3_180"
FT   mRNA            complement(<40303..>40815)
FT                   /db_xref="GI:66356369"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_180"
FT                   /db_xref="GeneID:3372333"
FT                   /locus_tag="cgd3_180"
FT                   /transcript_id="XM_625332.1"
FT                   /product="domain KOG1666, V-SNARE (intracellular
FT                   trafficking, secretion, and vesicular transport)"
FT   CDS_pept        complement(40303..40815)
FT                   /locus_tag="cgd3_180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="domain KOG1666, V-SNARE (intracellular
FT                   trafficking, secretion, and vesicular transport)"
FT                   /db_xref="GI:66356370"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_180"
FT                   /db_xref="GeneID:3372333"
FT                   /translation="MTLSKNSIEYQSYQRYQRVYEDIYRKFDTYREESMASSYYSNKEL
FT                   DMSTNISGNDGQNYLKPSTKEYNMGVSTEDLMKRNEDNLRISANLAQETQHIGLYSLNT
FT                   LTVQRDNLTRSKYGLNNIDYNIMESRKLASTLYKQKVIERLMLYFIIFVLLLANIYVFF
FT                   RRILGRK"
FT                   /protein_id="XP_625332.1"
FT   gene            complement(<41835..>43697)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_190"
FT                   /db_xref="GeneID:3372328"
FT                   /locus_tag="cgd3_190"
FT   mRNA            complement(<41835..>43697)
FT                   /db_xref="GI:126644373"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_190"
FT                   /db_xref="GeneID:3372328"
FT                   /locus_tag="cgd3_190"
FT                   /transcript_id="XM_001388052.1"
FT                   /product="latent transforming growth factor beta binding
FT                   protein like (3F865)"
FT   CDS_pept        complement(41835..>43697)
FT                   /locus_tag="cgd3_190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="latent transforming growth factor beta binding
FT                   protein like (3F865)"
FT                   /db_xref="GI:126644374"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_190"
FT                   /db_xref="GeneID:3372328"
FT                   /translation="LYFKFDINNNRIPSLPSPNNNNNRISNIPNSNNYYDRVSSLSFPN
FT                   HNNNRVSSLSFPNNDNNRISSIPNHNNNRVSSLSFPNNDNNRISSIPHHNNNRISSIPN
FT                   NNNNRVSSLSFPNNTTTEYPNIPITTTTTTVVTTTSTTGYPTTTTTGSPNTTTSTTRSP
FT                   TTTSTTGNPTTTTTKAPNATTTSTTGNPTTTTTKAPNVTTTSTTRSPIATTTGSPTTTT
FT                   TKAPNVTTTSTTEHPTTTSTTGYPTTTSTTGYPTTTSTTGYPTTTSTTGYPTTTSTTGQ
FT                   PTTTSTTGYPTTTSTTGYPTTTTTTTIPDITTTTTEYPNTTTTTSEPPKYAVSLVMDLS
FT                   KVPNIDQMKEINLSANVIYRNLVESGINTEILSVPINEQNKTQGHTSFISTLQGSDNNM
FT                   RVDRLLSMVAQQDSERVLNVIAQQNGTDSHSNQRGYHNKVLLKRRKIVYITAGFNGCTS
FT                   VKTCPGIVSLKKDIDIYFISLSKDANMYREIEYISSEPVLMHSIMMNKSDLSNEASHIS
FT                   KWIRDEYRFNNPMFLIPKKVKKNFKNEVCSKCSKNAECYVHSIFETTHDLSKFECVCSE
FT                   GYTGDGFTCRDIDECKVGNYCGKSQCCINTPGGFECKDSKDGKC"
FT                   /protein_id="XP_001388089.1"
FT   gene            complement(<44658..>45866)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_200"
FT                   /db_xref="GeneID:3372340"
FT                   /locus_tag="cgd3_200"
FT   mRNA            complement(<44658..>45866)
FT                   /db_xref="GI:66356371"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_200"
FT                   /db_xref="GeneID:3372340"
FT                   /locus_tag="cgd3_200"
FT                   /transcript_id="XM_625333.1"
FT                   /product="zfwd1 protein, CCCH like RNA binding domain fused
FT                   to WD repeats"
FT   CDS_pept        complement(44658..45866)
FT                   /locus_tag="cgd3_200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zfwd1 protein, CCCH like RNA binding domain fused
FT                   to WD repeats"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66356372"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_200"
FT                   /db_xref="GeneID:3372340"
FT                   /translation="MRGRWKGGKGGHGGSSSGGSNTKVSEICRHFVQQGNCKFGQNCNY
FT                   SHILRQVAQIQKAHFGGIRCAISSPLPTGELELFTGGCDGQLKRWIIRPADKDVMTTEP
FT                   ERGSNHRRRNYQNKFQNDVSGATQLSVKMDSAINCSAEVCSCLIYGDVLFCGLINGTIR
FT                   AFHKPTGNFTDLVGHNQEIHQLLIIDNILVSACWGGKIVFWKFDQASGTFIISAQIQAK
FT                   EHIKCLKYFPYKGNSAGAMGQPQCQIQDASPHLWVCGGGIVQIVDLITLQVVREIIFDG
FT                   GPIMSVLEYENHLVLCSLQGVIRVISPTGEETFRKSLGSPALCMDGTVTADAKHILMMG
FT                   QNNGHLRCITLPLFDSVLEFHTPDTRSEIRLVSNLGGSPGIILTAQWDGALNFYQWCLP
FT                   KSS"
FT                   /protein_id="XP_625333.1"
FT   gene            complement(<46248..>52061)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_210"
FT                   /db_xref="GeneID:3372337"
FT                   /locus_tag="cgd3_210"
FT   mRNA            complement(<46248..>52061)
FT                   /db_xref="GI:66356373"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_210"
FT                   /db_xref="GeneID:3372337"
FT                   /locus_tag="cgd3_210"
FT                   /transcript_id="XM_625334.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(46248..52061)
FT                   /locus_tag="cgd3_210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356374"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_210"
FT                   /db_xref="GeneID:3372337"
FT                   /translation="MATFNIPNFKIVISSVFCDGIVETPRQTHHSNSGQIMSNNGWFQL
FT                   YAVSTKQSLERDADAEDQYDSGEERAEKIVDYITSSIKGLFPNIPSEFYLKYGSASVVI
FT                   SQLNVEVVKTNNDLASTISELEEVNSSSFLNQEKTFETPLVNIILCNFDGAPSISSSPN
FT                   SFSHILKLYEVSNTYQEIELLFVGFSASKHPETERLSKKNFEKFKTELQRLFGNNAKDK
FT                   CLWFSASNQLDMPDSNLHVCARQIHTRLLEEAANAVNARIKSVIEYILDSRNEGPKLSH
FT                   SLKLTDSSLTPEILETPEFLTSGVNSPISSQVSGTQCRKLQVSDMWYQWILDIINKSDL
FT                   LGLMLFRLGLINEALLIYEQLLDDCRKPINPFIKELQNQSVGFAEIVAPKDPLLLASDC
FT                   CFGDCKTHLTENNTLIHRDKLILPLDFSKLILNKRATYFDIVQIIFLRQIFILLSVKDF
FT                   RKVCNRIQMFSRKFSKEILPVTDQLKYKILCHLWIFRFIMSIAAISFPGVPSNPAYTSG
FT                   HSPGSAISSLKIIIISSILPRLIHFLGASESVDVWKHKPSAPKLPPDSNVSSMEIQTAL
FT                   IKWATQCISSILLNCICDFDEFSRLEEELENNSNKTNHSVSTITNKCSQFSLYDKVPIE
FT                   EKSNNINNDSGLEQNSDTGMDTKVCLKSKNSNFEYSQSLSSPSFSLFHLASRHLSLVCI
FT                   LLSSEIWNESSSKLDGNKTFEELLDIQLLQNMSNNLNDNAEHYYTLKELYCSLKSPSKA
FT                   YRMLCEVVGMAAMDYISSGQLKSAISLPWGIIFENKNFLKWILKELNCETSTFVDYETS
FT                   KISDISFCYRFVRIWLDFPTILLPIPLQWAKLSNISQKLLIKLFAKKVNPISLSYINYN
FT                   DSYLLQAEIGIRLFLNILDSNNQSNFSQENGSNKDYKENTALEEQLILETYISKCLENS
FT                   NIVKVDSLQWEFPSHPNLWAHLFIPEYGSEKTKEIPKLKMRAFINFGNQTTDKNEALES
FT                   YDLQTKSFKGVTLKIVERQILMALLGGGKLIRLPTKALPCCGLLDPLKPVQGYFYVFHE
FT                   ILRPSGRLFLKSPNVLSPLQSPLGSSGQQIKPSEDIGSRIGQMEKQEIGKNMESQRIEQ
FT                   QEAGNNLSTQKMKSSNRSGSNSNYNSWFQKKSSKHERSFSFSNSELEHVREGRSNISNP
FT                   MGSNKRKDGSPRQWMWEIVTGFKWGSSSYGSSSKSKSKASSFNGSLYSEKTNGISEMNN
FT                   LDDRERVPTSTSVHGSSLKNSERLKIPSSPLDNAIKVEENLSPSKVITVNTPGPSNWVI
FT                   TEASKSNSKKSASASPKLALSPKNEDSTQCLVTPPNSWIHKFAVPGIPSRCILLIYIGL
FT                   SSPVYFGSVWLRVNGTRWILLENTITESSKGKVILEPGLNKIELDIFCEEGESSFFIDS
FT                   IGLSDRTSFSIPINFLWVIPLGTLPSPHILPKVISEFQIFETNLGILSGKKPINSGIIT
FT                   KTSKDELECNRDNAWNPLKKWTTLYSFGIKNLSEMISMEIQFRDIIQKSNLPESASRNL
FT                   LSTNTGEKKLYRISVEIERDWFQIYNVDMEVTLSFQESETESIQVFTDEVELVQLDGME
FT                   SSSILKPEINQKLIKLPSFSSECIIQTPIMFDMSPMKTSTEVNFSLNLIASIKGQDKEV
FT                   CTRHNFVFQVGPQVDLKNIQPVPNLDHYSLPFYYFELLFEATCKRVLVEKIITMLPKDL
FT                   ESSDLFGIMAPVELKPRTIENFQDLGDLYSIREYTLSHPLIIESNSRPLKLIWIVPKTE
FT                   LQKVLTPQILISTISLPKEERTKLSISGPFQIPMETLYNFISLRKSTHSTDNLLETSLD
FT                   GLSLDHVEHPSYSKVDSEFPLIIYLNYTFQKEETFSYCLNYFGDEDSEDKGCWWFIGAR
FT                   NGYIEAKPGSKIKLEFRVVPLTNGLLKLPSINFGCSNSRPYSYPYFTLSDNSRRFYLGK
FT                   QVVI"
FT                   /protein_id="XP_625334.1"
FT   gene            complement(<52679..>53176)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_220"
FT                   /db_xref="GeneID:3372336"
FT                   /locus_tag="cgd3_220"
FT   mRNA            complement(<52679..>53176)
FT                   /db_xref="GI:66356375"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_220"
FT                   /db_xref="GeneID:3372336"
FT                   /locus_tag="cgd3_220"
FT                   /transcript_id="XM_625335.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(52679..53176)
FT                   /locus_tag="cgd3_220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356376"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_220"
FT                   /db_xref="GeneID:3372336"
FT                   /translation="MSNLSTSTVTQGAQTYNQGTGTQTQTSPNTQTTTSKKTMYPKPQL
FT                   QQSSISGYEQVSSGVSSPYNGSVGSIPVVLQPPSTSVSPSNYYAVPPAQYILDTSIYSS
FT                   ATPYVAVPATVLSPTVMTSSPQMSAAYASYGFVPSQNLGYTTVGVSPTNTSRPSKYSPG
FT                   CC"
FT                   /protein_id="XP_625335.1"
FT   gene            <53934..>62207
FT                   /db_xref="ApiDB_CryptoDB:cgd3_230"
FT                   /db_xref="GeneID:3372334"
FT                   /locus_tag="cgd3_230"
FT   mRNA            <53934..>62207
FT                   /db_xref="GI:66356377"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_230"
FT                   /db_xref="GeneID:3372334"
FT                   /locus_tag="cgd3_230"
FT                   /transcript_id="XM_625336.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        53934..62207
FT                   /locus_tag="cgd3_230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="shares a domain with plasmodium"
FT                   /db_xref="GI:66356378"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_230"
FT                   /db_xref="GeneID:3372334"
FT                   /translation="MALERDIFEDLGSSSASMLVVSVGSLKLYSKILKLLPGTFKIALC
FT                   VGLRHEPIKDVSCVTKRRVFATLSRYHNGSDAEADQIEHRIQHNFGIPIPFCLDNKATT
FT                   VRLAIFLVMNDRSLVPVCRSMIRLSSTRDPTTAMKWFPLVKYNGFTGVGSVDNTDEFEV
FT                   IGEPGKEKLVKRHLVVGSIQILTRRVLQERIGRPDLHDALCFSTLCDEKKSRKSLAEQY
FT                   DDSSSEYNFSEKDLSCNELDEEKDNLFNGKYTSKIKGCYLESSIESLEDKIPFPFIQFK
FT                   DILSKYPTLQNIFHLMPLYNQKINKRILMLQKRNKNAKVVLIGDDFSSNYRSGISMPIK
FT                   VPSSIENIMSSSLDWNTWFCKSVDIAIMQSVEAYSKSTIFPSTSKYKAGKCDMNKKSSY
FT                   NFVGNKISTYHFEYFMKSLESNMDVLLVNTIFGAAATEFSRDIIDDVIFRGKNQVRKFT
FT                   PYKNLFVIWDYMIKRSYQELGMDYDIKLNNEEKMDDSTLENKVGEEVVEVLNISDISDT
FT                   ETHNIKIQETNFCKLENDFEEFSEIVAFDENIPKVAEDSSSEISQDQANETIPLYNSLK
FT                   RKVVDSIERSQIIPLSEDHPFSSLRLFENDRVFIHHKTIGRGLLGILVLGDSQTSAEDA
FT                   SKIYTREISAHMAINEAILRTKVKKAIRIYNSISKGKIPPRKFIPNSKAVIGYDGYIDP
FT                   KLNKKLSDFEIAMILLKGIDKFVKCSSEILHPSVNLTTVSPSLITCVDYSGFRIVVRPL
FT                   PPIPFTICDWPLPIQSNERGEISNIEKCLNISNILHPTKLISEIRHLPILLETSIGIFK
FT                   YYNFHHTYNIFPRDPWVSDVKGERVNWGNSSTDEYYHNYDTFSKNKLLSRNKCCTIRPL
FT                   FIKQAGAVQDMLKYQDTDEKLRRFHYTPDDLHELFRKEIEPSGFCLVCASDVQQRSYGF
FT                   FNINKEAMLFKPVPMNLISKFTETTTNYLIKINDGTHCSLCGKSMRVETQANSNNQMEL
FT                   ISYIGDKIPYPTLGHYDDGAAIKMNRVKLMTSYMQSSSDYFSEWSFTEGDVFRRDQIFW
FT                   ERRPGLYCLPRSCIKGGGNLLGTGLDTIKYLLSQAKLLLNAFDDNTRFSSASDFNREEK
FT                   LKIVKGVDVFDEPKRQSTVKIFFDESNIGQEIILLSNSLHTNWIEIVLNQLESIPAFAP
FT                   YDSVTLENFLHSRGVNCNMLGRMLNFTRSPWLKQLFSIEIVSRTIKNLIPRLIKTLFLP
FT                   GAISYMKKESGNLGRYCPCHSSSPSVSMLHTIFKIYITSTKRRIGSECIMINSSAKDSR
FT                   SKLFSSQFLNTDVVADQEKVIHREMKNEEKDTANNSKSLMIQSPIYWNEIFKALNENNW
FT                   DILNVHNIKISEISKLLVDWASQFFNVDDNILSYTNRETLNSRKKENDKLESEKSDLRR
FT                   FSRELIQMNKMSLPYWVLECLFSLNQKSLIMLRRHRFHQITILQVMLTNLFNLILGDSP
FT                   NSQLFWSTCISKLCSWEFSIAETSISKSKIPIGALFYALKHHTGVKFFLDIKKLKENLQ
FT                   DDSTFPINYDDFDSVLPKAKRKSEQYFSESLPIWGILETPEIIKLPRYNSFSVISTPTI
FT                   SQKLIALSIKLSASYFTNIQFFLDYMTHSEQFQGAERHLVRQDWIVQESWLELLGYFSY
FT                   LEYDKKCIQILNNVINLFPQDHIASVQMRILQMWSYSRLRNIEIFKNTDFNALNNNFDQ
FT                   ISISEKSIPHEISVSTLIFEIIDLHWSVIHPIIIDVYTSTALIHFLRGNWKSCEEILEK
FT                   AITKSLVISSCFDSNSDVFRHYSKLLSSRKNSNWEFENNTLDSNSSLKNRILLSNIKYA
FT                   INSKDTDKSIIQGIFGLHGKDENELEYELYQRFLNSNLQYIPRLLNTIENPNPNRIPKT
FT                   PPKLRIGWLLKQLGRVRLIHALHLYYFNKNNKEFRFLKETDIQSTDSTEESINESIGKN
FT                   EINTLALLDDSIESILELSCFTTQWALDIFDYYLGATTLETASCCYDLAYGLILLDNII
FT                   KDQMSSVLLKRSCELLIASFDVNSSLLIPSSFVCIENLIQLALVYEKQNSFSYSLKVWE
FT                   LVLEQLTIKSRTFDDIDYRVLNEFSIVSWCTPNKYFNIPLDFESKSDNFCLNQSQAIIR
FT                   EYISINQNKCLENNTGNEYLQGGFSSKNGNSFKSLSSDSGSNSNFISDSKFSSENSKNP
FT                   LPNDITPIESGSFETNGQEIDQNMIIISAKNMKKESSQWNLRNIIRLLFQTKERMVYLF
FT                   MNACNGNQYHKRLFRLFLLASYLKRGDKLVNLKDWEPILSLNRNSKDVDKSRLGSSYNE
FT                   KNASGLLFSVIYEANSWLYETEETNLAVSTFIENHPTKINRDKLFTGDGYSGPVSILYN
FT                   KVMVNNELTLGSRIYDYNSYTKDSMESIQIRNYNSNELRPGGNGHRIGSIRSSDNKHIK
FT                   RINKQYSDIKASGMGRTKSSNKFNEMDFCMSGMMVINSLNNTTGELSENSNQSYGTMDE
FT                   GFGKLRQFEFDNGENSKQISSLSINIDETKSKSNPRYLVSHIKESVEITAIENFFIDLI
FT                   KEAEDDIKFIWKSMKEQIRLFKTVKKDELDEIRRINSRIQYEQRISRLSKIRINEILND
FT                   SGSSEIKYLDLDLERSNLVKNINESFELSSISDESFSISFPIYKASLIATDNESKNLLS
FT                   KLMVYNSKKATFDDEFEQIGNDSSIIYNSLLKKNTVIYDKTIIQSDSEERKMIDGMKLN
FT                   MENAFFTESSEFDNVEDYTKSYPLSYRSKALDILISLIYYTTDYRDYFSNWKDNRKT"
FT                   /protein_id="XP_625336.1"
FT   gene            complement(<62638..>63297)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_240"
FT                   /db_xref="GeneID:3372335"
FT                   /locus_tag="cgd3_240"
FT   mRNA            complement(<62638..>63297)
FT                   /db_xref="GI:66356379"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_240"
FT                   /db_xref="GeneID:3372335"
FT                   /locus_tag="cgd3_240"
FT                   /transcript_id="XM_625337.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(62638..63297)
FT                   /locus_tag="cgd3_240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356380"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_240"
FT                   /db_xref="GeneID:3372335"
FT                   /translation="MESISTTKDTHDTEILHFNNQSNSFQDLDHDHKIDTENINTGTDN
FT                   IKIDSREELIPSLDFDDLSMIERVSKEGVDKSFNMKSNVDENEIIEWKVLKKALRKEIV
FT                   LKSNQMFEKYGGLDQLDYLPYNCKLHSNLENSHLDEVSPRHKNIEYSCPDCGKSILENF
FT                   LMDILEAFDCHTDFPPTIQRICELLLFPDCYNNTKSFLYALDKVCLTRISFSSFKN"
FT                   /protein_id="XP_625337.1"
FT   gene            complement(<63983..>66301)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_250"
FT                   /db_xref="GeneID:3372327"
FT                   /locus_tag="cgd3_250"
FT   mRNA            complement(<63983..>66301)
FT                   /db_xref="GI:126644375"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_250"
FT                   /db_xref="GeneID:3372327"
FT                   /locus_tag="cgd3_250"
FT                   /transcript_id="XM_001388053.1"
FT                   /product="protein serine/threonine phosphatase alpha"
FT   CDS_pept        complement(63983..66301)
FT                   /locus_tag="cgd3_250"
FT                   /gene_family="HOG000246464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein serine/threonine phosphatase alpha"
FT                   /db_xref="GI:126644376"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_250"
FT                   /db_xref="GeneID:3372327"
FT                   /translation="MSVPICGGRTPGRRYGHIMVYSKPNLIVFGGNDGQRTLNDVWFMN
FT                   VEESPFVWTQVLFDRDERVPFPRVYHSAALCTEGPAAGMTVVHGGRASDSRCLRDTWGL
FT                   RQHRDGRWDWIEAPCRKGGPPAQRFQHVVLFVGSKMLALGGRGDDVSKVLPSMLYDTEN
FT                   CEWRDLPGIERFRHSAWAIKSTLFSFAGFDHKTQTHPTVDLLSMDCSAEPNFYNEKERS
FT                   IRRKSLIGVPYNTIGVQPKDQLVFGTGDPNKTRSDLTNEDLGSSTTNEQNNVQEYNSPK
FT                   SNDIPFTDVERAIARANIQLQNDSKRYIPKMEYKTTAGLIGLTPAVTKVSSRVHITVDS
FT                   MNNDFSTLVQKVSIDQLGEEGRKIDKVAAKHALADSPWMLTPSSMGVPGTGLIEKCLKL
FT                   FLHPTITPVELSARFNHMAAFSLTWPEVIQLCEMAFSIVKQEDMVLKLRTPVKVYGDIH
FT                   GQYYDLMRLFHNYKAPISEELEDIFEAKGDIDSTDYLFLGDYVDRGSHSLETICLLFAL
FT                   KIRYPRQIHLIRGNHEDPVVNSLYGFKDECRRRLREDTDDPDSCWNWFNRVFEYLPVGA
FT                   IIEDRILCIHGGIGGSIHKVEQIKEIQRPLRPSQTPQTEYEQRILDLLWSDPTDNDSLE
FT                   GIVPNDTRDPDGCGFIVKFGPDRVIQFLCENNLDLIIRAHECVQDGFERFAGGKLITLF
FT                   SATDYCGKHQNAGALLFIKRDLTVVPKILLPSASKDPRMILNNSNYWDQNILSERPPTP
FT                   PRSATYFDKINSEFIDIAS"
FT                   /protein_id="XP_001388090.1"
FT   gene            complement(<67742..>71284)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_260"
FT                   /db_xref="GeneID:3372326"
FT                   /locus_tag="cgd3_260"
FT   mRNA            complement(<67742..>71284)
FT                   /db_xref="GI:126644377"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_260"
FT                   /db_xref="GeneID:3372326"
FT                   /locus_tag="cgd3_260"
FT                   /transcript_id="XM_001388054.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(67742..71284)
FT                   /locus_tag="cgd3_260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644378"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_260"
FT                   /db_xref="GeneID:3372326"
FT                   /translation="MQSIKDGEESKNNIEVETSESKLSRDSSVFGLSNQTPKPPIKRDS
FT                   FVGTSYLPIQNHYKLGEKVGEGSWGAVYIVEERCSGILRAAKKIPKQFSGEIFRFRQEM
FT                   QLLSILDHPNIAKLFESFEDYNSIYLIMELCTGGELFDRLSHVGRFSERVTAHLIKQML
FT                   SAISYCHSKGIVHRDLKPENFLFLHSKSNINCKHCLFEQKSSQLFQDEEAALSKYLKQD
FT                   RFRICRSLPSSMNNQQLQSLIYNINDNTITPSNNNGICDITSNHLFSASNSEICKKNRD
FT                   KEVGERHESYDQETNNGELSHTDIPIPNSEPFGSPNFIANMYLKKGSVSNSISNSNSSS
FT                   IKYPIPSHQEKECECNCNCFELNSPLKLIDFGLAKRITRTGTLRTRVGTLYYIAPEILL
FT                   GKGYDDKCDIWSIGVMAHILLCGVPPFAGNTDTEIIEKVRRGSVSFSESIWSQVSTQAK
FT                   DFLLQLLNKNPSERISAFQALQHPWLRSWDTPNIPLCGIGMINKIVVWPWHQQRMRVTK
FT                   SRASSGISSLKIKSSISSPSLYSNRERINDILSEEDLNNLSGSDDNTPVVTSSPETGGF
FT                   FKTQIVNAPPRLDSSSGQGSVAGSMIGFLESHGLSTGSQIRNVNRNSMLKRSCSTPLLY
FT                   SMNNAYPNTDANPSLASIPNSSIYNPGLVQITDQQIATPRTKATINALLNQEDSILSPP
FT                   GDTRFHFGCHCGNPIVLNHICQGNVTINSIDHGSCDGSKSYSGISIPNSISSSSSSSST
FT                   FTTSYSISRSSLSFSNLLTNNNLKQGNIDEYLENSDENANGQRISVINNVTIPNIVSKV
FT                   CDKEQLFHCVIYNKTCNAYKPLLKLISSWERFCNYTLLKRVILVSIALRIGENCEFNQL
FT                   RDQFNRFDVAADGVVSLAELQCVLCFIFHVERISSSNYKNKQCHPKQTSNDNFQSASSR
FT                   SSSLPPLSNSPNNQPSFEDYIDNASEIEEDHFDEIYDEGFRSSAIESPEKGAFNHSNQI
FT                   GNRKSMSIDDYLKSLSNQSTFNKDQLLKFLCSFNIDDIIKLNELCNRIEGIFGIIDQDQ
FT                   SGSWEYSEFIAASMEPEMYLNNTSALKTVFRNFDKDSDGKVSVQDILASFGWEDDIILC
FT                   SETISPQQYEQYLKLGNSQSYDQQRDERFLGVDQSNSVQYCAHIHWTEIFLNECCKPGK
FT                   NYLDFCDFYDFLRN"
FT                   /protein_id="XP_001388091.1"
FT   gene            <72411..>75803
FT                   /db_xref="ApiDB_CryptoDB:cgd3_270"
FT                   /db_xref="GeneID:3372332"
FT                   /locus_tag="cgd3_270"
FT   mRNA            <72411..>75803
FT                   /db_xref="GI:66356381"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_270"
FT                   /db_xref="GeneID:3372332"
FT                   /locus_tag="cgd3_270"
FT                   /transcript_id="XM_625338.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        72411..75803
FT                   /locus_tag="cgd3_270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356382"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_270"
FT                   /db_xref="GeneID:3372332"
FT                   /translation="MGTKLVSNIKNFIISGRNQNGIKGLVKGSYPNGYRNFGPDLDRMM
FT                   LPLNKKYVDESKLVDSINEEINSIGGCSTSGGGKDNYYLSVLKCLVEFIQWDIKKEREN
FT                   YAKYGMFLFLKLLEGYKDHWVDSIRLTAFIRNQSEAWLSKDSGALQYYGKWIILGNMKR
FT                   SLEKNSHLYYKEFEGLSNDGAHIVSTNPNIGQKYPGLSANSLPIKMCTLSNKLVEMLCK
FT                   CVININNRLESKNGKEKLKGCKNSIITEEQSLKANEVSNKDLIEVTLILEIILLGFLME
FT                   GEIFGEKSDALISEFVIPSLASIIDSKLILSYCLSFHNVKYYLNENGPGRSLYNTMEIF
FT                   REDSNLFFQGDKATINELIESLYMRFLYLIETLSIIFLKEFQEEKAMQQRCSETISGKV
FT                   TSEIEDDSVSQSTSLNNFNNNISNNELGLIQRFKVQDRINILPLKFKSLNDKLYSLCYY
FT                   PYILTSDICLSICRGNSDYTVELITLLTCALRYHTINTGYSEDFQRLFQNTDPLFIIDE
FT                   LMVSISGGNDEIPRSILYYETPQYCYSLLRCLHRVLCCCPRIVGISRLVSTLINLIDVI
FT                   LPLYDLNGTLCSRSKNFDGQISNIGNNRGGMAGGDIGKCALLMRNVAFQVVFDIMCILS
FT                   DTSQVFYVIRVLVKVRDWCGSCLLDLIRRCQRLASQSSEMGNLNKRSLSTYNSQLKSNN
FT                   VGGVNGLTTAVNQKYDKLDLRTRVGATGLLQTSNKKISELGNINNTSEGSKLVQNSSLV
FT                   GGISGSVASYNSGIDLSSYLNIGGLREFDLEIVNPSFWSASKILEIAGINRKWITGQIG
FT                   NSGNNYISMNFTGGGAGGGGMINGLNGNNSNNMSISSGISSGLSSDIIVSSKTTQVIFN
FT                   RSENMGSNNSGNSGLGGALRTDVIGGSTKSIPSTNTNIITATTNATTTTTSATNAATVV
FT                   TSSTTTSSPSAITIGAGNISSSGSSNYGSISSPKAVVLPSSNYCYDYSSEDEENEDYDF
FT                   DDIDTSSDEDKSIVNFKGSERRRGGGRYKFGGGYAEEDRRREEEDDDSENSGGEDGDDD
FT                   YWEADQKLLELIRLRPTSSIINAQPPTAGILRRTVSSDVSISKGTFSKIGSISSLWTKH
FT                   NSSPPKALSSMKRVCFAEVAQIY"
FT                   /protein_id="XP_625338.1"
FT   gene            <76894..>81213
FT                   /db_xref="ApiDB_CryptoDB:cgd3_280"
FT                   /db_xref="GeneID:3372331"
FT                   /locus_tag="cgd3_280"
FT   mRNA            <76894..>81213
FT                   /db_xref="GI:66356383"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_280"
FT                   /db_xref="GeneID:3372331"
FT                   /locus_tag="cgd3_280"
FT                   /transcript_id="XM_625339.1"
FT                   /product="mRNA translation inhibitor SKI2 SFII helicase,
FT                   DEXDc+HELICc"
FT   CDS_pept        76894..81213
FT                   /locus_tag="cgd3_280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mRNA translation inhibitor SKI2 SFII helicase,
FT                   DEXDc+HELICc"
FT                   /db_xref="GI:66356384"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_280"
FT                   /db_xref="GeneID:3372331"
FT                   /translation="MFANQDDFWTSDEEEEEEEGVEEEGVEEEEVEGEEDKDEEKNDQK
FT                   NDLDMVEEKVSRISLKEGKEGEENGEEEERKKKKGFIRKKWSIEDERDVSDFREIIGYE
FT                   PCKKEDLDDSEDLENVVLKYPYELDDFQKRAVINIHNGDHVLVAAHTSAGKTAVAEYAI
FT                   ELANKNGRKAIYTSPIKALSSQKYREFLNRFREYPAHSSFTQRNRIGIITGDVSINPDA
FT                   QCVIMTTEILRTMLYRNDPCIEQIQTVIFDEVHYINDLERGVVWEEVLILLDPKVQLVL
FT                   LSATIPNYIEFANWIGRIKQNTVYCIRTLHRPVPLKHYLYIYEKCFQIMDENNKFNING
FT                   YKEMLDFIKTSKSKKSISSLKSKVSKLSSSISKANSSQEIQSQEDPNQEDPSQEDPNQE
FT                   DPSQEDPTQEVQSQEEPIQEDQSQETQSQETQSQEIQSQEAKVEDNNIAMLRISAINKQ
FT                   ISSSAGAKGGSGGILSSAETKFKTEVYRLQVFLKLLEKNDQLPVILFGFSRRKVEQLAT
FT                   NLPNLNFLYNHNEKSNIITFIKESTSKLNELDQKIPQLLQCKELALRGIGIHHSGMLPI
FT                   IKEMTEILFTRGLIKVLFATETISMGINCPARSIVFTSIKKYDGRKNRILLSSEYTQMS
FT                   GRAGRRGIDTFGNVFIFNSSHETIPECIDIVKMMLNTYLPVQSKFRLTYQMILQLSCRH
FT                   SLKIEDMMTKSFKEMFRSINLPIFHRNLNRKLKRHQIILSKLHSILESYNSNLVISNYN
FT                   QRNTNQKDEFQFESDSESLLNIINGLISTIETSNLISGQLFQKLCNSSINKNIISQKIL
FT                   NPGRLILFNSFSLTGKSLPMFANILEYNPTSTLSSIIVYSQEFIDFQFSSNNYLSKNIM
FT                   DGNDNNNNNNNNKGIGDSNNDIQFYDVVEESIQNYQNSNKNRQISVVQNLIDLDRSKKN
FT                   NNQRNSSSSYSSKNSTTINLIHHSTFNSQKLLISTSLYNNTNINEINPLFKNINNYYIF
FT                   QNVPLELFMFIFDFNASATNNQTNLLKSINFKDISILHNIAILLKNSVQDFLSNQNSIN
FT                   NMNGNCNNSLKNNNLGNSGINPNIGPKPKNKNNKKGMKVNLFEFISHQEQQNQQLNTNR
FT                   GNITEYSSSSSSNIPENWPKLLPISKTLKSIEIEYYELLQRYNDLFPEFVNNHIFKNCY
FT                   SFIIEENNNHNDNNGNNTMIQLIVELNKLDHEISIYKHFINDESLDDYPEMKLKIQLLI
FT                   EKGFLNENLTITTKGRIASELLTSDELTLIEILLNGMLHKLNNIHEITAILSCFVFPEK
FT                   MESLSNSNTSTNNNNNNNNILGIDRPSLPSVELLNAHDELINIHTDYEKTHYKHQINLD
FT                   TEHFWSLCNDKFMLIAYKWSNKESLKEIMEFVHNSEMNLHEGTIVRTILRLDELVRKLI
FT                   IAAKMMGDKILEEKLCLIHENIARDIIFMTSLYFNSN"
FT                   /protein_id="XP_625339.1"
FT   gene            complement(<82451..>84325)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_290"
FT                   /db_xref="GeneID:3372330"
FT                   /locus_tag="cgd3_290"
FT   mRNA            complement(<82451..>84325)
FT                   /db_xref="GI:66356385"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_290"
FT                   /db_xref="GeneID:3372330"
FT                   /locus_tag="cgd3_290"
FT                   /transcript_id="XM_625340.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(82451..84325)
FT                   /locus_tag="cgd3_290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66356386"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_290"
FT                   /db_xref="GeneID:3372330"
FT                   /translation="MNKEKSIIDLIIMSINDTILIKELKDKEEIRKISIRKRKDKEKID
FT                   FVEWFINDHKEIMFEWNDTIKKQIYIKIINIKKRINKYFEIYNNQLGIIKSDEYKFNYD
FT                   LIKRIIKYENYINMMKEYKQECIDINLDNIINNNNNNNNNNNNNDKKEFNRKIYSNLLN
FT                   NEIEKNYKDYILKLIIIREINNLTMLLLKNQDNNNLKKKMIELILIKKFKDFYILIMKN
FT                   YGIKMNHINNNMIEYYYENLNDRFQYYNNNNNNNNNIIDENCSILNEEKNEKMIINNNI
FT                   ILKKNKQNERIYRIGNIHPNLRGLSSIIINNINDNNINKNLILLKKNSDNNYNINDENN
FT                   NNNYYYNYNKIQVLMIINDMIQILLLNINHFNNNNNNNNNNNNNNNNNNMLLLLKLVDN
FT                   ILIRIILLTIENIVDINNEDDDYIEDYDDNNNNMNNSNNNNNNNYYYYYYKNKIKIGGN
FT                   NYNEYNGINLNIELIGEVIIEIMLYFGKYYQNDEEIKEEIDLMINRIKEMDEIELINSD
FT                   LLSLLILKMSQKYKIFNNEQLDNNNNNNNNNKIIKYNKIELIMFKNEIKQLLNDRMRDN
FT                   KEIINNEKNNNKNKEEYEEIQIEEIQVEEEKVNDDYDPISNAMMIWEY"
FT                   /protein_id="XP_625340.1"
FT   gene            complement(<86870..>88336)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_300"
FT                   /db_xref="GeneID:3374003"
FT                   /locus_tag="cgd3_300"
FT   mRNA            complement(<86870..>88336)
FT                   /db_xref="GI:66358875"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_300"
FT                   /db_xref="GeneID:3374003"
FT                   /locus_tag="cgd3_300"
FT                   /transcript_id="XM_626616.1"
FT                   /product="rasputin.  nuclear transport factor 2 (NTF2)
FT                   domain plus RRM domain"
FT   CDS_pept        complement(86870..88336)
FT                   /locus_tag="cgd3_300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rasputin.  nuclear transport factor 2 (NTF2)
FT                   domain plus RRM domain"
FT                   /db_xref="GI:66358876"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_300"
FT                   /db_xref="GeneID:3374003"
FT                   /translation="MTEGTNNSSTCNASKIADFFVTEFYSRLKKDPSTLYELYHDSGYL
FT                   TWVGNRSEVMDSSFNPQSAIRAETKEKIRSAINLLDLSNCTTYVEVLECSKSINNSLCI
FT                   TAKGRMYIGEGESVGKSFVQNFLLTEIRPRWYFIRNDCLIFIDSELPLKQSVQNTAKIA
FT                   NNDSGVAKNSGKKSHDSGFETNKSQKEQHHSSKVQCNDEHNKEVNKHATGPKEDDDNKS
FT                   QSVATVGAHANTDSNAESQKKVSSSTAANTSNNSSNNASTSAPNTTSNNAAANTSSASS
FT                   PSPLDPVNYTDSLNAKNNANINRSNPHKYEVTSYAGKLMGGALKNGNKVKGYAIHVPTE
FT                   DKNKTASQNGSTKKTSTQKDPKSLKEAKNKRKIFVHSLPTNISDDQIREAVLNQLKVHG
FT                   GGYVIDIERARVSGRHWGIIELDSEFSCKTLLNNGLYLGGMEISIEKWKQINQPQGQNF
FT                   SQNSSKFNNKNSNRQAGNNYHHNSSNNPKN"
FT                   /protein_id="XP_626616.1"
FT   gene            <89618..>95254
FT                   /db_xref="ApiDB_CryptoDB:cgd3_310"
FT                   /db_xref="GeneID:3374002"
FT                   /locus_tag="cgd3_310"
FT   mRNA            <89618..>95254
FT                   /db_xref="GI:66358877"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_310"
FT                   /db_xref="GeneID:3374002"
FT                   /locus_tag="cgd3_310"
FT                   /transcript_id="XM_626617.1"
FT                   /product="RCC1 domain containing protein"
FT   CDS_pept        89618..95254
FT                   /locus_tag="cgd3_310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RCC1 domain containing protein"
FT                   /db_xref="GI:66358878"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_310"
FT                   /db_xref="GeneID:3374002"
FT                   /translation="MYATQDQSQLPDVPDFIKNEVKKNAFKKQGGDSLGGHSFTRAASS
FT                   LNHYFIVAKLKNKGQLYAWGVNTNNVLGLGIENGEFNFPMKVNFFSALEVFQVSCGYSH
FT                   TAVLVKGISEASGRVYTMGLGDRGRLGYTRGYTEFGNEHDKNDLNESWYTPVPCIVNFP
FT                   FNAKISRISCGANHSLALSDSGLVFAWGIGQYGCLGTGELNDVYSPVKIEAGPTDKKVL
FT                   HIAAGARHSLCCNEDGQVFAWGSNSNGRLGTGGSYGMKTVPTQIKSLSQYHITLVAAGE
FT                   SHSGCIDSFGYIYTWGNGGSGKLGHGTQSDCNIPRRIEGISSLPFVQLTLGAFNSMALS
FT                   QSGEVYIWGAKQHEIISLPTKIDAFDSHICHINSGPYISFAMDVRHNIYLWNNRLLVNS
FT                   KKSEALNASEEQLYKRMNSKNPVLLPFFQSKAFVDDCIFYMGFNLVDYKGNKVSYEPKS
FT                   EGGLFSVNRIYKSNGSSEIGSLVGSQIPSWSVRQIACGTSHTLLLVYGGTIFAWGDNKY
FT                   GQLGVDTRRRKSQNGDKNESFLNEPTEIKFSEPIRRVACGSWHSLCCDIKGNCFSWGRG
FT                   DRGQLGTGAIRNLYEPAGIVTLKNVIEVAGGELYSACIVACITTGNKDLDTINSGDLWI
FT                   WGDGDLGKLGLGDHVLKSCIAAPRHLNLGTPIIKVALGSSHTLVLTASGELITWGAGYY
FT                   GRLGTNSTKSHSNPIKIRFPIKGVQIVDIAVGSYHSMAVSSLGDLWVWGKAENVLSEKD
FT                   VLTPYIFAKLESPSGVPRIYSIHAFGDVSYAITQSGVLWIWGPENSETENIQGLESSIK
FT                   IKSHTGRAEMILLPGNAIGVSGSTTHHVCLLASGEVVSWGDPSRGKLGQQDIRNKKYIE
FT                   DPTLVIQKWNDAKNMLDSVGKGDSSAGLATDKKKNYTKDEGVTTIEELEAFMGELTSNS
FT                   VHFSKKAKSFEYVQSLLHKEDPRTRKDSISLLEEDLVVLFSSHIEYFRKMKEEEERLRY
FT                   LIFLAEVQMRRLINMIQSANSNSFIFIEDNYYRNIYGDYFNSFILKYMSMIEYIFAILR
FT                   TQPLYIINLMLECSFGEEFISILNCLYGLFPPQLEYVEVFETKNFHGLNDSLIMLEIIG
FT                   EILCKRELQEAFSTNDVFWPGKSKFLYYLSSVVLRGPDLRSLVQNLLDIYTPTSLVSVI
FT                   AKFPKEVLLVLDSSCLAQYLGISPNDESLPKHYLNMVKFAEVALLVGISENINKNIKFP
FT                   RILERLLYKACKLVNLMEIPSFNPLLDYKQQKDQAIQQPLIRLLLYGIILPILEQCNAY
FT                   CTYFYFPLITDMRIMSSIQLLAHSIKIFLAGYLNQTSSSQGFLWINSLISFSSSITIKI
FT                   SEMVNEQKDVTDLSLTYLSYNSQYSLHSDNYHVVLNLVDIMVMINSIQKYKNFLRLNLM
FT                   DPVINSVEYFSRRDKLSIPFFPLEFINLVKNVNLLPNSDGGGVFVSIRISPRWIINNDV
FT                   RQSRISNYLRVSNISSNIEIENSNRRANRKFYDLDEQNYDEIRDEENTCLPPLDTSMMF
FT                   CPLTKIGMSQSLLPRFEANVRKSNGISEFGLFIRYFEIPDKRRAIEKGLLMLPIITART
FT                   MFELLETVDEYIEQFKRKENDKRQYEQLSFMLEFRKVVEELMLNYQDSITPLLIWITNE
FT                   IMDRIKHRAYLEHLLEIEEKLRDKRKWYKDQLNEWEDVIEKSVINMTLWGYKDTELINL
FT                   LNRYYKNNINTTMKQMENVLYNTMISGYYAGEDDLTMIKNGNYITTDIIKKSITLPFLC
FT                   FPLSIFIMNNVIKIKSDEKIFNLFESQRKTMMNFFRRTAQMNNWTIFITFTPTLGLDCI
FT                   ITTSRSGYKIQSSFEQRIICKFYITPDQVKKAKFSNFLYTRLYSNGLVEVNLPSFVSYV
FT                   YSQI"
FT                   /protein_id="XP_626617.1"
FT   gene            complement(<95291..>96700)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_320"
FT                   /db_xref="GeneID:3373813"
FT                   /locus_tag="cgd3_320"
FT   mRNA            complement(<95291..>96700)
FT                   /db_xref="GI:66358879"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_320"
FT                   /db_xref="GeneID:3373813"
FT                   /locus_tag="cgd3_320"
FT                   /transcript_id="XM_626618.1"
FT                   /product="N-myristoyltransferase"
FT   CDS_pept        complement(95291..>96700)
FT                   /locus_tag="cgd3_320"
FT                   /gene_family="HOG000189123" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-myristoyltransferase"
FT                   /db_xref="GI:66358880"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_320"
FT                   /db_xref="GeneID:3373813"
FT                   /translation="LIRMSGETPENSESSISNTKKITNLLKEMSLGSFMNTAANAIKPH
FT                   KFWNTQPVVQNDDSSSEYSFGPIEIEPDSFRKEIYKLPDGFSWFDCNLWDIESQDFEDT
FT                   YQLLKDHYVEDDDSQFRFNYSKEFLRWALCVPGQKKNWLVGVRVNETKKMVGFISAIPI
FT                   KVRIHNCIMNTSVVNFLCVHKKLRSKRLAPVLIKEITRRIRCEKIFQSIYTCGKNITKP
FT                   FTIGTYWHRIINVKKLLEAGFIGIPRNMTMSSLIKYHRIPADKRIEGFRPSVDSDAEQI
FT                   CKLFENYFMKYKDVSNETMNNLINYDEINHSKELGKQAYMKLDKIEDLQDKITIHQCFN
FT                   VEDVKHYFTNIDKVIVTYVRENKNKEITDLFSFFIIESTVINNERFPTINIAYSYFNIA
FT                   NTCSLKELFNEMLITAKNNNCDAFNTLDLMQNLQVIQDSKFIIGTGRLRYYVFNWKIPQ
FT                   ISPSNVGIILF"
FT                   /protein_id="XP_626618.1"
FT   gene            <97253..>98107
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_330"
FT                   /db_xref="GeneID:3373948"
FT                   /locus_tag="cgd3_330"
FT   mRNA            <97253..>98107
FT                   /db_xref="GI:126644404"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_330"
FT                   /db_xref="GeneID:3373948"
FT                   /locus_tag="cgd3_330"
FT                   /transcript_id="XM_001388055.1"
FT                   /product="scully CG7113-PA, putative"
FT   CDS_pept        97253..98107
FT                   /locus_tag="cgd3_330"
FT                   /codon_start="1"
FT                   /product="scully CG7113-PA, putative"
FT                   /db_xref="GI:126644405"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_330"
FT                   /db_xref="GeneID:3373948"
FT                   /translation="MKIEDSVIVVTGGMSGLGKAVVEELLKENPRKVCLMDAVLKEGEL
FT                   EEEPINKCEKYCVDVTDYNCIKSAAKSIIDKYSKIDAVVHCAGITHCPTPIVQKDDNGK
FT                   IMENNEDIPEIWGKVVNVNVIGTLNVIHCLSPFLAMNQGNSHGFEKGVFILVSSSTARD
FT                   GPAQNQGYIASKGAINSLTLPLARELGPLGIRVVTIGPGVFDTPMSKHAMSEKTSSTLL
FT                   KSIPLGRFGVPNEFAETVVNVGLKSEYISGEIIYLDGAWRPPFITSGSVRRLSIQKSSS
FT                   NDE"
FT                   /protein_id="XP_001388092.1"
FT   gene            <98492..>98564
FT                   /db_xref="ApiDB_CryptoDB:cgd3_335"
FT                   /db_xref="GeneID:3373949"
FT                   /locus_tag="cgd3_335"
FT   tRNA            98492..98564
FT                   /note="codon recognized: UGG"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_335"
FT                   /db_xref="GeneID:3373949"
FT                   /locus_tag="cgd3_335"
FT                   /product="tRNA-Trp"
FT   gene            <98668..>99792
FT                   /db_xref="ApiDB_CryptoDB:cgd3_340"
FT                   /db_xref="GeneID:3374001"
FT                   /locus_tag="cgd3_340"
FT   mRNA            <98668..>99792
FT                   /db_xref="GI:66358881"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_340"
FT                   /db_xref="GeneID:3374001"
FT                   /locus_tag="cgd3_340"
FT                   /transcript_id="XM_626619.1"
FT                   /product="hypothetical protein with signal peptide and 5
FT                   transmembrane domains"
FT   CDS_pept        98668..99792
FT                   /locus_tag="cgd3_340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide and 5
FT                   transmembrane domains"
FT                   /db_xref="GI:66358882"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_340"
FT                   /db_xref="GeneID:3374001"
FT                   /translation="MFKSIKKKRDEFLFKWNRRRYSYRMGWYYSMLSIVSGIIILVSFI
FT                   LFFLLKMNSCTGRRCGIFRTFSCSPTSVSLLSSAFISLGSIYSIKSAFSYMLSRLLYSF
FT                   ANYRTTDFMALGKFASILGALVKHIPFLIALCTICNGIICITGVIYILIGLCSHSYSSA
FT                   TQIIVDNCRLYFSNCENPTVNSIFDCNDPSQLISSPFLQLRCLPGSSEICRYSQELKSG
FT                   SNPCTKDMLKSYLISTGDSEIIEELEKLTGRTLSISMPNQVDKENSRKIIERKLGSTYI
FT                   STLQGVSNRELLDLYLLPSSPSDQSELISSYGFSDLYAAARVWIAAACYTYVSTTILFF
FT                   FVKYFSPQDSCFSFVRSPNEFFLLKILNIFTPWQ"
FT                   /protein_id="XP_626619.1"
FT   gene            complement(<100292..>101125)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_350"
FT                   /db_xref="GeneID:3374000"
FT                   /locus_tag="cgd3_350"
FT   mRNA            complement(<100292..>101125)
FT                   /db_xref="GI:66358883"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_350"
FT                   /db_xref="GeneID:3374000"
FT                   /locus_tag="cgd3_350"
FT                   /transcript_id="XM_626620.1"
FT                   /product="Pop2p-like 3'5' exonuclease, CCR4-NOT
FT                   transcription complex"
FT   CDS_pept        complement(100292..101125)
FT                   /locus_tag="cgd3_350"
FT                   /gene_family="HOG000173077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Pop2p-like 3'5' exonuclease, CCR4-NOT
FT                   transcription complex"
FT                   /db_xref="GI:66358884"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_350"
FT                   /db_xref="GeneID:3374000"
FT                   /translation="MTNYANNNATVASKKGVIYEVWQNNINEAFQMISEIMDDFPYVAI
FT                   DTEFPGVVVRPTNNYYEYYYQTVRFNVDLLKVIQIGLSFRNKYGQAPTNICSTFQFNFK
FT                   FDMECDIYSQESIQFLRHSGIEFDKHLNSGIDFLCFGEYMYGSGLVLNPKVKWISFHGC
FT                   YDFAYLVKILSSQPLPETETNFIELVKALFPTLYDLKFILKQLSSLSHLSSLQKLSEHL
FT                   KIQRIGIAHQAGSDALVTCCTFFKLFKLHLNSQVDDNLFNGQIYGFGLPPPTIVK"
FT                   /protein_id="XP_626620.1"
FT   gene            <101820..>102212
FT                   /db_xref="ApiDB_CryptoDB:cgd3_360"
FT                   /db_xref="GeneID:3373999"
FT                   /locus_tag="cgd3_360"
FT   mRNA            <101820..>102212
FT                   /db_xref="GI:66358885"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_360"
FT                   /db_xref="GeneID:3373999"
FT                   /locus_tag="cgd3_360"
FT                   /transcript_id="XM_626621.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        101820..102212
FT                   /locus_tag="cgd3_360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358886"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_360"
FT                   /db_xref="GeneID:3373999"
FT                   /translation="MDLLKSTIYGNIDQEFVIDNTLDTCCFQFETAQSTLSMGFEDDIY
FT                   LRDSIQTLQDDPDHIEHTDHNFNLNWDEDSSFDQKKQKELKELTFELATDPSPNSEFLV
FT                   RVTETLNSILQNEFKALDFQVSPSIS"
FT                   /protein_id="XP_626621.1"
FT   gene            complement(<103469..>103783)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_370"
FT                   /db_xref="GeneID:3373803"
FT                   /locus_tag="cgd3_370"
FT   mRNA            complement(<103469..>103783)
FT                   /db_xref="GI:66358887"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_370"
FT                   /db_xref="GeneID:3373803"
FT                   /locus_tag="cgd3_370"
FT                   /transcript_id="XM_626622.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(103469..103783)
FT                   /locus_tag="cgd3_370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358888"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_370"
FT                   /db_xref="GeneID:3373803"
FT                   /translation="MKFISVIFHYLLNNPKKKMKKKFEVYIYIYIYIYIQTNKGFQSFS
FT                   INSLTPLTVCKNGKSIKFQCCLFRITQNSLGIMKTISRTYYSVKTLILFMVLKPKKESD
FT                   "
FT                   /protein_id="XP_626622.1"
FT   gene            <104162..>107344
FT                   /db_xref="ApiDB_CryptoDB:cgd3_380"
FT                   /db_xref="GeneID:3373998"
FT                   /locus_tag="cgd3_380"
FT   mRNA            <104162..>107344
FT                   /db_xref="GI:66358889"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_380"
FT                   /db_xref="GeneID:3373998"
FT                   /locus_tag="cgd3_380"
FT                   /transcript_id="XM_626623.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        104162..107344
FT                   /locus_tag="cgd3_380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358890"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_380"
FT                   /db_xref="GeneID:3373998"
FT                   /translation="MSDKKTSTIICGFEKKNLEAIKTCLETHLNRENILDNAVIQECFN
FT                   KDVLGFSLDSVSNLQELKEVWYSLFGKDPNTNRKELMHAIGISTGMSEVLNLSIYTQYG
FT                   NEMNLGISQSNEEKKLNEEESMNALVDTSKLILEFLENGCEKDIYIKPIFKAERTTLIL
FT                   RDLENDVIENEIFDLLSKCPHFHTEETSENKTNEYSLDAVKKLVVNFRKEVHGTWFITL
FT                   KTEDLTTKVALWLRDQKLRDNNSSLLRVGIKSEHPIASLLSVLSMNKGIQSIHNRMSNL
FT                   QLSGTEMGIGIPPILSTLNAPLSNLPPNISSSELINVSAGNVPNSTVLDGPSSNRRTAL
FT                   GNVSPNMSYMLNTPGCSNSGFIQTHPQINRPNQENDHSTKDTGNEPQIGMDNLNSQNPE
FT                   HLTAPLPVMYPYHRGIGRAIGVPNHTTPLNIYGPIPGAPNGGIIAPIIVVPGATIPGGM
FT                   ATSPLPSPTPEVGSPNASKTGDTEVTKSPKNNHKRRGSKSSYISDSDTKSLSPNISNRR
FT                   SSPDATNNVKPASEVENCGALPVADGMNSVIRGIPQGATTMIHGITPFYYGISGLSEVQ
FT                   PVNLQYLGGGPHLGPHPHIFIHGNPQFHYHHQIDIGAPGAAVQGDSGDMESSPPNTISN
FT                   SEANKDNIQHIKPQIPTMFPAGYYHNVHYIGDESLGAIGNHGFSAGSFAINNIGGDGIV
FT                   VPGNLNAQGRSFWVRNPSNNTGNQKFKANGRKNNNSSGNRTGNKSSLNPSNPKKNNNQK
FT                   SSFVNGTNPEGTYSEPKVGSKTASISKSPVNDAITKHDEIDQYENAEMCSTNSSKQYPS
FT                   NEKEIECSPSEEAHIGDNSSITENTANTCTSCANDDNQNRISKKLPNESSKLPIDEPQD
FT                   KQQTFNKTFKPFLNSAGKSRGHRNSKNSSNGGGNSEGKGNLEYSEHRSNLANDKSKVPD
FT                   GTKGNNGPNNQAAETGLNYHQRRRTSRQINTGSGGFGGRENGKFTHGKYNNGYENNHFR
FT                   LKRTTENEQSHFNFNNHGKQSDGYSNNNHSYGNKSINHKGKGNAAKSNYQESKEIGLDH
FT                   FPSLSDAMATKK"
FT                   /protein_id="XP_626623.1"
FT   gene            complement(<108524..>110812)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_390"
FT                   /db_xref="GeneID:3373997"
FT                   /locus_tag="cgd3_390"
FT   mRNA            complement(<108524..>110812)
FT                   /db_xref="GI:66358891"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_390"
FT                   /db_xref="GeneID:3373997"
FT                   /locus_tag="cgd3_390"
FT                   /transcript_id="XM_626624.1"
FT                   /product="RecQ SF II RNA helicase, DEXDc+HELICc"
FT   CDS_pept        complement(108524..110812)
FT                   /locus_tag="cgd3_390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RecQ SF II RNA helicase, DEXDc+HELICc"
FT                   /db_xref="GI:66358892"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_390"
FT                   /db_xref="GeneID:3373997"
FT                   /translation="MGIIDGSSNRGKIKKSEEWKQSSLNNFMGLSKKKTEESEDDFENE
FT                   ELLRVKELENSIEAEKAQEDRIQELFCRYKLKVDNIKRINKVNHSDVEELKNGLRWGLK
FT                   YLKLEDYRKGQKDAIEKLVCERRDVVLILPTGGGKSLTYQLPSLLREYQKQVKEIPSLS
FT                   KGMVTVVVSPLIALIEDQINSLRKWGVKSNGLSSTIIQKSDPSQSMNKALEELYIDLEK
FT                   KVPTNSIIYVTPESFGTEKVLGCLYKLYLNGNLYCFAIDEAHCISEWGHDFRTAYRRLN
FT                   QIKNIFSDIPVLACTATASPKVQRDIKTVLNLIDPYISVNSFNRPNIHYTAYNIDNNDY
FT                   LADLSLEEIVLNGVLYMQEYFKRIDNQESAVGIVYVNSRKSSEHISQYLSNKGVPSKAY
FT                   HAGLSLKIRTQIQNEWLENKIQVLVGTIAFGMGVHKPNVRFVIHSSIPDSIDSYYQQSG
FT                   RAGRDSKFSKAMLFFSKRDITCLKCIKRKSLQYLFMKSKQKAQQAYEKFQDNLQSVIEF
FT                   AQCNNSEYQETDECYEIDYDPENRIENSNNRKRSSIDHYPGSIQNSKPQDPNQYQIRIN
FT                   KYGQCRRSYLLGYFGEKFNREKSSSNYLSCCDVCDSKSKQQDKNNSFMSYVSSKVHLKK
FT                   SSNLLNKDYNINSYKNQFSKQEEFTFEFNQIQGPDPDCNQSNKVGSSGFSSVFKSAKSF
FT                   LDSNQKASKSSFQSALKMNNLLKSKGMTYLERLQTLEEQEAKSEEKSNTQNSKFNIIRN
FT                   SLKKKRNWV"
FT                   /protein_id="XP_626624.1"
FT   gene            <111116..>113851
FT                   /db_xref="ApiDB_CryptoDB:cgd3_400"
FT                   /db_xref="GeneID:3373996"
FT                   /locus_tag="cgd3_400"
FT   mRNA            <111116..>113851
FT                   /db_xref="GI:66358893"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_400"
FT                   /db_xref="GeneID:3373996"
FT                   /locus_tag="cgd3_400"
FT                   /transcript_id="XM_626625.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        111116..113851
FT                   /locus_tag="cgd3_400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358894"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_400"
FT                   /db_xref="GeneID:3373996"
FT                   /translation="MQKINTPNYDKIIFDEIEHQNLNFLDLKELNDKFLEKPVFELENE
FT                   EINLKIREILKNKNIVKPIILLIVVNRLIKIGNKSIFLKPGKCIEENVFIPELELLAFL
FT                   LKEGNIIRDCCEYANFSNLQDISNSFTIEVLNSIIKIPTLAINSILTLKPSLKNNMNFR
FT                   ILDKYIPLELHDSNYYENIWICTLYILNDIRLTDKATYNVLQVIFSRLFLRGYKEILCR
FT                   IMVGWSNNIDKSLFEDCKLLNNEELCLNRVFDNILKINKTDDNLIKSFIKQLFKEIESV
FT                   RVQNNQGILFLKLKDRNFEEELKVEDIRNDDFFLFLKSIVDFCIIEEDLKNKGFLKSEL
FT                   FQIKKQNFSIKTYLLFLDICVLNVIKNDEFNKYFLPEQSFDYLEMIRSEKLAALEESNK
FT                   LKIYLNFLKELTQCLTKQWNSYQDSMAYSLTLSTVIIRSVSILIYLNLSNLLNLKKVLL
FT                   EFYMDITEGIQFRLKNIDPLIRSSAMYLGEFYFNLLYELFPSTNEADSGYLMSENPKFD
FT                   ELKLFNPEIKNRLSCIYNSTKFFAINTFSYEGEIQIRNATESIKDMSLSKEKKEFNEDQ
FT                   EKKIIDEDDEFWNKAPSIKANSKNEGIIQLKTPKSLHYTSGIEQKKQEPKRKLVNKSFD
FT                   LINLYTDEKKSKEIQDKSEKLLNILKELAENIEKDDSNYDHLILPLIDKLISLKEKDQK
FT                   ILVLIIFSKLIQYKTDKVSVEMINYSCNMNNGIPMDFRILILNSLTSACQNMANTQSNT
FT                   QSTIRPNKKTIINLFDKYSLIWSSRLVKYIMELITHSENHECFEKIPNIFFISSLELFN
FT                   QIIVNTSSNNANIGQIAHSGLEFITSIDLTNNHLFKDIAIRKSIYMLTFNIILKIKYSS
FT                   YFLALNQILRQVVTWISKAEISETDPNSIWIIQETKSFIS"
FT                   /protein_id="XP_626625.1"
FT   gene            <114509..>119464
FT                   /db_xref="ApiDB_CryptoDB:cgd3_410"
FT                   /db_xref="GeneID:3373995"
FT                   /locus_tag="cgd3_410"
FT   mRNA            <114509..>119464
FT                   /db_xref="GI:66358895"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_410"
FT                   /db_xref="GeneID:3373995"
FT                   /locus_tag="cgd3_410"
FT                   /transcript_id="XM_626626.1"
FT                   /product="putative ABC transporter, 12x transmembrane
FT                   domains plus 2x AAA"
FT   CDS_pept        114509..119464
FT                   /locus_tag="cgd3_410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative ABC transporter, 12x transmembrane
FT                   domains plus 2x AAA"
FT                   /db_xref="GI:66358896"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_410"
FT                   /db_xref="GeneID:3373995"
FT                   /translation="MFGKTLDDTSFHKKISFQKEESLEIPYLKENPIKRQKNQSFFSFA
FT                   HSYIQFTWVTKWIYLGSRRPLPAKDLPDLPETDSTNYWSNLFENSIEQERLKNLSSFDR
FT                   NVLVIRALWKCLYGQFIMLIILKVSWEACLYLNNSVIRGFIQYKEMESSAEVSGVSSEK
FT                   SQALGVGLWNGLLLVLFYLVHVYISTQFNFWESRVILKIQTCLKTSIFKRLIESKSCAK
FT                   NLLQNGKEIVDSKIKEDKLNIAEDLHLDIDSSLSNQNSKSQNNNLNETGQNTNRSFDDK
FT                   KKGSEDRYTISTNVFNLLMVDVEDIEDFIMALIQFILLPCRIFVASLLMYRNIGESAIP
FT                   GVVVMISMIVFMIILDIISALLKGPLLYWRDKRLAKLHEVLNKIRTIKILGWAPFAEEI
FT                   VLRDRRNEVSYLYRIISFSALSYLFFKLAISGSVVAIMVYYTKGMLSRAGNLSSYPNGF
FT                   DLKASNIIPLIHVINYVAGILRTVPNSLNMLIEGWISLKRFSHHLGYSHLPSDVNKELL
FT                   ENHRSLGDDIVCKSNISSEGRIEKQQKQEETPLISKILTFDGGNMLEVNEVINKKNQDK
FT                   LPSQVFHSYKNQKMEYTFDESILVYLQDLEYIPESDDENFKKTKNSFTLIIPKMIIKKN
FT                   SCHLIVGNSGSGKSTLLYGILGEVYSKRGLRFIRSQNSTIGFCSEDPWIPIGTIRSVIL
FT                   FERPWNEKRYNRVLEACLLIEDIMQWQERDLRVLDDGGHILSGGQRSRLTLARALYGFL
FT                   SDQEEYNSFDEDSIEENSHHSVYCISDRSSNRFDTQLFLFDDTFVSLDPNVGRRIFYNL
FT                   FNRENGLLTGGNYSAVIVINTTVLLCFLDEKLSQEEINEKFGVEINIWNIKSESGRPNY
FT                   NVLEHSKYETLKNSGMEKDHSFNNSESNSRTVSGYIDVGSSQVTKEKFELRKRNLSAEK
FT                   EAKSNSNLSSSIVTDFEHQNSIIKARGTASSYSSSDFYNEDIICIQSETGHRAIPLSLY
FT                   RWYLSKVGIVFFISVCLLIMTSIILDSGQDFLLVEWTGFTSDGRDLKTGTEFYDSNSSS
FT                   LNTFESHMNYMYGLIIIFIFGILTHLLVQVTQIYASLRAAKKIHNEMLSKLLTTSQEFF
FT                   DRNTIGQIINRFCLDMVSIDRKTMFRICNFVSIFLEILIRGGFIIFVFPWLLLMIPPIC
FT                   LFAWFWLFQYYRHASRELFRSNLSAHTPVCNIYTQALMGGSIIRAFRCGHVFLNRNINY
FT                   IDNLQKIRFMRSASAQWISVRMQLLLLPFTAGITLAPILLKYLNLSTAFFASFTIIKMT
FT                   AGLWGLALVFVMSYAPLINDFFNMFTTVEKSMCAVERVSVLLNDLEDSKKKEFNEEVHE
FT                   LKYKEYMVSNRNSPQNNFQGLYIYELRVEYGNQSLGIELKNEYVKYGECIGIIGRTGSG
FT                   KTTFLNSLLGLTPIQSGLLFLDGKWLFNKDMRKNRNDYIGVLPQNSIGFDGWTIRKFLD
FT                   PFDEIHDDQVIWDGIYACGLETTLRSMSNLNPLDAVLGNTSGGISKRRGSKDKNEYKFT
FT                   QKHLRQLALARLVIHRLKYKIILVDEPPEELSSDLQKQNGSDNYVSMNSSSSTRKLGSN
FT                   ILENQYLSVEEIVSKFMKHCVVFIVAHNYKSLKSCNRIWVLSGGVKVNECEFSQVNNQQ
FT                   MLADFLLTNTKNQ"
FT                   /protein_id="XP_626626.1"
FT   gene            <120105..>122780
FT                   /db_xref="ApiDB_CryptoDB:cgd3_420"
FT                   /db_xref="GeneID:3373994"
FT                   /locus_tag="cgd3_420"
FT   mRNA            <120105..>122780
FT                   /db_xref="GI:66358897"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_420"
FT                   /db_xref="GeneID:3373994"
FT                   /locus_tag="cgd3_420"
FT                   /transcript_id="XM_626627.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        120105..122780
FT                   /locus_tag="cgd3_420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358898"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_420"
FT                   /db_xref="GeneID:3373994"
FT                   /translation="MENIGLEAVAGKIKNGKNDGVEFLFLTKAVEGCLISQEIISELLD
FT                   FDIFCIDWQEYNKDPKYTVGNFDKVNSINFVIQEPLIQVLREILVTLEATLDANLDLNI
FT                   RIYLPYSSELHVEYARNIGLLQEEICTINKKVQLKRFDFISIINEVMKEFEGINISIKT
FT                   VNWISIFYCNANLICNNSCSSVYATCIENRSVPIPLLEEDIERVYNSVVNERKNQHLNN
FT                   FIMPDLFSKENVKKDMALLNLVNLPSNLRKAYSMHILQLMSFLQQVTGTNFVESESCSI
FT                   NFLSMGQTSNLISKAMQESYLKMVNTSSKTQIKPSNTKDDITILIMDRNLDCISPIYSP
FT                   ILNINLSEDETFSRFDDGIIEFLDEFILSNTQNQAIGNISTGDSLEKDDPELNCKELEE
FT                   DRESYLDKKVEDSNNSDESYIHEITNPVYLSIMLDPEKLQKDLVISQNYPILSYRFISA
FT                   LEDLKDLVLSREKSFSESLKKDIINRIDSIMNIHPIYGQNSWMFLLLSLNQSHYTRKFW
FT                   TEVCDVCNNYDVKSDKRKVMVLIIVYRYLVIIQNDIASNSNDINMKSPSTQTSSSSLTP
FT                   VIFQDQIEKEEDIIGKIVSILLIIREKLLPDSITNISKKLEDLSLNPSLYNTYDLKLEL
FT                   SALLQILHYFLIPMFPLDLVSFNSIFVRNLKKKFTNNSFENISVNDQTEFQSYSLECIR
FT                   KIISLAISCSSYEGPDCKFTSFNLKQVLDCFHPKGGFSSFGDLEKLGRKLNNIRNARSK
FT                   IKYKFFRNFQLSPFLPENSNKQEFRILSLVSQVILYIIQTIFIEESKTSKEWLKVDLKM
FT                   KSISSNYDESGLQSLRNKLKETKKTLVINIIGNISMFEINEIEKLSKKFRDYVNIIILT
FT                   DHISSAASITNSLITDHHNL"
FT                   /protein_id="XP_626627.1"
FT   gene            complement(<122821..>136083)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_430"
FT                   /db_xref="GeneID:3373808"
FT                   /locus_tag="cgd3_430"
FT   mRNA            complement(<122821..>136083)
FT                   /db_xref="GI:66358899"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_430"
FT                   /db_xref="GeneID:3373808"
FT                   /locus_tag="cgd3_430"
FT                   /transcript_id="XM_626628.1"
FT                   /product="VPS13p like protein involved in vacuolar sorting"
FT   CDS_pept        complement(122821..136083)
FT                   /locus_tag="cgd3_430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="VPS13p like protein involved in vacuolar sorting"
FT                   /db_xref="GI:66358900"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_430"
FT                   /db_xref="GeneID:3373808"
FT                   /translation="MRRAVSRVAGFVSKWATTFIGKYLENVSEDSFELGLNSGKLQLRN
FT                   VKIKEGFLEQLRLPIKVKYGCIETINISIPYSNILRPGSSSPLVVEIDDVNLYASFIDH
FT                   NEFDSEKIESLVISERLRLIEHWNIHFMAELAEDEYFSVKGSSSKGGSKPFLSRIVSVL
FT                   IQDVRLKFRRIHIKLGDSANKELNCGLVLDSLEVRSIPNLSQVLVDQDLVIPKPVGSGI
FT                   NEDTNISGNNSASREVNSELGPDQIHGYEEHLGLVKEIFCSRSECSDEKLFEPFFQKKD
FT                   SSDFSYRILDLDGLSIYTAREATDGETNLKETPKELDQVVHPFCCKLLLRQRKDLFNAS
FT                   KMPIYTIYGVLEEIYVTVSEQIITYCGGILNQIQAFNKQIELGKTMLERKFLYRPNVPV
FT                   IGNAKLWWRYAIGCIIRDRRADISSISGSHRFSRSSYNSSLYIRLQEDFTEAKISMYCR
FT                   DYTMEFHKYFEEKMTFDSIGPYFDGGLFNDLLLDFSRQFSEYYILRVPFSRFVSLHTSL
FT                   VHQWVGKRLEIHSFRRTSHSDSQATGGGSGSWIQWLFKFHRISSVPLNSADDVFFDAQE
FT                   SEDEQNKQEEYENFNGSVELDEAFLAQQTMEDLQFFDCLSDHSLEDGDKNTSESKQNLG
FT                   SFDKSQSENPLYMESSPTVKQFGAISSETPFMAFRVLLRETKLEVVLRDEFAVETGGSK
FT                   IDGQEGLRMIKRSALMGSLRSFGLEFIQSDSRISLLSVLQEFNLDYSDPDEERFQIIYE
FT                   DESLVQDEKMWFTFYYLNKKSSICNVQGSSRRRSSLSMSSDFSMDRSISKRLETSFPES
FT                   SKTTIKINVEKCYAIFYSNVVSALVNAINKYNKSIGKSRGEGIKHKSKTRIDNHMACTE
FT                   SGSTDISEKRDINSQGDGFLQNSGLMDVDIQIETPILVFCHKVDPRLEGAIYNVISFGK
FT                   ISISNNDSEILRGYELEESSLDISSPQSRFENNSFDLQSFINKGVGGGIQVSPYYRYVL
FT                   SEKSTYWFKCIQSLCYYAKIEEIYLSIYSDFQSGTTGIEKDEQKIRARIQDTSNIHRRE
FT                   SGKSEKRSPKLPKGVDMVNSYRLFSIDYIDIKLNLLSYKRYNMLDETWMKYIKLFGVLT
FT                   QLDPFSQDLFEERSFMNLVLSTNSVCLDSKPTGGGSIGEIQLGDVLKNIYSSIQINSIT
FT                   SNFDPQVYQSIYLNMIQWMDDSCLSEYFNLGRKLTREKEFKMFKLGLNIQLFWFLRLNS
FT                   LKFDFVSDNNSWMNVGTRDIQVLNFIHDHYRLVNFSISQLSMDYFLRIKEAEREGGYLN
FT                   SKDESQECKGIKRIPLFSLSNTFSFVRFPTSQYHFIEEELSLEKARDEKVKWLNRSRSG
FT                   YSQSNQVQVRTEIGSIIIYLRPLILQELLCLFKRTTSPYISTEQEIKSKKDQDLGSEIG
FT                   VKTSDKWTRYLIDANVCNFELVAFQRDTEFFKLVFENTVSICDHDTRRDIIVRVIRMKA
FT                   YNMVNGRKDLCFFKMDSSVESSIMEVKMISHQRAQDIEDLIHGRLSKMISSSEMLVEAE
FT                   NITLVLFLDAFLHNIYYFSYLIDNIQSFVYYLEEDNVKDSEVVKSSKSSSLILPSQEKV
FT                   GGEIEGGSDVCVPLRSMNFRNSKLIIPSVSVDDADPDKVSSVEMFIELFNFNNKSLIRQ
FT                   VSDPSMIYLYIFRMMNVRMRQIWGLYLEEENYGITEGRSSIPFGIIPDLNFHLRRYTCS
FT                   EGMNNSFDMNCFIESKQKEAELNLYPETLSLLIKAFSGNLMNYDPFVKQLTNLSSGTIS
FT                   DPEFMISLKEEKLQDDQFIIGTKKKRYVPQLIQHRFIGRRAALRFQDSIQEGESSSIIP
FT                   TGRFEDQDIQPSNSISVSFPLIRINLIKDWDWKNKQLIGFDGNVLQVEGKETKEGSIQT
FT                   VSIVRIKGINLFMSKFPQNQSFTFNLLLSSLTFNDEQNPSFLISIPDSFHHSDVDSNFG
FT                   TGYCIQDQTQDQDHKQERGDSESNKRLEKTNFEDQHYFTVYTKEAYFENYLESYFNALK
FT                   PIVEEDQNLQENQNPRRERDLEQPIEVQYYSFKEDSDDIRDNKKTNTSCSSWRIRIESP
FT                   VINTDCDIQSLFGIYDWYSDYSRAFCLPNSDIIEQENSRKDENNSRFLVDLMEVNLSLK
FT                   KFSCILASNTGLRTKVNLIGTYDLGYLSKKEKSQDGIQGENDLEQLFESNLNISISSSK
FT                   LGYHMADFGSFVIWDGLEHQIIHNIISKGIEAALKTNRSLKLISQPITLQIHYPHVLDL
FT                   YDVLLSMQKSLSKRSQLSRNSDLYRSLTNGISERFTSSQEFLGIGSSKAKEELSINVII
FT                   QNSRLILLNSIEDFSGIPLFMIFVQSNNLILSSRSYLIDHPISITNSGDFSLWIMNPRH
FT                   GYFEPIIEGCNFNLALDKLVQNDGFSPRNKSCSSKVTKRLNFHLLSALNLNISPWTIRT
FT                   ILRHYGAWNTRGCLLSSSVKPFRPILVINQSGYDIQLIGYPNFDTFQNSKNNNFIDPGS
FT                   TCNIINDGTEIVLDQINYCFQPSNIQIFQIHIGRAKIKEYCKNEDQINFERLFSTEKVI
FT                   NLDNTGRFAIFIRNLKDTKMDYENKSLQNGFNSNCLLFESPYLFYQVEHRNIKDQLGVE
FT                   KILRILSPLELSNEISMDLQVFFTDGLFSSRVLPNSKIPIPFNLETNNYLCYNKVSKDL
FT                   KEDDNKTNPVKYNEYYKLKINDFLKDIIKENENLNKYRITEKKEKKRIYFVQKGECAGV
FT                   GFYITIEGIMSTFGQGKYQFYKYILKFKPFLTLISTLPLDLEYRFFAFTSEKEGNNKLN
FT                   VITTQINDQDFSSNSGILEYMKPKALYLPCSLFDENPQVKLEIGVKSRKDSKTDNNNHF
FT                   ENNSQNFTVIWSCLIDLGNDIKLGIWKTQNTLNDLNGGDNNEIYLQRLGEIVPGKNKIS
FT                   MFSVYNLEKNPKGGYPLTWVVHSKYWFNSVGSELNLSNIILSDFTPPPDSVSNLMKTSN
FT                   TWLKSNQNLFGQYGDLIKHSIIPLVKREGSIHIEGAFDKIKSRKIVFMALINGKQHILD
FT                   FTKPHIKTKKGGIYNLGILQDKLGMVGYNFFYRDISLELQLNGSIARVLIGHLILFPQK
FT                   MVVNNSKITIEMQSHSNFILNPSTSIPIVPYFPDTIRLNYKNLSDRVKSGTVSSYHIGN
FT                   DQTRRSRVISIKSGSIIYPNFVLNKNKSWKILLKKPLGDKFQVKTEVNDNFESLEEGPD
FT                   GLSYLKIRSILDENLGFEMVLITTKKTCNQEFYTRNISSVFIFNCSNKDLHISQRNDDS
FT                   KNSTYLPSSSIVKQIFRSKSISEFVWEDYFRPRDIFIHNDLNITNANSANTMISGYNAN
FT                   KKTKYISIDNYSNKRRQEKNHLFEVYDFGSNEKKDWIIYKVSKISSKGNNYILGLFSYE
FT                   DFMDWHSKKGLTRRALSLLQPSRPTSISSPSFKSGNSYGSPVSVVSSSLTKFSSFNRGY
FT                   SSSEQYIFDIFCSQVLVSVIWENPSRNTPQELFLVVLDNLHSKYCFFTHLNAPQDFQIS
FT                   IGNIQIDLQYKDTLYPVLFQRLPSSSSRTLNTLEEKFLASNKTDFASFSFSSNQNNFLD
FT                   SSNQHQYSNSSLLSNSERSILPMLVIASNFCWDCVKSSKGKVSDSSGEVDLEEDVKELE
FT                   VNLNRRNSRILISQNLSENYFSEVSEYLKSLNIPNIRLPSELLISQGFLRNQKNSNGDS
FT                   LQLINVNKLLIRLLGINICFDTHFIYILTMFIDQIKEISRSIGNNVKKERSGTNISIYD
FT                   YDKNTNLDGESRSPKCDDLGLGDGDYELSKNNDNEYNGGNINFGYGIEEEQEEENEEED
FT                   DDEYQFIDKKDIIKQFPLKQSFFDKVFIKNFKIYPMVIHLTFNLNLLKSSINSDSLSSS
FT                   SSSSLSSSSSSSSSSSSSSLSSSSSSSSSSSSSFQNPTNNYEISNINSRQRNGSIIKNL
FT                   NFGKVLEQFAHTFGLVFSSLIRSITTIEDAPLWMNQFESRDSESCSNLIQKIRKHYEHE
FT                   LYSQLYVIATSLGSVGNPVNSFTNIGAGIGDLFYEPIYAVTSGRNDNNNNNGANVVTGV
FT                   KKGIESFMNHSVFGTFQAISKMAGTASQIAGALTMDEKYMEERRRFVHGQQPKDLMDGI
FT                   SIGAHAFGKSVTDGLSSLVGEVLDGATTGNPNSLAIGITKGLVAAVVKPITGVLDFTQK
FT                   TAQGIQKASTVDRVGNTNRTRLPRVFYSKSQVLAPFSKEHAFLHDIVTCIGGPDHIVNQ
FT                   RISSSRDDIGNSIQLGQLFNGVLYVTTCGDGSKIAVVTNDSLLVLQMNSGILCSESESE
FT                   NVSVEHSIQLHNIQYVIMGSLSKSNSRKINVCRSVFNNNEDFKSVILNRNSIKGHGYAL
FT                   NIDDIYPMPCNKKEEAGLKETLFNDKMMSEIVIQMQRQSECISPSPRTRSSQRLRPSTP
FT                   TSYSSSSSSFSSSSSKREFPDYFQVREAETPSMIIITHPSTPLPHYRWIECSNRSNLEK
FT                   LKNVICSLI"
FT                   /protein_id="XP_626628.1"
FT   gene            complement(<136878..>138215)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_440"
FT                   /db_xref="GeneID:3373807"
FT                   /locus_tag="cgd3_440"
FT   mRNA            complement(<136878..>138215)
FT                   /db_xref="GI:66358901"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_440"
FT                   /db_xref="GeneID:3373807"
FT                   /locus_tag="cgd3_440"
FT                   /transcript_id="XM_626629.1"
FT                   /product="C-type lectin containing protein with a
FT                   transmembrane domain and mucin-like rich regions"
FT   CDS_pept        complement(136878..138215)
FT                   /locus_tag="cgd3_440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C-type lectin containing protein with a
FT                   transmembrane domain and mucin-like rich regions"
FT                   /db_xref="GI:66358902"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_440"
FT                   /db_xref="GeneID:3373807"
FT                   /translation="MKLIGLSAQPTYHPLDRSSSGSFESDSTESGRANEERNDTLEEMI
FT                   YKQSSDSIEDILVPVTKPIFSDYSSIGRNSGVEEVYSSNVSTISSKGVVFPNTTTSSDN
FT                   DFTKNNPANSSKHTSTSTTTNTTTTTTRTTTTTTTTTTTTTTTTTTTTETTTTKKSTTA
FT                   TKNTTTTLRPRFYTTGKSLYTPKTENVRTSAYVKKNSNSLTGNNIVKRDSGIIDMNSDK
FT                   EAENSLLGFGAGEYVNSESDDPQETQELSYLNEAGQVKMEKSIEGHFDVIERTVNKKLI
FT                   IGVVIGILLILLILMFCCVFFLRRRSDDTESAQNVDNSNKEIIRNKLNSLQLASIKPIL
FT                   ARKGSKIVHMSQKSISYDSNIAPPEKKSIVSVEDTTFSPEYMNSGEGGEAEKTIPYYVA
FT                   QSQANTLQLHSGRNINLGYDTRPQTQKQAVLKSPKYHDFFYSESSR"
FT                   /protein_id="XP_626629.1"
FT   gene            <139832..>140827
FT                   /db_xref="ApiDB_CryptoDB:cgd3_450"
FT                   /db_xref="GeneID:3373806"
FT                   /locus_tag="cgd3_450"
FT   mRNA            <139832..>140827
FT                   /db_xref="GI:66358903"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_450"
FT                   /db_xref="GeneID:3373806"
FT                   /locus_tag="cgd3_450"
FT                   /transcript_id="XM_626630.1"
FT                   /product="Ctl1p-like mRNA capping enzyme beta subunit
FT                   (polynucleotide 5'-triphosphatase)"
FT   CDS_pept        139832..140827
FT                   /locus_tag="cgd3_450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ctl1p-like mRNA capping enzyme beta subunit
FT                   (polynucleotide 5'-triphosphatase)"
FT                   /db_xref="GI:66358904"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_450"
FT                   /db_xref="GeneID:3373806"
FT                   /translation="MCLLLPSEKEFSYRFSPGLEKWQMTSVVEELRKDFDESKIPYIIK
FT                   NRNTNDYYVHNPNKSETEDKSLIRLSYISPKNQKDKPTEAIWKEKIAVFDFCSPGQPGD
FT                   LETKHNIENGTLLKDFRIAINLEHKENPIEVANTVTGPIENSCVLERRRERETVEVSNF
FT                   VLDSTHVVQIESRRGFRQCETYELELELKPSHFIPLLKSYIEDTNNGKLKVIGTHPFIK
FT                   LLTNFVNLVFGITLFLNNKKPNEQIESSIQNSSGNENQIMDLTSCTQSNEIVQAFKKYV
FT                   SPITPILGDYLYRAVASEKQKLNRPQDIICKDDIDISLGIKPLPPDTKEI"
FT                   /protein_id="XP_626630.1"
FT   gene            <141730..>142386
FT                   /db_xref="ApiDB_CryptoDB:cgd3_460"
FT                   /db_xref="GeneID:3373805"
FT                   /locus_tag="cgd3_460"
FT   mRNA            <141730..>142386
FT                   /db_xref="GI:66358905"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_460"
FT                   /db_xref="GeneID:3373805"
FT                   /locus_tag="cgd3_460"
FT                   /transcript_id="XM_626631.1"
FT                   /product="glutathione peroxidase"
FT   CDS_pept        141730..142386
FT                   /locus_tag="cgd3_460"
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="GI:66358906"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_460"
FT                   /db_xref="GeneID:3373805"
FT                   /translation="MGNFLASTKITTDLASKSVYSYTLTTLEGNPFPMESLKGKVVMVT
FT                   NVASKCGYTKSYYKQMVRIYSVFAPLGLEIIGLPSREFMGQEFEDPKEIRKFADSHNVK
FT                   FPLMEICKVNGPDALEFVQKLKRETPELYDEKSNTLSAIKWNFSRFLIDKNGKVVAFRG
FT                   TRTEPNELIPKIAELLGVSDYQNLFKNYDKLHPESGYDPKDDVCPLKQKQSEQGS"
FT                   /protein_id="XP_626631.1"
FT   gene            complement(<142478..>144082)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_470"
FT                   /db_xref="GeneID:3373804"
FT                   /locus_tag="cgd3_470"
FT   mRNA            complement(<142478..>144082)
FT                   /db_xref="GI:66358907"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_470"
FT                   /db_xref="GeneID:3373804"
FT                   /locus_tag="cgd3_470"
FT                   /transcript_id="XM_626632.1"
FT                   /product="hypothetical protein with 10 transmembrane
FT                   domains"
FT   CDS_pept        complement(142478..144082)
FT                   /locus_tag="cgd3_470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 10 transmembrane
FT                   domains"
FT                   /db_xref="GI:66358908"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_470"
FT                   /db_xref="GeneID:3373804"
FT                   /translation="MEAANDSFKYSSKAFATMTAGCIGSGVVFLTYGMKMAGLAVGIST
FT                   LIICAIVSIVTHSIYVVGSLQLGAVDLSTLLMRVSAYKSIRSFLARRDAKKENKEDVEK
FT                   LQKGQKMILTASEVEEMKGNMKFHFKSISIICFLSMAYAVPVYFILLRSFTQDLVTHAV
FT                   FSFPQAKFLEYLKDEYFLSALYFLLVLPFATKSKVSELDFLGWFSVASFFTLATVIVVR
FT                   SVVFPYSGPMPPVTGEVHIWPAHGPLSAFKMFTFATYAFLCHCMVVPAVLNVSTCTYKR
FT                   CIKVISASFTFLLVFSLALTISAYTTFGEATQDNITLNFSPCDIFMGFSRILSCISLCV
FT                   IIPLFTVSICNFIVNDIGLINYMSELAVEDVFQVIFDGNDDDDKKESRALKLTYVPSNP
FT                   NIVLDELVSLLAKNKARAIESDGQEDFSAEATLKSMKNKEKFNIWRFLLSTAILLVSIF
FT                   LSHVAKSCTQYVELFCGYIDAFTASIYPLFVYSIIWGRRKSFFTNFCVVLSCYISAIGP
FT                   ILSSIVTTYELITGVQT"
FT                   /protein_id="XP_626632.1"
FT   gene            <144713..>145813
FT                   /db_xref="ApiDB_CryptoDB:cgd3_480"
FT                   /db_xref="GeneID:3373802"
FT                   /locus_tag="cgd3_480"
FT   mRNA            <144713..>145813
FT                   /db_xref="GI:66358909"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_480"
FT                   /db_xref="GeneID:3373802"
FT                   /locus_tag="cgd3_480"
FT                   /transcript_id="XM_626633.1"
FT                   /product="hypothetical protein with a signal peptide"
FT   CDS_pept        144713..145813
FT                   /locus_tag="cgd3_480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with a signal peptide"
FT                   /db_xref="GI:66358910"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_480"
FT                   /db_xref="GeneID:3373802"
FT                   /translation="MRNIRFFPLLGIFVLGLIIICFGVSECYQEEKSLEGSQVFQEDPQ
FT                   FKLEQSGSYKEDPERMRNLDEFIKYLVNDVLFPLEGIVKGYCLFRSVSDEAKEDLGLYN
FT                   KESIAVATILLSGKWKNPINFILRCRESLRVVSNGMKVSSFEHSSESWSSITSARRKMK
FT                   ASRIKICFKARICSRMMKKEEGTDNLRRFLINRTQYGLIYPDQGSEMAVWNTVREFKDI
FT                   LSAGILKGSIKNHIRVIIMFNYMNKILSQIGKQPVTLFVCIALINSMVRERSLSEWLSF
FT                   SRSKTSSRNRLNELGIDPVTNLRYDTRLNIKENIINFQIRTCNHVIWTSEVLLSERQVQ
FT                   VIGVNSNQIYTLRKRITWMCNKMFTM"
FT                   /protein_id="XP_626633.1"
FT   gene            <147172..>148470
FT                   /db_xref="ApiDB_CryptoDB:cgd3_490"
FT                   /db_xref="GeneID:3373801"
FT                   /locus_tag="cgd3_490"
FT   mRNA            <147172..>148470
FT                   /db_xref="GI:66358911"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_490"
FT                   /db_xref="GeneID:3373801"
FT                   /locus_tag="cgd3_490"
FT                   /transcript_id="XM_626634.1"
FT                   /product="putative fucose translocator with 8 transmembrane
FT                   domains, within locus of 3 paralogous genes"
FT   CDS_pept        147172..148470
FT                   /locus_tag="cgd3_490"
FT                   /gene_family="HOG000137632" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative fucose translocator with 8 transmembrane
FT                   domains, within locus of 3 paralogous genes"
FT                   /db_xref="GI:66358912"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_490"
FT                   /db_xref="GeneID:3373801"
FT                   /translation="MGHSKNKKSNSSSGSEAGKESERFISFLPNSVATVLAICSFIAAS
FT                   ISSVYFNNGVFKKQIKFPVFVSCAQQLVGMIIMSIFGLIRMAISKSSESGNGKDGAEVQ
FT                   ANGSSVSSWKKVMYAIPVAFFFSFNISFNNICLTHGKVSTYAMAKSTTLMWSLCLQFLI
FT                   LGIKVKLTSLISCAIIISGVLIGAFDPKSLVLVSLIYGCISSFSQSCYNITLKWVLPKI
FT                   GNDSAGLLKYVQMWSILFFFIPMFGTGEVIPAFTTSGCFDFNDLNRMIYLWGLITTSAL
FT                   LAIGVNQSTYVVIGLTTPATFNVCGLVKQALQTIGGIFYLGESLPTQTIIAVCLTFCGS
FT                   ASYTAFNHFGSKPSMSPSELKVVEEKYKEVARQSVGTASDVFENAQDDILKRSGSKTKN
FT                   MITPFTSKNPEAIPLKDDIEEGLPTGNNNENRN"
FT                   /protein_id="XP_626634.1"
FT   gene            <148958..>150142
FT                   /db_xref="ApiDB_CryptoDB:cgd3_500"
FT                   /db_xref="GeneID:3373800"
FT                   /locus_tag="cgd3_500"
FT   mRNA            <148958..>150142
FT                   /db_xref="GI:66358913"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_500"
FT                   /db_xref="GeneID:3373800"
FT                   /locus_tag="cgd3_500"
FT                   /transcript_id="XM_626635.1"
FT                   /product="putative fucose translocator with 8 transmembrane
FT                   domains, within locus of 3 paralogous genes"
FT   CDS_pept        148958..150142
FT                   /locus_tag="cgd3_500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative fucose translocator with 8 transmembrane
FT                   domains, within locus of 3 paralogous genes"
FT                   /db_xref="GI:66358914"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_500"
FT                   /db_xref="GeneID:3373800"
FT                   /translation="MSKDSERPEISFMGLPRLASASIAIAVYVVCSIGCVYANKWLLSN
FT                   VGACHGFIPLVQQLIGAIFVRTMVYITGICGIGSDNQNPSSDKTSQNEKQNESLVSRLW
FT                   NRYKYIWPASFCFSSTIVLNNACLSMAKLSTYSVAKSTTLIWNVLFQFILLRIKLPVST
FT                   ILSCFLILAGVTIGSLDTSTLAPMAVIAGCSSSIFQALYNTCIARALPKTNNDTSEVLV
FT                   RNQELSSVFLVIYILASKELVNLFMHSPCFDLSSSKFLSCWAIFFLTTAFAAGLNKFTF
FT                   MVIGLTEPSTFSVIGFTKAGLQTAGGWFIYKDPASIKSVTSVVFTLSGSLIYGITRGSK
FT                   KSESKKEQVEEIRRLTRCSAASVGDIDAVPSPRDEEAKKSASNDEKQKLITSKV"
FT                   /protein_id="XP_626635.1"
FT   gene            <150949..>152118
FT                   /db_xref="ApiDB_CryptoDB:cgd3_510"
FT                   /db_xref="GeneID:3373799"
FT                   /locus_tag="cgd3_510"
FT   mRNA            <150949..>152118
FT                   /db_xref="GI:66358915"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_510"
FT                   /db_xref="GeneID:3373799"
FT                   /locus_tag="cgd3_510"
FT                   /transcript_id="XM_626636.1"
FT                   /product="putative fucose translocatorw ith 8 transmembrane
FT                   domains, within locus of 3 paralogous genes"
FT   CDS_pept        150949..152118
FT                   /locus_tag="cgd3_510"
FT                   /gene_family="HOG000137632" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative fucose translocatorw ith 8 transmembrane
FT                   domains, within locus of 3 paralogous genes"
FT                   /db_xref="GI:66358916"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_510"
FT                   /db_xref="GeneID:3373799"
FT                   /translation="MAGDFGNKSNSQEEVRYCFGLPNAVAAPIAMCAFIVSSIGCVYYN
FT                   KKCYQKDLPFPVFMSWAQQLIGMAIMSTFLTIRGILSGNEEMSASIPLSKRLYRYKYAV
FT                   FVAFCFCMNISLNNMCLKDAKVSMYAVAKSTTVCYSLLLQYFLLGIRAKLSSVLSCFVI
FT                   IGGVIVGISDKEFGLEPRSFFMGTLSSFFQSLYSVAVKYTVPHCDNSTTELLLHVQELS
FT                   CIILLVLSVAWGETSKVLSSNVFAFVSAPLSALWLWVLMAGSAILAICLNQCTYLVVSL
FT                   TTPATYNVTGLVKQALQTAGGFIFWGDKLKPAPVGGACLTLTGSAIYTLTKLWDNTPKN
FT                   TKQEETIKEQARLSVGTGSDAFENPLTENGNQNEKQPLIPEDKCEKGQA"
FT                   /protein_id="XP_626636.1"
FT   gene            complement(<152635..>154686)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_520"
FT                   /db_xref="GeneID:3373798"
FT                   /locus_tag="cgd3_520"
FT   mRNA            complement(<152635..>154686)
FT                   /db_xref="GI:66358917"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_520"
FT                   /db_xref="GeneID:3373798"
FT                   /locus_tag="cgd3_520"
FT                   /transcript_id="XM_626637.1"
FT                   /product="cysteine-rich extracellular protein with a signal
FT                   peptide and two apple domains"
FT   CDS_pept        complement(152635..154686)
FT                   /locus_tag="cgd3_520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine-rich extracellular protein with a signal
FT                   peptide and two apple domains"
FT                   /db_xref="GI:66358918"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_520"
FT                   /db_xref="GeneID:3373798"
FT                   /translation="MGKSWKQFKYGLLALAYILTIVKCQRKIPEYFNDGPFPSLSIPTS
FT                   RFGNSTTFVADILDGALSPFSYLKLAGISACGKLQTGTPLPSVCYIDFELKCNNPSEGG
FT                   LKIRGKPVVTHHGVIDVTGGSFELNNGKSKAGGWGYGIFPYLGESSYFELTLVPVLNKK
FT                   GEYVFEIYGVGYEKAHLTSESIGINCPFSIGEVIFKNVHWARTYIVGVNWIRNQLPFPN
FT                   VIPKTKNKLVEMDAPFTPGSSWRLGGMFLSSLHVPVNPSIPIGNTDMRVILSCQKNNNN
FT                   FLISLNSTGDITVSQLYTNYTNTQLFDQFKPNNEIFTGKYPHVMYNGLIVELVIARSLY
FT                   AESGVIYLNDLAIPKFFECRDNTIRVSVKHDTWAPLYTSNFTSNCHEYGSSFTGVNLFS
FT                   IPTFLSPGQCQNSCIQTSDCEFWTYNNKDNICNGYSSEKYSFKRDSSTYSMITGSVSCP
FT                   CYSHNVNLVTPLLDGNDKVKVTNSAVSSPAECQALVLENNGLGSYFVYNKEKKECYKQG
FT                   VVKSNTVPIIDTNSVVGPSICYEYIYSNGVTRFSDKLQLIKSIKISTNSTDHHGEFCRS
FT                   LCSMEEKCQIFELNNSYECMLYSINDKRGLRPLFDIIENSWPTSGVILMGISTPLVVSY
FT                   PNGNREHILHAEVGSLSLDLTRSSDAFNSSLTTKQLSILLAILLLLIL"
FT                   /protein_id="XP_626637.1"
FT   gene            <155559..>162416
FT                   /db_xref="ApiDB_CryptoDB:cgd3_530"
FT                   /db_xref="GeneID:3373797"
FT                   /locus_tag="cgd3_530"
FT   mRNA            <155559..>162416
FT                   /db_xref="GI:66358919"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_530"
FT                   /db_xref="GeneID:3373797"
FT                   /locus_tag="cgd3_530"
FT                   /transcript_id="XM_626638.1"
FT                   /product="large hypothetical protein with signal peptide"
FT   CDS_pept        155559..162416
FT                   /locus_tag="cgd3_530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large hypothetical protein with signal peptide"
FT                   /db_xref="GI:66358920"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_530"
FT                   /db_xref="GeneID:3373797"
FT                   /translation="MNGSKNRPSFSVKILLFFLTSGYLIFSPVVFGIGLSQEQTGFTGY
FT                   DSPIQETSGLEATNYEARDYSTIFGQDASSSPESKTLGELSRVKSRSADRSPSLPYSQE
FT                   PSMELENSISKSPSAFPNQSQQYSPVYEQSPSKNSRFVLKRENSLLGELSKSKSSSKSK
FT                   SPQKKIPSKDKKRPLVVSLSSEASHSERSKSRSPSRSSSKSRSKSRSRSELSKSRTGYG
FT                   GEMSISSPEISPVKTEKSRSKSRKESSKRPSTPESEFLKEQEVSSSQNMGNIIPLTAPD
FT                   MSPSPKFSFNEVSPSNRVEASNIEASASPSTLLDQSIPQEASVSSPESSSLLSEELSVK
FT                   EDGSLNATQMPSRKSSGTSESVSARPYTPVDEGSEFSTLLDGSLSSNEPIDTSHLPLEV
FT                   ASESSIGSNYMTLLSSLYGMQALSGVPLDFSEELFRIEILVSEALYNTGLSISNADVTL
FT                   LTKRVALVDSSDKNNSFGAQVHPNSFEKIPSFPKVTFNFAECVYQLENILFHTRSFIKP
FT                   VSMSHILKGCDHIRSSLNISKPIMENNEIFTKVIQYLILRIYNIGNHEILSIIHKRTSI
FT                   PAILDLTVFEKLQKSLIEDFLSDSTSLPLPVEFWRTIFVQQLHSFNLYSKDLIGGLLDD
FT                   HFGLMDILLDTMYSDPIKMCPYITSIVFYKVNPFKIEDIRINSAKIQTFCLIYLKNMGL
FT                   NELVTLNKLNMPTLSRNSRLDQIAKQLAPGFEILPYFHPDFPKDGNDLTWETCYSIYSS
FT                   VSMMLNSLQLDLIFPQISPLCTKITKKPPSPKFILGMFSRILDIPSTIQNSLLEIQDID
FT                   QIISSLSVQLKLPETHLREIYTDYIQGNPIKYLNTIYTILTKSLKFYFGFDSNQESNRQ
FT                   RNSNKTFEQLFLTRNISENTQMFERLNYWSTIHLYFLSFTMGIPNSSEILSGIYSFTPS
FT                   NCESLLFSFFRRVSYSTRSSIADSLTLCITMYSVIYKNNISSVLVKNISIKELRDALNY
FT                   KIGTWTPTQNEWMRSIYMVFENKLEIIPNISNIQTLSLTINEDFFNCFYSVNKYLHGMV
FT                   TVTRFKDIKTPNLENRILNERSLGFNLCSSMSIGAHSTREEAIELRIISTVIEAVRQFG
FT                   FKIDIEYIKEFINNYKLSNNSAFPSGRIILDNIISKFPNTLGTAIKKAFQANSSSSNSL
FT                   PYFIQAERIISKTLESRGCFIQNKETSIDGRSFELSRDISISPGNKNVSYYNTINSCLS
FT                   WKTFGYFNLISCYSVLVNSGTCESKDVILEAMVEIAERLEWPRELILLILSQDFSLSDS
FT                   NVFQKIKQSTDQEEFEKYLQIIQDLIVHVEEHVNDFSWSEKSLSNPKDESYVLAEPSEV
FT                   SISKSQTQKINYSFAFGFSKDSIGDYLRLWEYRKEIVLNQIMSFPVNPSLSLTKDEISS
FT                   LLMDSSPQNINKFVNSKMTPFANKIKELCYKEPHGSFLCEIKTQIGLPPLKIYGKGSNM
FT                   ISTSISVMNPPKELGQENLLVLMIATPSKSSIKWEKLEPQSLLFLSVLMGPKWEKELKR
FT                   YTQLSVKYFPYSGEYIRLTPPVFKIETKESIIQETSDLLDSSISASISRSPSTKMSKAS
FT                   VLPGVWHEHLGNISIQKLVDFSKFVPDNSNLLINIVWTLASAFNSLWVGGVELCQIDLK
FT                   SIYAYLGSQNQQSLNMGKILDEFLEFGPNEENVHSLTNFVLHTLSPPLIRFSELGRSRV
FT                   HSVTESSIEASQSKINECNDQLEVMNIFKNILSSTDLSGKIKGQNLETICREISEIDPT
FT                   KLDCSSLAWARENSRIPNDLDKWPITDIPIVSPTLKQQEVEIPTSVNPNEEFSNPESKY
FT                   SEQSRSLLESAPTIPVYIPPSAPSIPPSIPPPIRQSVRHPIPPSISASEPSAKEVVTEE
FT                   SQKKEFSPESPPSEESEVEGTSTNEIFDQASVDQGDSSVFVTNPILPPPPTSTIVKPYK
FT                   PEDLNEFTLVKVPKGQLMNLHIYPRITGNLSEQRKFEIKELLTTLKGVAEELISKFTSW
FT                   SASISRKHSSIVPDVNFKPSFIFVPPTPNNRADSPRILEKEFYIHESVFLFAREELQRI
FT                   ELPMQQIRNEDLVEVKMSRASLAFINNNKQAPPSITIPQAPSFPDIRPNISPISQAPSS
FT                   IGGFNDNEISHLVSNIEKKPGKYKESIENTQRSSELSNSLEKKSDISLSSGSLGQGSES
FT                   SQREMSSESVIKENSEENVSESQRSISPKSNLESENIQGLSNGHEYGYSTDSSITKGEK
FT                   NNSNSLAQENSPNSDSNSHNSQPEMSSLKSESSLDFGSNTDLSSSDSKSVSGSNSGE"
FT                   /protein_id="XP_626638.1"
FT   gene            complement(<162614..>164089)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_540"
FT                   /db_xref="GeneID:3373796"
FT                   /locus_tag="cgd3_540"
FT   mRNA            complement(<162614..>164089)
FT                   /db_xref="GI:66358921"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_540"
FT                   /db_xref="GeneID:3373796"
FT                   /locus_tag="cgd3_540"
FT                   /transcript_id="XM_626639.1"
FT                   /product="protein with 12 transmembrane domains"
FT   CDS_pept        complement(162614..164089)
FT                   /locus_tag="cgd3_540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 12 transmembrane domains"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66358922"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_540"
FT                   /db_xref="GeneID:3373796"
FT                   /translation="MMEKPFTCENQTKSGFSSTTLLLFYVVSAPMVGAPYLLPSAVKEL
FT                   LMNNDAYYWLDPDFKLTTMNSLCSLGTSSLLLSGVLGAYFVDLFNNRNTAILSAAFHIM
FT                   GWIFCFFLDKTWFYFPYIGICLWGISTQLLTLTKTSISVFYDSKKHLVVAMVGGSVGMS
FT                   FAYMQIMVNLVRYISSKGIDFHYLGINPTQFIIIINCFFSILWMIGFYFIIPKHPFVTP
FT                   TVDYCTRVSISRSQIMNSLTEFDHEERLSLINSQMVVEVNRCKEDIPYQWTLTFKEQLI
FT                   SIPTILFTIIYSLMWFVRLYFTVNMKSILLDQTSGDLQYSESIINIFGLLLGTTFIAAI
FT                   LVGIFVDLMGIYLFLVLFVASSLLILVLFANFIPYCFLSHLFGIVICVFCYSYFIGCSF
FT                   SLFTSAFGYTHLNSIQGISSTIAGFFTLVYNLWDSFIHRNYKDNFFFPTIIAIIINSFI
FT                   LILSIFILLYTKRWNSHNSTYFFSINKKTSLIK"
FT                   /protein_id="XP_626639.1"
FT   gene            <164602..>166083
FT                   /db_xref="ApiDB_CryptoDB:cgd3_550"
FT                   /db_xref="GeneID:3373795"
FT                   /locus_tag="cgd3_550"
FT   mRNA            <164602..>166083
FT                   /db_xref="GI:66358923"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_550"
FT                   /db_xref="GeneID:3373795"
FT                   /locus_tag="cgd3_550"
FT                   /transcript_id="XM_626640.1"
FT                   /product="protein with 12 transmembrane domains"
FT   CDS_pept        164602..166083
FT                   /locus_tag="cgd3_550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 12 transmembrane domains"
FT                   /db_xref="GI:66358924"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_550"
FT                   /db_xref="GeneID:3373795"
FT                   /translation="MAGSETDKRRASGRRGSLESGRGDSLGKNSNESNPGVFREMFGTK
FT                   ENPTVIPFKSIIKNPKIYFPIIALTATLTAGHIQNPDATRELFFKSGAFSFAPEMLESG
FT                   EAFFTINNVMSVANGAVFIGHMIAGSIIDKFGLLPCALVGHILSIFGYTLMFLLHFSSY
FT                   AYYFAGICFGISLSCTFASRSRFMQMFPKVKNTVGMLLTIGMDFSLLFPLLQDKLSELF
FT                   GGTKIVMTSMVIIQAIILIHHAFIFPYGKLPDRMEYKNSNNSRNLEDETTDLIQKDETE
FT                   EIEQDGIQGYRELSCIRKIFSLPFIAFFIYMLFFALSRIHYQLFFRSTCLMNISDQVSA
FT                   KKAADYGNIVYSLASYLSLAWGYIVDYNGLIITMQYQIALLIGAYFCAGFKSVSNIIPQ
FT                   ILSNVFAGLYTCFANSLTYSFVAGVFGYESFGVVQGLASLSAFASLMSINYWQNFLENV
FT                   LQRDYNLANKLIMYAAIVILVILFILRMIYVRKSK"
FT                   /protein_id="XP_626640.1"
FT   gene            complement(<166501..>168153)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_560"
FT                   /db_xref="GeneID:3373794"
FT                   /locus_tag="cgd3_560"
FT   mRNA            complement(<166501..>168153)
FT                   /db_xref="GI:66358925"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_560"
FT                   /db_xref="GeneID:3373794"
FT                   /locus_tag="cgd3_560"
FT                   /transcript_id="XM_626641.1"
FT                   /product="hypothetical protein with a signal peptide"
FT   CDS_pept        complement(166501..168153)
FT                   /locus_tag="cgd3_560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with a signal peptide"
FT                   /db_xref="GI:66358926"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_560"
FT                   /db_xref="GeneID:3373794"
FT                   /translation="MNFVKESSLVLLLLQLILWITLIQELSIVKAADSRSGNKSGLRKR
FT                   SGLTPQGTSKVSSDSSKKESNSAGEEGINSVEELRGINPMKAHSIGRVVEICNGQNVLK
FT                   GEGKKKFFFLKCESDKNQKVVSVPQINQITKKAVEGSSEKTVLVNWKLNLEGANSALVY
FT                   AILFVTSTLQYTVMENCLVLPRNQVLKGDPKNPDLAQKLYDCSVGSKVQPITSFHILAK
FT                   IDTYFNLRPARLYNELERAMRISQLSYSYKANSKTPEVRVSLHPKYYVINDKNGNEVFN
FT                   EMLFIEKLDAIPYIKVIVVLKDENLLYDLLIGKEFQEQKVQVGRWYRRMLRGIWLPFYT
FT                   AAMFMLQNGNKVHCDLHTRNIMISIDPNFGSDKWKTINTMFELAAVTPTSMKIIDIGNT
FT                   ISMNSHEIQYENDPCRKYERRPYEDIGLLDFRILDPLTAPAKPPSFLPEEEKIFSEDVK
FT                   PDDINNIRSLIKYYNMKLSKLKAAIRSVHQWESCRVKRVNKKTRRLHQEIDKYPCRFID
FT                   QKQALLEACKILKRYTAEQFMGVPSCNFSSRRK"
FT                   /protein_id="XP_626641.1"
FT   gene            <169085..>170428
FT                   /db_xref="ApiDB_CryptoDB:cgd3_570"
FT                   /db_xref="GeneID:3373793"
FT                   /locus_tag="cgd3_570"
FT   mRNA            <169085..>170428
FT                   /db_xref="GI:66358927"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_570"
FT                   /db_xref="GeneID:3373793"
FT                   /locus_tag="cgd3_570"
FT                   /transcript_id="XM_626642.1"
FT                   /product="hypothetical protein with a signal peptide"
FT   CDS_pept        169085..170428
FT                   /locus_tag="cgd3_570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with a signal peptide"
FT                   /db_xref="GI:66358928"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_570"
FT                   /db_xref="GeneID:3373793"
FT                   /translation="MFELKFLFLFLALALLRNAAGDEFSDYSIFQSPESSTELSGGSLG
FT                   MLNFGQKQSLEDTTFDTQSQVLLDHFQDPNEPSTIGNMISENNYPVERKEIIGSFDDKY
FT                   KESPYSETSMSSRRGKRSQNIFSINKILSKYSKEELALLNEYLISFSMLLKRRFRKFIF
FT                   KKYSPSRIRSQFAKMYVDKFGGSKSKALLKLREFEKILSLKHSAARRLFHSQFNLLIST
FT                   LNSAEALIYLTEKWRYQPTYISEPLLVVSKSSYNKLMNLCKKKSRKTKIVLVSASSELI
FT                   PKKFRKSDLNDSFQELSKFSKTIHSFQESASSGGADSKLSLGTTQCNWDSSRKKKAKFT
FT                   KSSLKCFFKPKKRSFFHIHYYDITNTAKFKYLMQVLLRYKPNPYSQNAYPLIIIPVLIG
FT                   IPQIDKNGSILGLNSITEVTKKKRKYGKSFNHRNKKKSNKKKRTKLGK"
FT                   /protein_id="XP_626642.1"
FT   gene            <170792..>172858
FT                   /db_xref="ApiDB_CryptoDB:cgd3_580"
FT                   /db_xref="GeneID:3373792"
FT                   /locus_tag="cgd3_580"
FT   mRNA            <170792..>172858
FT                   /db_xref="GI:66358929"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_580"
FT                   /db_xref="GeneID:3373792"
FT                   /locus_tag="cgd3_580"
FT                   /transcript_id="XM_626643.1"
FT                   /product="hypothetical protein with a signal peptide plus
FT                   transmembrane domain near C-terminus"
FT   CDS_pept        170792..172858
FT                   /locus_tag="cgd3_580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with a signal peptide plus
FT                   transmembrane domain near C-terminus"
FT                   /db_xref="GI:66358930"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_580"
FT                   /db_xref="GeneID:3373792"
FT                   /translation="MIKSKYWYWTLTLVLLIIQVVLGQNEKFSRLVASYATGIDEIFYP
FT                   FIPQLFLMMGREQVISNLFNSFDVVIEKYPGTANLWMFESIKGEISEIKNSMEENILNL
FT                   GDKYNIKFAGDNKFKSFQDFQKDLLIYFKEFGLERAFKIHNEIEEIRKKLMDYKTLNNV
FT                   KILEQVEYRWNFLINILEFVNKNEGNKNDELRRKINQSITNHFIMMEIPKKTEFDVKNF
FT                   DSDFSNEFWDGHLSNYKLLALFHEYSIQQINLLYKQKLIWLRIHLTVGIIDSEGFLNKV
FT                   HKSASNTMVHSISLTSLQYLYQIKDRIDFFLLNESYLDQLLDIYDNLSIAMNRWMGQTL
FT                   VLDDLQYLYTHLKIECLDIRKALIHFFDRIKQYGQTDLIVLDKKSKKNKKLGKKNSGFL
FT                   THLPIEWDITTKLENDLLSLIREIEIWKGKSYPKVKQSGDILIFRDMITSRVNMELEEE
FT                   IKKNDSLYEDHTEFYLYLERIEQRYMTFVRKSIVFLDELKSTSNDCQTLYFSASQAGTL
FT                   IYEIVASEILKTSNRSGRINMNSSKQLKSLIKDLEFVKESIDTVKKTEEDSDATDILGE
FT                   SISDEDFIYVPGTVGSFKKSQTTSGYLIFRISVIVGLLIVAIILYIYKDKILVKKFDNS
FT                   EESEIYERYCSRVSLDEIEFNSSQNGEHKMVMKKNKYYKVDNKSGNIILKQQK"
FT                   /protein_id="XP_626643.1"
FT   gene            <173488..>177009
FT                   /db_xref="ApiDB_CryptoDB:cgd3_590"
FT                   /db_xref="GeneID:3373791"
FT                   /locus_tag="cgd3_590"
FT   mRNA            <173488..>177009
FT                   /db_xref="GI:66358931"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_590"
FT                   /db_xref="GeneID:3373791"
FT                   /locus_tag="cgd3_590"
FT                   /transcript_id="XM_626644.1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains, possible unusual phyletic distribution"
FT   CDS_pept        173488..177009
FT                   /locus_tag="cgd3_590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains, possible unusual phyletic distribution"
FT                   /db_xref="GI:66358932"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_590"
FT                   /db_xref="GeneID:3373791"
FT                   /translation="MDVIEAGDVVEKPSPDVFRSSRQFLDSEVKLIEEIKHNFLDTVGY
FT                   MEFRKFSRKHQGVFRDVARAWTLILLVLCGFFSNLLFFSSCPNLGDIAAHGLFYKGYNL
FT                   IILCVEIGMIVTTSFWLLMTQFQTGVVYSFRLSVLYTAITFLLFILRTTISDSENSTIL
FT                   QKCDYILSNGEVIVYNIIPLIYITLQFLISFISFFYSKLRPIIAVYYFKHPWFLKSWKF
FT                   VNIEPVELKLLSFGKRFDGSRNISPRNTSSKYCEKSESEDKTSSEGMKGGYSSDTKMFW
FT                   DTESDNQNIRLASGYFIEIKRFSVRKLLKKLNPIRLDLLLTFRTRKDRGRRPNSLKNQG
FT                   CSINSWYLGEINEEGRPHGFGRWREDDYYGEILVGFWKNGHPVGPFKTRECRSGSGFIC
FT                   LKLGFCRTEANLTPNLYGYADIECSVSGQFFRGFPLCHIYPAPSIGMNRSGSIFARIGA
FT                   KGKAALDDTTQKGKKMVGAVFNSSWFKKIRKKDKDKKTALEKKESILDSKKVVRLNLDN
FT                   IEGNSDKMESNELNSLSIDIPSGNEQNLKEVEPKLSSGMCKSEMNLSLQKKGVHMIRKV
FT                   RQKLRRNQNRQDKERDLSLLWVFQNLSPHIPMFTIHPKNEVTILVDAERGLYIAGYFPV
FT                   SEVLRYTKQTGARLALSNQDPESLLSENNLKSTILGPNDAISGLIPFSSSFSSSSIIKA
FT                   SQYPLNRPQDNRYLESVEVRVVDRYCNDSVFSKDALDENQDNTVYYPELEVKNWIHSDG
FT                   LHAAEALIFIHGYNNTIMDALRQVGQMIAFGNFPSYIKPMVFSWPSGNSFLEYFKARKS
FT                   AESPHTHNSLYQLILGLKNRGIRHIHIMTHSMGTRLFIQSFPKLLSENLLERCEQHDHR
FT                   SSIDPGNYLGLRHSETQFGDEINPIINEKVQIVSMTFLNPDYYLDDFINKAFPMLRQYC
FT                   NLITMYGDSQDGALKWSEIIQGRKALGCNVFGLHYGTIGSFSKRMKSQINDLDQYRASD
FT                   VELTSGLKKTVSTSNMAVYGDEINFSSNQKIGTTGLKSDTENHPNSENRASQESKPRND
FT                   SALSLIYPSKVLINSFNASQSPRQGSPRASSSGILETSSPYANRHTPEQRFNYLDMDVI
FT                   DQSFIEQNVGTMRHNNWNLNREVIEDLRELVVSRKRAYQRSTRLDKREGNVWVYRIAPS
FT                   CVTSIFD"
FT                   /protein_id="XP_626644.1"
FT   gene            <177562..>181851
FT                   /db_xref="ApiDB_CryptoDB:cgd3_600"
FT                   /db_xref="GeneID:3373790"
FT                   /locus_tag="cgd3_600"
FT   mRNA            <177562..>181851
FT                   /db_xref="GI:66358933"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_600"
FT                   /db_xref="GeneID:3373790"
FT                   /locus_tag="cgd3_600"
FT                   /transcript_id="XM_626645.1"
FT                   /product="hypothetical protein, signal peptide"
FT   CDS_pept        177562..181851
FT                   /locus_tag="cgd3_600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide"
FT                   /db_xref="GI:66358934"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_600"
FT                   /db_xref="GeneID:3373790"
FT                   /translation="MKALFLAFLIIFIGGWGGGKLVRVESLKTSAKRYQERERVPSRLP
FT                   PPREEPPVFQRYLYSYPKDYGYYFFNRISDSNYWDRINGENKQIPIEGWQWDNTSNNWL
FT                   WGPLRNQDGTPLLPLSPELEAPRAYVGPTRIYGPIQVDDLPIPRVLDIICKPYESLIGI
FT                   RAWFPNPESKGRKDLRGIQFLCSSPLDTRVKGGSKHSTWSRIMGNVGPNLKKYTVLTRP
FT                   EDPFVKIRVFVETLNPVKHQSQRELVIPTYQGPRLVYIDNQEEALEKGPIYLIRRITLR
FT                   TKNNHLSFLGKAGGNLPSVVESAPEGYELSGFRILISGYPRSKWRGADFSTLAYRNSIS
FT                   LGFLFSKTEDILSRPQVIYGRRGYDFQDIKCDGKITGLQGFFMGNRGLVGIKVECDRVW
FT                   QEVILGITEGTDYKALVGSMISAVTLHLSPEKFIQSLVVFSTTGRQQKLGDDWVTPTIR
FT                   SSKSEGGGRGKILQGIFAELDKTGAISGIGFHWKKPPKPGQAGDREDYGNLEVSESPLE
FT                   GGDTGSLGNSSKKEIVPRSSFYGRVAKDCPILETKCPTGVPLTGLRLIMRKGETQPKPF
FT                   KMYLVSLSIQCGDEFFKPVGNPNLIEAGKKRTYDILIHEEDPVVDFRVYLGDLGLPHLF
FT                   DLRFKHDVLSSYELYGFRVAMMIRSERIGAIAPLYRVATPIDLPPITAKDISIRLFGAV
FT                   RPESDPDVVVLETSCPPGIPITAVRMWFVRKIEGNNVFSRLVGLRIRCGSKWRKTKLGS
FT                   SMGDRFEAEVESGDFFSRSFVENQSEKPFYVSGIMLVTLENRKSSFGETGTEIMKKLAS
FT                   GDVESEIYGFIGQETPEGLVSIGFLERKANYDDYPTFNDIEVAPYQVSASDIQGESEGS
FT                   LNEEKLIESGIVNFRPGEEWFGRRGLGGSHAEETFCAPGSRLTGLLVHTSTKIPHSIIG
FT                   LTLICDGKPLNPVGSTLGDIARYEIPMNEPIEKVEVVLNKEDRSLSRLKLFNRNHMKKK
FT                   MGKLHDRFLSGFDVEIRKGMITALSAIYTNFGDSGPPPKVRTVLGSNQVGSGSAPITDR
FT                   NTPWGHANANGDVSTGDEYSCEEGTKLTQITMAYKRNSIEQKQELIGLRITCNDEDYEQ
FT                   VGMWDVSDNNYILVEETFGLREKEFIIAIGGTRIDKTHSIGKLYFETNLLRQFGEWQHY
FT                   YVEAKTRGDGLYGFELLFEKTGDYTTPIAMLLPLFRPTSMDTRSEDLEEKKYKSPFELP
FT                   KAVAESSEEANEQEMRGMLSSPTIVTDWIGLDIGSLEMDGIWCKTSRLKLDGRMTWEDW
FT                   RNSRMTGLRVYNDGDHIKGIALQCGNSWLEEANLGLVGPKFHFDEISDCLESDADYIEN
FT                   IEVAIDSRGIPAGFKVFSHVKRQKKVLINNNSMVTWQSNVPDSGNHYASGIHVEYDPDT
FT                   NIIFRVRIVYRPISIAEDPEENVGFIF"
FT                   /protein_id="XP_626645.1"
FT   gene            complement(<182378..>182450)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_605"
FT                   /db_xref="GeneID:3373954"
FT                   /locus_tag="cgd3_605"
FT   tRNA            complement(182378..182450)
FT                   /note="codon recognized: GAG"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_605"
FT                   /db_xref="GeneID:3373954"
FT                   /locus_tag="cgd3_605"
FT                   /product="tRNA-Glu"
FT   gene            <183185..>184276
FT                   /db_xref="ApiDB_CryptoDB:cgd3_610"
FT                   /db_xref="GeneID:3373789"
FT                   /locus_tag="cgd3_610"
FT   mRNA            <183185..>184276
FT                   /db_xref="GI:66358935"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_610"
FT                   /db_xref="GeneID:3373789"
FT                   /locus_tag="cgd3_610"
FT                   /transcript_id="XM_626646.1"
FT                   /product="hypothetical protein with possible 4
FT                   transmembrane domains"
FT   CDS_pept        183185..184276
FT                   /locus_tag="cgd3_610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with possible 4
FT                   transmembrane domains"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66358936"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_610"
FT                   /db_xref="GeneID:3373789"
FT                   /translation="MEQNSIVPYHNGRNYPEYGQLTNYYPNNTNNNGNDSKSAPYEIPG
FT                   CPVFSVFIATVVGILWLFFALTLPAYHYARVVFPIDNYIDLNFGLWTVHVSSNCDSFVS
FT                   FDANKKMCRFIVSRMDNLSISDATNFICSLEAGTLQLLNLGCNKFHLLRIGSSVIMTMF
FT                   ILSIILLFFAAIFLLTFWFCYRTRRVRQSIFMLHFISALTCVLGIVGYLLVGGLTIQPF
FT                   RDSSMFGIGSSMFARLFFVDISRTFDLSTGFAFAAFGMIWIVLLPLWSVCALPSDICVD
FT                   AIEVIEDTTYEEEELKKLLGYSGLFGQNYGNEQSAANNSYYYQNNQNQNYYNHQYPQYY
FT                   QGQQNHNPYGQQYPYYNQQYRGY"
FT                   /protein_id="XP_626646.1"
FT   gene            <186592..>187320
FT                   /db_xref="ApiDB_CryptoDB:cgd3_620"
FT                   /db_xref="GeneID:3373812"
FT                   /locus_tag="cgd3_620"
FT   mRNA            <186592..>187320
FT                   /db_xref="GI:66358937"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_620"
FT                   /db_xref="GeneID:3373812"
FT                   /locus_tag="cgd3_620"
FT                   /transcript_id="XM_626647.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        <186592..187320
FT                   /locus_tag="cgd3_620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66358938"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_620"
FT                   /db_xref="GeneID:3373812"
FT                   /translation="VFLSKGIPPLIKFPIFAGMVVFAVKLPVEELESLISIFSSCLSLF
FT                   SFFSPSFSFSPFSFLFILFFGLLLFFYLFVHLFFILFFLRFLFVLLFILCHLFILHLLF
FT                   VLFILCLLFIFLFILCLLFFIRFLFFLRFLFVLFILCHLFILHLLFVLFIICLLFFIRF
FT                   LFVLFILCHLFILHLLFVLFILCLLSFLYLLFSLLFFLHFLFVLLLFVLLFILCLLFII
FT                   CLLFALLFLLPLYWVVYLTM"
FT                   /protein_id="XP_626647.1"
FT   gene            complement(<186754..>187701)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_630"
FT                   /db_xref="GeneID:3374143"
FT                   /locus_tag="cgd3_630"
FT   mRNA            complement(<186754..>187701)
FT                   /db_xref="GI:66358939"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_630"
FT                   /db_xref="GeneID:3374143"
FT                   /locus_tag="cgd3_630"
FT                   /transcript_id="XM_626648.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        complement(186754..187701)
FT                   /locus_tag="cgd3_630"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66358940"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_630"
FT                   /db_xref="GeneID:3374143"
FT                   /translation="MKMHIIKFGRLFLPILVIFSFVWLSESVRLENYEILAEDQIAEIE
FT                   NSQKQNNDQVCEINTIGESCSGRILKLKSNIQQGVVLNIKTEFSLISNDNSTQISESSS
FT                   ISKAKLSLRNNQRNEIKNSANIDLHSEIYNPIQGKEKEKSEKKTDDEKKTENEKKDEKE
FT                   KDEKKMEEEKERKKKVEEGKKTENEKYKKKVEDEKMAENEKDEKKTDEEKKTDNEKDEK
FT                   KVEDEKMAENEKDEKKTEEEKKTDEEKKTENEKKDEKKTENEKDEKKVEDKKMAENEKK
FT                   YEKKTEEEKDKKEMDEKVEEKKKTEKEDEKKRKG"
FT                   /protein_id="XP_626648.1"
FT   gene            <189397..>191454
FT                   /db_xref="ApiDB_CryptoDB:cgd3_640"
FT                   /db_xref="GeneID:3374145"
FT                   /locus_tag="cgd3_640"
FT   mRNA            <189397..>191454
FT                   /db_xref="GI:66358941"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_640"
FT                   /db_xref="GeneID:3374145"
FT                   /locus_tag="cgd3_640"
FT                   /transcript_id="XM_626649.1"
FT                   /product="acyl-CoA synthetase"
FT   CDS_pept        189397..191454
FT                   /locus_tag="cgd3_640"
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA synthetase"
FT                   /db_xref="GI:66358942"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_640"
FT                   /db_xref="GeneID:3374145"
FT                   /translation="MEEKIDRKDFFSVELENGQVEPESSPIYRNPSYSKGELSNLQGLN
FT                   ANNLWELFVNSVNKYKNKKCLGTRKLNRDGTYGEYVFKSYEELKEEALNIGINILKMDL
FT                   CPIRKYEDNEYQKEISMMGILSRNREEWYLTEHACNAFGICLAPLYDTLGEDNLKFILV
FT                   QTQLKSLCISNDSLEKIISIIERSIIDSTRDSILIKNLICFDHPTTEINQRAKNLDINL
FT                   ILFKNLQEKVSKKDKEIYKPKKIKPDDMCSIHFTSGTTGYPKGAILTHRCFLACVKSSY
FT                   EHLFSEKEIQLDNEDAHLSYLPMAHIFERLIVMNAYYLGIPIGIFSGSVTRLMSDSQEL
FT                   KPTILVCVPQVLTRIIQTVNDKISQSNFLVRTVFHKALKQKESIIKTKGDPTHWLWDRI
FT                   IFSNTRQILGGKLKAIISGAAPLGLEVNHKIQAIFCCKLIEGFGMSECIGTLGTRYSYA
FT                   HLGTVGGPFSDVEVKLTSVLEMGYDSTKEPRRGLLKIRGNSVCKGYFRDIINSKELIDS
FT                   NGWLDTGDIAERQQDGSFKIIDRKKSLFKLSQGEYISPERIEGIYLSSSSLIQHVYVYG
FT                   QSTDRFLVALIFPNEQALRKWSEDKGMNTLSLSLEELCESHELFDELNDSFHKAELSSN
FT                   LFGFERIHKFKVIPEVLSTSNGLLTPTMKIVRNKVNSKYKEVLNTLRSQI"
FT                   /protein_id="XP_626649.1"
FT   gene            complement(<192547..>195138)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_650"
FT                   /db_xref="GeneID:3374144"
FT                   /locus_tag="cgd3_650"
FT   mRNA            complement(<192547..>195138)
FT                   /db_xref="GI:66358943"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_650"
FT                   /db_xref="GeneID:3374144"
FT                   /locus_tag="cgd3_650"
FT                   /transcript_id="XM_626650.1"
FT                   /product="hypothetical protein, signal peptide"
FT   CDS_pept        complement(192547..195138)
FT                   /locus_tag="cgd3_650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide"
FT                   /db_xref="GI:66358944"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_650"
FT                   /db_xref="GeneID:3374144"
FT                   /translation="MKASSLLCVLFAFLFRAINIFAQNNDAKSSEKSTCEIYQDVKLTS
FT                   ANNTRYSYTSSSSKKSGPAPFRLAILAMLVSDFVTDNFAEIGTGFQEFDVIKFYEEILK
FT                   HGGTRGISNYKDCCFNSCFGGLIPYDSDHHLANLDSVSDKIGRTTLCEALCDHTMHFLK
FT                   SMDYFFLSSSELFELKITEKESNQFLEKDKNFLKGQSQAKKQQKSSLIRENEEKDDMAK
FT                   VQSFSSVNKFLLDIQDREQNQSESSDSNSISSNHHYQLHNHHEEDPNNIKDASVMNFIE
FT                   DKDFETEEMININSRLLMLWDVDKTLWDSYNFIQKGVIYGRAGKFNPYTMSLLFMIKER
FT                   QQHDPRILDQYIITYGRGTLMKLQSPFLKSLCYSCWDLMRVYDRYFAEKYDSIQTQDFK
FT                   RVFEAKEHNTISFNGEEFKFRNCPGTLKNLLFWKGKDMELIRDHIVSADESLRKEYYYG
FT                   NISNNLTDLEIEYNFRYPFKTRSKSKIDEIVTVLIDDTVSHLKLTCIEEYHLFNMVVIP
FT                   IIPFKGINIDERIEMEFRKSGTSHLNLLTNDLIENDLNPIRGVNSIHIPGILNDALNQV
FT                   PLNANATELSRAIRKKISEISPGRFPESQCNYDLINTKAIYLTFLSSCKFFNDIITLFN
FT                   NLPESHPSYVDIHYLLSNIDSWGFDESHNTKMCSIVNDRINSYMELCDKTSKAGKLRES
FT                   NRNNKSLLTKRICSIEWKNRFFFGFALREHYGPIPLNALSSSLLPRRRTIILNIEADHI
FT                   FNSVPLSMYENKFFYCTIKTNLFSSTFETIRKITIATRSTLKYVGNISSKNLNEIDKSD
FT                   LGNVLEVARNSTKVFQSQLSNLFEKLDNGGSTNNKLHYKIYKEYTNCILID"
FT                   /protein_id="XP_626650.1"
FT   gene            complement(<195603..>198251)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_660"
FT                   /db_xref="GeneID:3374142"
FT                   /locus_tag="cgd3_660"
FT   mRNA            complement(<195603..>198251)
FT                   /db_xref="GI:66358945"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_660"
FT                   /db_xref="GeneID:3374142"
FT                   /locus_tag="cgd3_660"
FT                   /transcript_id="XM_626651.1"
FT                   /product="hypothetical protein, signal peptide"
FT   CDS_pept        complement(195603..198251)
FT                   /locus_tag="cgd3_660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide"
FT                   /db_xref="GI:66358946"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_660"
FT                   /db_xref="GeneID:3374142"
FT                   /translation="MGKKLLSGLIVPFLVLFTAVEGAPDYSGIFDPTSLLSREKINDAL
FT                   VDSWDEPIDISKANVSTIFGDLLNSKTFSDYNSLFPLSPYNSVSNEYLIRCISAEGIVY
FT                   SPDICPNLDCEQYPISTDFKYYDKSSSSNIRLSLSKENVALGSAIYTFDTSAIPSITLI
FT                   NKFVVIFRTEDPKVNSKISVRLVSVTKKIEDGKETIPILRGSSFHSIEQNIIPGKTFYS
FT                   IDIVGLFSYLPNEFELSRISIMVLPSSPSTQVVLSMDVFAIARFYMAVDTIPIYEFGGI
FT                   GEKAIQQSKYIQVRTSSVFGRSIIDYNDKLKARFNDYCPKTFGGQCLVQITSLQSTNAI
FT                   GIFGFQLQLAGVVFAIKSAKIYIPISVFKSAEQVVTDIQISLLKPTFSITNLNYKEFRE
FT                   SFEKPINSISVPLSLESGIKTLIVDITRLFQKSPTLAIENVFISLSLPENYVGAIFTLN
FT                   KAKITYQFDPSETFQSMDHLNTQVFSNPNIASVETSFFDSNGKAVNYDSSLGFEDITQA
FT                   NKTSISGNSAFVSQFSIPFITTESLQEMNITIVEKLHASSENIDTSDSDSNSTSDSNSS
FT                   SNSNSSSNSGENGNQNENSLTETHKTLDYTLSIVKTLKTSTLTSSNDLTAISSKDFKLK
FT                   LGGTTRVDVLDLVKKAINESKLNLGLITFYGFPKSKDSSQDINLALPFMEIKWNPGSSL
FT                   SNGVISGGSFETKLKNLKLGELTKTNWSSTSTVATAKLNSVVLAAFDFSKVPCLNTITS
FT                   AKAKIEFSKFTANGEFEVFLMDKFDWNSSFTVEGQSFFDNPTQKYTTDKSIPPTLLAVP
FT                   FVVDRESSFEIDVSITNVIGSGGASLLKNPQLGVIAFSTNSNDSEMMVKSVEIDLKCSF
FT                   NDGVYYNTAIV"
FT                   /protein_id="XP_626651.1"
FT   gene            198832..198951
FT                   /db_xref="ApiDB_CryptoDB:cgd3_665"
FT                   /db_xref="GeneID:3374066"
FT                   /locus_tag="cgd3_665"
FT   rRNA            198832..198951
FT                   /db_xref="ApiDB_CryptoDB:cgd3_665"
FT                   /db_xref="GeneID:3374066"
FT                   /locus_tag="cgd3_665"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(199405..199524)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_666"
FT                   /db_xref="GeneID:3374067"
FT                   /locus_tag="cgd3_666"
FT   rRNA            complement(199405..199524)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_666"
FT                   /db_xref="GeneID:3374067"
FT                   /locus_tag="cgd3_666"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(200085..200204)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_667"
FT                   /db_xref="GeneID:3374068"
FT                   /locus_tag="cgd3_667"
FT   rRNA            complement(200085..200204)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_667"
FT                   /db_xref="GeneID:3374068"
FT                   /locus_tag="cgd3_667"
FT                   /product="5S ribosomal RNA"
FT   gene            <200540..>202288
FT                   /db_xref="ApiDB_CryptoDB:cgd3_670"
FT                   /db_xref="GeneID:3374141"
FT                   /locus_tag="cgd3_670"
FT   mRNA            <200540..>202288
FT                   /db_xref="GI:66358947"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_670"
FT                   /db_xref="GeneID:3374141"
FT                   /locus_tag="cgd3_670"
FT                   /transcript_id="XM_626652.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        200540..202288
FT                   /locus_tag="cgd3_670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with signal peptide, similar to glutathione
FT                   S-transferase; transcripts identified by EST"
FT                   /db_xref="GI:66358948"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_670"
FT                   /db_xref="GeneID:3374141"
FT                   /translation="MKNIIRYLFVFIAIFALNSYSTLAENNEEILKELDFCKYPEMYPG
FT                   IHLHFGYWDGFRGRGNLIRLVFELSQLPYIGHAFGGYNPEGAFDFTNWFGKHKSLISQI
FT                   DPSSTPNLPFLVDCSNTSKTKFMTETLDLMIYLARKFNPKLLGEGLAIPENQIMSASIT
FT                   ANNLFSGWVQHLMGKEGSIEAVLNSPDFFTDGDITGGPIITIFQVEEFVKSQVQQYDGP
FT                   LTFGSDATIPDIFIYEFANLINTLFPGIINEYPSIRGLVDAFNEIPLVTRFIHSERSVI
FT                   YPPLTSELLPFQYSMAFNPRRSFSSEIPRLGQYLVFYGHSESTSAASICLSHKVFSTSS
FT                   SNVDSEEFNEMYGLLQFPQIVDIATRVIGRNALVRTWYRVFRKLGSTKNRMKKSCVAIL
FT                   TSGKYHQVSISTEQAQEICSSFINCYTSRSTAWNATKTLIDASKRFNFFGGSTSVFNSE
FT                   RYFKKYITAPLLFAKAIRFYYTSKVMLKSGSFSKKSIVEILNETQKQGAVSTFGFTVNK
FT                   ELAIQICTDYCANKLPRKSLYSFKSSYSMQALCETSFMSYYPNESSELAVEKASTLVSL
FT                   LDQISN"
FT                   /protein_id="XP_626652.1"
FT   gene            complement(<202658..>203608)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_680"
FT                   /db_xref="GeneID:3373947"
FT                   /locus_tag="cgd3_680"
FT   mRNA            complement(join(<202658..202971,203026..>203608))
FT                   /db_xref="GI:126644431"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_680"
FT                   /db_xref="GeneID:3373947"
FT                   /locus_tag="cgd3_680"
FT                   /transcript_id="XM_001388056.1"
FT                   /product="cathepsin like thiol protease possibly membrane
FT                   associated, putative"
FT   CDS_pept        complement(join(202658..202971,203026..>203608))
FT                   /locus_tag="cgd3_680"
FT                   /gene_family="HOG000230773" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cathepsin like thiol protease possibly membrane
FT                   associated, putative"
FT                   /db_xref="GI:126644432"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_680"
FT                   /db_xref="GeneID:3373947"
FT                   /translation="CKKEFGIKVSKVNKKKKRKLIILNLILYSPFRIPESFDLRSNEAN
FT                   RKNGGSCITFPDNQGKCANCYNFSALSAIEGATCRQLGKRIPPLSQQHSLDCWLQSKGS
FT                   VKACSGGQTFEVFNYAIKSKVCTRDSYPSTTHKTGKLGECKSNCNECVGIKNFKWSYTG
FT                   SSILYEDPWDVITDAIYNYGPVTVSVCSLMPGFNLYSGGYYEPPTCGSIWCGTRQVDHA
FT                   VTLIGYGVSESGKRYYIMKNSWGLSWGNKGFMNISADMCSTFFNPGWVTSVSMDGISDY
FT                   CLNREPDKNEIAHDFVI"
FT                   /protein_id="XP_001388093.1"
FT   gene            <204904..>209664
FT                   /db_xref="ApiDB_CryptoDB:cgd3_690"
FT                   /db_xref="GeneID:3374140"
FT                   /locus_tag="cgd3_690"
FT   mRNA            <204904..>209664
FT                   /db_xref="GI:66358949"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_690"
FT                   /db_xref="GeneID:3374140"
FT                   /locus_tag="cgd3_690"
FT                   /transcript_id="XM_626653.1"
FT                   /product="ABC transporter"
FT   CDS_pept        204904..209664
FT                   /locus_tag="cgd3_690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter"
FT                   /db_xref="GI:66358950"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_690"
FT                   /db_xref="GeneID:3374140"
FT                   /translation="MDRLEFLYKNINEKQKWGHPKSAGLWSKLTLGWLDKYIQNASTGI
FT                   SHNPSEFPKILESDSTVLWANKLEKEIMKMNSNLNKCDDFNVNVFRAVFNVLRGTLFRI
FT                   LFGKILCEILGMFIADRLKLSLKMVEDFSKLDKNQDEYYNSRRNGISIAILIGFLQVLF
FT                   VILTTQVGYYICRLTVRIQGSVTHLLYRSVLSRGINRIEIIPDIKDSQREDTTSIYNSI
FT                   LIDTNIVVKVIVSLVDVLIIPFRMILVITMLTRTMGDSVLSRPAMFCIIFISLLITILE
FT                   ICLAFFKWTYLVRRDERMNLMDYTIHNLSSIKILGLESLFYWKINKSRINELKSRKSFI
FT                   IFQSISSVLYSTANLITQYTLFKTALICSVLYSLEIPPSKIVTSYYVIDMFSQRLADLP
FT                   LLISTIVEGNNSKIRMESVIRQVIARNLEIQESINRDAEFHNSVKELQNNGSFESNINF
FT                   NSNSIVDDGSVGEDFTSSSFNININEESGIQKARSVSDNTIVLIKNVELINELFEDRIN
FT                   INLFQVERSCLTVIEDHSSERLEIFVQAILGYNDYGCQVGPKISNCTDSIFYIRRISCL
FT                   PIFWCSHDPWIPSGTIRSIILCGSPMVKNLYKLALFSCDLNADIFSWKEKDLRFVDGKQ
FT                   GLSGGQIARIGLARAVYKYLYNSQFDSEFDHLFILDNCFRSIDVPVAVNIMLRLFTGEE
FT                   AVLQYANTILIISPILKEILFSKSVGTFSCSIREYKFGNDGITKGFTIFKNNINDMNVS
FT                   KYFGASNNNSSLTSIESQQSDDEEILRKKKSSPIQCSLNVSESEQHPLNYDYPYPSKTI
FT                   LPGNKLSSKSDCISESDLIKAIQSKEVLPLLEDINEMGSVSNKTYGSYLSSVNKITLLL
FT                   IFIGVLITVFGGILSQFGLTYFLDLICKTNNQGKDLDIIKGNAPMSVIPYGPSRNIDLR
FT                   KHVSRFVLDKFKGPLEYILGVQMNMNGQLSLNTNQLIGSFGLMLFIIIMGTFLTYVLEA
FT                   VACIQACKFFHNNLLYKILINSSIPTLMKISAGQVLNKFSTDVILIDWNTMRSFGRVTW
FT                   GFVSLVMNICLLIALAPWTLPIFLIMMGLILFKIFLPMISASRNLQRINLIAFSPICSI
FT                   MSSTLEGSRTIFLLKNSEYFEKTALNILEFMQRIRFLQHTSLIWCNTRIQFFILPISII
FT                   NSIFPYITPFALSSAENKMPNSIFLFYLKLLSQPITIAWGISKCLSLAENATCLMADYV
FT                   QLEKEMCSIERINDLMNFITQKDKERNYIHHEEDKIEKNMLLRLKNNSTRKSLFLNRDS
FT                   DHTNFKKTYHNIFVSLLSANDMSNHRNPVLSISNVFINYEIPDKGNLCTSSILKDISLK
FT                   AFNGEVVGLIGRTGSGKSSIFSSILKISPVISGTISLLGQPINSIPRHILRNKIGVIPQ
FT                   KMCILPNCTVRDVIDPFNQYSDNEVHSVLKICGIYKYVINTLNGINSQISLQNSHINIH
FT                   EEDQSKQKSLPLCLRSSRNSSKPPIFVISEIYLRYLYACRIILYSKNYNLILIDEPIIF
FT                   QDELSKNSSMNEQTIQIIDIISTYCSHSAVITISHDISIIKKCKRIYHLSDGILKEISF
FT                   VKTHSLS"
FT                   /protein_id="XP_626653.1"
FT   gene            <213618..>217580
FT                   /db_xref="ApiDB_CryptoDB:cgd3_710"
FT                   /db_xref="GeneID:3374139"
FT                   /locus_tag="cgd3_710"
FT   mRNA            <213618..>217580
FT                   /db_xref="GI:66358951"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_710"
FT                   /db_xref="GeneID:3374139"
FT                   /locus_tag="cgd3_710"
FT                   /transcript_id="XM_626654.1"
FT                   /product="large  hypothetical protein with signal peptide"
FT   CDS_pept        213618..217580
FT                   /locus_tag="cgd3_710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large  hypothetical protein with signal peptide"
FT                   /db_xref="GI:66358952"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_710"
FT                   /db_xref="GeneID:3374139"
FT                   /translation="METRFRTITCIIFLTIIRVLIFNAHVVACKDLHGNGKVTLKYPPY
FT                   SGLEEESFQIIEEKSLGDYFAIGETKLKSLFGIEGEDGIKIRVNEIEVERSELKHSISE
FT                   FKLAEDEDIVIELFLKDELDLQYRSRRVKDQMDGFGEKGENNFSKQEGILFLSFSSIDN
FT                   EELVSFSNVPKTVSVKEKLPMTVEELKKMIENFANPLEFSIESVTTVRNPEKELVTELM
FT                   NSKYQSKIADLENGDSIKVKIREITLNIGENNDEEMNYETNNFRKENLESSEGIQGNFP
FT                   VMIVFSNRREVPNNVINLNEDSSVGDLLERLYEVKYPGTGNTVISSGDRIAIQNEQGRE
FT                   VDQINELELKEFVPEGINVSKNRPFLIYVTVFGSNNENTKEEYNESSMRQDFSEIFEPR
FT                   NGKEIEELMFNIKDQVKAIESDLEGIQDKKRGSDAPIVRFVNQEGNLEYEIKGDPSLIT
FT                   IASLYSQAQLVWNSRGKNERNCVLIYGNDDMILDPNNHETLSTLKGYFQGMRITMREPR
FT                   KVNAEITAYLSIGKEMGNNQLDTKIAFTRNLEVPEIISVIDFLKMIYSNYNSELSKYLI
FT                   VGIQKDIGNERLTEYLPVPKTPSSITYLTFQSKRSDLNVLLEVIPAKSIEIMLMIPPNS
FT                   AGEDLSEKTEDSDSNDEFLLEYRLKILSNTTIRELIESLIENKVLDKSISPKTVQIKDK
FT                   ETNTYLNSNYIIGHHLSEKANRRKKGLNKKIFVVEIIKKLNLNVMFYNYKGEELQIEPF
FT                   QVKVKSNQSIKKLKEDIVSIGVKNGFSVNIAQIGLGSGFDIGKEFKKIVYTILKDSDQV
FT                   QNSGFVQNDDLRVYVLKESQEEPENKEEFGNENQVKFENMESDQGPKLEIPLSIENCPL
FT                   NTMLERRWFIVPMSLGLPIGELKELIDNIAMLRGMDFDLFGETEKGKMELSEESKSCLS
FT                   LGITELGNLTAICNGKKSNRDVKKEEFNKSVSQAIFDDICEDDGNSDKCSKPTGEVLDK
FT                   ISNYKKDQVDIIFEESSDEEFSDEEIKEREERNRKSMELLEKIEKKIEQMEEEELKSKK
FT                   NKKMMDKLIKKEALAYSKNNLKEKELVKLLRDFLSAYATKGTAGLARFCKKQGSDKIEQ
FT                   LVAYISTKEGRKMSRKLAKKIVEREKRRNRGKINSRRVIPTGRNLLLNVEYSVMPKIAQ
FT                   YSEFDEDSSSIYTSESESSNLSQSEDEESQSIHHVRNSSKKRKKSSKINDESLEKNYLN
FT                   GDLDTVTNIQKSKKKSKIIKAFKKIPVISPTISFLYSHLSNRGKKKRKAKKYIKTIRKL
FT                   EIQFRRKAYGHFQEKEYQKGNELSQDDDQFMYLMSY"
FT                   /protein_id="XP_626654.1"
FT   gene            <218067..>253157
FT                   /db_xref="ApiDB_CryptoDB:cgd3_720"
FT                   /db_xref="GeneID:3374138"
FT                   /locus_tag="cgd3_720"
FT   mRNA            <218067..>253157
FT                   /db_xref="GI:66358953"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_720"
FT                   /db_xref="GeneID:3374138"
FT                   /locus_tag="cgd3_720"
FT                   /transcript_id="XM_626655.1"
FT                   /product="very large probable mucin, 11700 aa long protein
FT                   with signal peptide and pronounced Thr repeat (308 aa
FT                   long)"
FT   CDS_pept        218067..253157
FT                   /locus_tag="cgd3_720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="very large probable mucin, 11700 aa long protein
FT                   with signal peptide and pronounced Thr repeat (308 aa
FT                   long)"
FT                   /db_xref="GI:66358954"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_720"
FT                   /db_xref="GeneID:3374138"
FT                   /translation="MIMTKWVYNVFLILFFQAFLVVLASTEFESFKLGRVEPQKLKIIS
FT                   KTTTLNDYGSLGVYSFKNSKDEVVMKSILFPNYAVLFDEDRRQFCSGKYSADSHTYSAG
FT                   DQIPFFLNYWTDKYTYRYWVLESDQGVICMLPYTLETNFTKVITEVDSDFQFELAPTYE
FT                   PNNTNSIIQQTPLFDYSQSCTLSLFQGCFSSEFVLSLPDSSFTSGLEFVVRGFSEFRTY
FT                   KGVFSELIFHDKTASNAKILHIIINPDMIGIHLVGTGDQIWGKLKHQVEIGNMKFNYDF
FT                   RIIIKEKWIYITSPQGQTLVSSKLPDNFSNVGKIVSPQRSVSDPTFIQVLLASNTEISK
FT                   DFIQSEAFCLLSMSPFTSQVENILGFSQEVLFTENYHLDISLDIQSFDSIQEEDLLLGI
FT                   SFDELLIDPANLEIQRTSHLTDPKLRIGLFKGYISLEEMQSRTIITGSYQASINSKVTI
FT                   QIQPISSENKLRILYKIDQSNWFRLTEVSGELNRLFNKIKFEKNSKHSEILSYTIKGEA
FT                   DASSLATTYTDSTPFISPTSDNLCKLMPLSYCNSQDVSFVIEDLTQVEGKDQAMEEETS
FT                   KVESLMSINNVTIQIPNFPTSNNDLMYKWRLLSNDISVYEISVFQTSISITNLISYETI
FT                   TGPPMSIISQYSENLGISIIFQTTKIFIVDSGTNNIIASISKSKNLNINKIQTSYEKKI
FT                   SVNYYSSYSFTPGPKTTSTESTILNVLFECQFFNQCNYGNYVCQGSSARQLCKDPEIMK
FT                   LWYSGPLISTDTSLSLGVFPNSLSVFTIGSQNKNLFLINVFERYISLSDPFSGRSCYNE
FT                   LPNNIVLNQNSYVKFGVIVSNGKRVDLVYFSGNDTPNLLCSISIQGRFISDFYFFESNG
FT                   QGLSSTIGDITMNTELEDLSGQITTISPPAESNSNSLVPFKPSNQLDLELSSELKANMG
FT                   VHFDVNLDPNSDSALVIGVSILNRYQDIHTHLYISGGSYPSVILSSNIPGVGTLTNYSS
FT                   IPDECTSVRNSLLNGGNVQFTIGVDIETFVKYNLGVKEEIKIPYLYVVLCDQSLAKVPM
FT                   GGLNIYKLLISNRSIISTSTTLVNGFYANRSTSRIRDLSAVPLESDDSISGYKEGCEIN
FT                   QDLGVTSYCLSSSLKIEGDSGLNENYELTVYLTIQDFPQFKYRNSTYFNGISYQVGGMS
FT                   SFVVLFNETHLGILNLIEEREIWNLYGGDALMPVSSWISISVNRISGFIYFTLNDQIFA
FT                   SFPDYPSQHISIQEISLLQPGSWSVFQGVKQDSIYESNRYPFIYHGFIECSFGDECQPT
FT                   KEQTCFGNSFSGLCPYPNPDEIVWLFNAFPEIPTEVNNGTFGSSFELPELVHAYKLNDG
FT                   FFDIFAFYFFKDYAAIQYLLDGTVCRNSYNVQNGGSTSLDSVPSNFQWGFYLGDGTINL
FT                   VTDLGGNGIKKICSLNIPENIDLRLNVVYPVGHFLGIIEANKKNKNDLTITDAPPEQDT
FT                   GNNPCMLEMFKKCKINDQVQLFPDETYFKSNYVFELSFVYDESREYNIVFKGQTNGLLS
FT                   LYPVSKKQTDLIKLSILGKSLQLSNSNSDISMADILIENAESGVTTFSLFVYLSSKGDT
FT                   FNLVSSLDLETENTNSRLRNLVEGYKGVSVSLNGKISEISIDKVNESNPTVYLNNWIIE
FT                   ADSLKPSSKHLTCKLEEVDPGSWCVGLNATYNQVDSDSKLIWLNFTLSKDLQGDPNTFE
FT                   YLDSYILKKENNKDLIELKFGSKEFQIKDLINDETSFSYYTNKTILKSGEIFKLGIGVL
FT                   EESPDKIYFCDEYSNVLLRIPFPSSEISGSNFIINSKKEIFSSFMVDSKPLSINETLID
FT                   GYNSCSFESNCGLETLTCTGQILEYPCPRSTPGLNWMISSKLVDTGLSSGEWGNEFAIN
FT                   NILSSFIIFGDLQIKFLVHFFRNRVVLLDPSHGLSCSGPYISNQAVTEGDSVDWTIGLD
FT                   SNHMVFLGLFDSNSKKHFTVCGFKNFGEDIPFVAVIPVGSKPGLNIFKQFGRGFPTGGY
FT                   ESTSNSKDNNGFYHPNLDTSTQEYTPLIPYGQNAPFLPVGVPVTDDQGLVVPPGFYFNK
FT                   TTSQYEPLGSAEDSNSLRPPVPFQLVQGIEECELEIYSFCNSTKVTMESLMTNLDKKDW
FT                   TLFAMVSTGIPTYTPDSSPNFNFQFKFKDKQDQIKFSIDISNSSIVISGSDSSQIAEAV
FT                   SPQCGPYCSTYPKGYFTFWLQKKFSENKFVVGVNYNNLLLVEFDSDNRDFTKIDTGGDP
FT                   GATLSPSKTYVLWNLLDISNPPKQSATTTTTKTPWDQDIKDECHLELDQPCRGNDSILD
FT                   KPLNQGDIVWINTLLGKSDQPIEVDGKNYWFEYKFQKESDSVISLLFNETSVAIYFYDR
FT                   AETLSSKYTNQHLLYEGMDITLGITSNRFGFFLVNKDLNALIHDPSLKILDYNKILQES
FT                   VPNHISNFLLEEGFTYPKNILFRGYETCTLYGDCKTVSKSCESQVLIEMCNPIQAGTEI
FT                   SIQTSISQTNINNGTWGAPLIQSDLINIFHIGNEDKDVYTVYIYTNRMVLEDMVNFISC
FT                   GGPYPGGKTLSSSSNLEWSIALDSKKFLYLNVLDEENTEMKTICSMSLIGGIHSLDYIS
FT                   PSGFKPNNSVFTQKINSFKQGGYKSTSDVNLGYYFPIYDNSKNEFFPDLVYGDSFPFYP
FT                   PGVHPAPIVGDQLNTPPNYHYNTTTGQFEKNEDHSDPDEINPFQPNHIVNGISECNLDL
FT                   FTTCNASSIKIMPEDITFKEFWTLFVISSTGIPNKGSESDPSNYKYEFMKTDTGVEELV
FT                   LSLTISNETVILKNEKTNEEEVVGSPQCGPYCSTYPKGYFAFWLTLDSINKKYIVSIEN
FT                   NSKKLVEINSEGADFNQVKPCKSCQGTPDSEMYSIWKLFNSKIQPTEVATTTTTTTKTP
FT                   WQDQIIENCIVSYDSDPCKGTNVEIDPELQEGDILWINTTLQISDPKVEINGKSYWQGI
FT                   QLKKDDKKVFSILFDELFISINIEDSGNEYFSPYTNQTLGYSGREISIGIGKSKYGYFI
FT                   LNEILGSLITLNANGLDLSFNKASPLSSHDIVSKFELQKGFVLPANQLFIGYETCSLND
FT                   DCSLETTSCNSQVVKGLCPSPSNTRIWTIEVEISKTNINNGTWGESLVMDELMNIYFLS
FT                   SSSEILYNVLFFENRVVIEDADTQVTCSGAYPGGVSISYGEKFIWSFGVNENSRMIYFN
FT                   SAPKDNPNKLNTICSMPYMGKRSQITTVYPLGYAPSKALFTQKKDGLPTGGFETTSIPN
FT                   NGFYFPDKNDDTGIFEPQNKYGQSYEEFPLGLKPAPIDGDESNTPPGYHYNTTTGQFEK
FT                   NEDHSDPDEINPFQPTHIVDGISECNLYLFSTCNGTSAKIMPEDATFNEGWTLFVILST
FT                   GVPEYGDNSNNIAFNYKYNFVKSDSTKIDNVVLSLSFTNSTVTFKNEKTSTESVVGSPQ
FT                   CGPYCSTYPKGYFAFWLTYDSATSKYIISVENNTKKLVEIEAEITGSDDDPIFNKITPM
FT                   IDGNSGAGVEISKTFSVWHLFNKKIINNVVATTTTTSTTSTTTEQPWHEIELEECPLEF
FT                   KKPCKGHNAIIKDSQFNKGNLIWISMKTVKSTPEIELAPNKYWHGFSFYNKQNEKVLSI
FT                   LFNETHLLLEDKESGMDFTSRYTNSSLNYVGETITIGLGWSRLGLFLINENKDSFIEVK
FT                   NNLDYTFVKIVHDSTQKSSSNYYLEENFLYPNIFLFKGYETCGLYEECSTSPVNCYSQV
FT                   LTEICPKKVPGMYWTFENIIHETNVNNGTWGSEFILDGLLNVYLINDGDSDIATIYFFN
FT                   NRMVLLDSKNKVACSGPYPNNHIISVSDKIKWSIGFGKNYLLYLNVYDLNNNNKEYSVC
FT                   TIQYGSGFFNIEYVYPLGYAPSMSKFNQYKDGFPNGGYESTSDPTNSNGDFYYPDKDEN
FT                   TGEIKPEDKYGVSYPFFPPGIKPAPIDGDENNTPPGYHYNTTTGQFEKDEDNTNLDEIN
FT                   PFQPNHIVDGISECELYLFSTCNGTSAKIMPEDATFNEGWTLFVILSTGVPEYGDNSNN
FT                   ILFNYKYNFIKTDSANSDDIILSLSFTNNTVTFKNEKTSTESVVGSPQCGPYCSTYPKG
FT                   YFAFWLTYDSATSKYIISVENNTKKLVEIEADITGNLVFNKITPVIDTNGVGVEVSKTF
FT                   SIWQLTNIKEIPADTATTTTTTTTTTTTTTTTTTSTTSTTTEQPWYEIELDECPVKLEK
FT                   PCRGLDAVINDPEFQLGNLLWIQLKMEVSNPLIEENGRKYWMGYNFHKDTKEVMKIRLN
FT                   ETHILLQDQLNNKDYSSPLTNSSLGYIERELTIGIGWSRLGLFIINDDHNSYIDIKGRD
FT                   DYSFNKIEQILVPDKKASNYILEDSFLYPINIMYLGYETCSLFSDCSQNIVHCGSQVLK
FT                   EICTKRIPNMEWTFEGLNAETNVNNGTWGEELKMDELMNLYIVNSGEEEKNIFGIYIFK
FT                   NRMALQDFENFQSCSGIYPKGKNLSFGDKMKWSLGLDSDNLVYLNYIDIDDNTKYTVCV
FT                   LKHNPGFTRVKYIHPLGYSPSYMIMTQTKNGLDEGGYLPSSTPNTGFYNPEKDDNGIYK
FT                   PSEKYGESYPFFPPGVQPAPIDGDENNTPPNYHYNTTTGQFEKNEDHPNPDEINPFQPN
FT                   HIVDGISECDLYLFSTCNGTSAKIMPEDATFNEGWTLFVILSTGVPEYGDNSNNIAFNY
FT                   KYNFIKSYSTGSDDLVLSLSFTNNTVTLKNEKTSTESVVGSPQCGPYCSTYPKGYFAFW
FT                   LTYDSVTSKYIISVENNSKKLVEIEADITSDSVFNKITPVIDTNGGAGVDISKTFSIWQ
FT                   LTNIKEIPIDTATTTTTTTTSTTSTTTEQPWFEKDHDECPLELNKPCRGKDGNLDSPFE
FT                   KGQMVWLNRTVSISNPNLDFENGKYWFGFRFEDENNNKLLSLYFNESFITVVDWRQDLK
FT                   YITPYTNESLSYSGREENIGVGWSKMGLFILNEDLNSLVELQTDLDFGFKKIIQESNPQ
FT                   VPIKYILEEGFFYPNNILFIGYETCSLRNECRLDSTSCNSQVLKDTCDKRIDEMSWTFE
FT                   TSFSETNVNNGTWSQDLVIPDLLGVYLINNGHIDISIIYLFKNRLVLKGLILDEVCSGP
FT                   YPGNQIKQIGDKITWSLAIDSNDLLYLNIIDDSDPKNKEYYTICPISYDNRFGRFKYIY
FT                   PLGHAPSKVTFTQDLKGFPQGGYDSTSDPTNSNGGFYYPDKDENTGEIKPEDKYGESYP
FT                   FFPPGIKPAPIDGDESNTPPGYHYNTTTGQFEKDEDNTNLDEINPFQPNHIVDGISECD
FT                   LYLFSTCNATSAKIMPEDVTFKEGWTLFVILSTGVPDYDETKYNGFNYKYEFKKSDNSN
FT                   GGLEETVLSLEYSNDTVTFKNLKTNEEEVVGSPQCGPYCSTYPKGYFAFWLTYEPIRKM
FT                   YSIGIENNSKYLMEIKAEDNVVFNKIVPCCGDMVDKSYNIWQLTDSVSIPKSQATTTTT
FT                   TTTTTSTASTESTTTTKTPWEDVELDDCPLDMSSPCKGINSTLTIPDKFEEGNFIWINS
FT                   SIADHGKTININNIEMTKIYHFKDNNQDEILILGFNMTHLTLIDNQSSKVYSSYYTNQT
FT                   TSFPTKSFSIGIGWSRLGLFILNEYGDGLIQLKSDKKYEFVKIEQAQVLETLTIYEWSN
FT                   KFIYPREMLFLGYSICSAYNDCTDDNSLSCSAQAFGDLCNRRKTNISWDIEFKVTETYV
FT                   NNGTWGNEFELPGLVNIYFVSNDHQNILSIYFFQSYLALRDLENQNICSGPYPESMNIS
FT                   QDDKINWSLNIGHSGEIYLNIESWKGSNKGTKFTICMIGGGSNGKNKYIQDVKYIHPLG
FT                   YSPSFNKYTQINSLLIPNGGYESTSDPTNNNGGFYYPDKDENTGEIKPEDKYGESYPFF
FT                   PPGIKPAPIDGDENNTPPNYHYNTTTGQFEKNEDHPNLDEINPFQPTHIVDGISECDLY
FT                   LFSTCNATSAKIMPEDTTFNEDWTLFVILSTGVPEYGDNSNNILFNYKYNFVKSDSTSS
FT                   DDLVLSLSFTNNTVTLKNEKTNVEIVVGSPQCGPYCSTYPKGYFAFWLTYDSITNKYII
FT                   SVENNTKKLVEIEADITSDSVFNKIIPVIDTNGGAGVDISKTFSIWQLTNIKEIPIDTA
FT                   TTTTTTTTTTTSTTTTTTTTTTTTTTTTTTTTSTTSTTTERPWYEIELDECPLELNKPC
FT                   RGINGKLDKPFNHGNLLWINGTLGKDINGRLLLDDTNLMGYDIMNDNKKIMTLLLNETF
FT                   IGVYDLTKDQEYYSYYTNESLAYNGMDFKIGIGWSKLGLFILNEYSSSLIEIQTHSDYK
FT                   FNKVLLRGPTMDKYVNYILLDNFLYPNGILYLGYDTCTFNGECNVKSLECSSQVLEGLC
FT                   LKKLPGITWKMETILAQTNVNNGTWGFDYSINGLINLYTLNNGIEDVLVIYFFNNRVAL
FT                   QDLINSNSCSGPYPENSQVNVGDLIKWSIGIDSLMNLYLNILDDNVTGKNYTVCYIKNL
FT                   NQFGGGFKYLSPLGYRPNYSRFIQEISPKFQDGGYESTSKPDNGYYFPEKDVNTGQYNP
FT                   DDKYGENSYPFFPPGVQPAPIDGDENNTPPNYHYNTTTGQFEKNEDHPNPDEINPFQPN
FT                   HIVDGISECDLYLFSTCNATSTKFMPDGTIFKQGWTLFVMINTGVPDYDPNNVNNNYNY
FT                   RYEFISSTNSNTGGGTLSDKLILSLEYNNETVTFRNEITGEEDVVGSPQCGPYCSTYPK
FT                   GYFAFWLTYDSKYNYFIISVNSNNDYLTSISADNTDMIFNKIIPRGNNVNNSYNIWHLN
FT                   SQNRLPVSIATTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTTTTTTT
FT                   TTSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTNPPWDQIVQDNCELEPNNQPCKGFNSTIPSIVNQGNLFWIDSN
FT                   IAYYSPKNYNIRKLYFTENNNPISNDGYYWMGYNFMKDNDPVFTLLFNETYLTIKDWKG
FT                   KQEYYSPYTNEKLAYNNMNFTIGIGLSRLGLYLMNSKLQSLIQIQPQYDYSFNHVKQLL
FT                   YDNQVITNYLLQDGFLYPNTLLYEGYEKCSLYNNCLSNKLECNSQVLTGICSTLSPGLN
FT                   LEFETEIKSTNLNNGTWGEIFKQSDLLNTYIISSNNEDQYIIYIYSNRIAIQDLNNYIS
FT                   CSGPYPNGNLIHIGSKLIWKIGFDSYYSIYLNVYDQINHEYYSICQLKPVIHHITSLDL
FT                   INTAITTTTNNNNNNNNNNKNNTSNTFGIDSIDYIYTRGYNPSNTKFIQYINNFPRGGY
FT                   KSSSSSNSNPNLVTSYYYPYFDKSINEFNPLYNYGKNYAFYPPGIKPAPIIGNYHTTPT
FT                   NYHYNTTTGQFEKNEDHPNPDEINPFQPNHIVDGISECDLYLFSTCNATSAKIMPEDTI
FT                   FKQDWTLFVIISTGIPEYDNNSNNIDLYNYKYDFVNFDKDTGNEEIILSLLLRNETVTL
FT                   KNHITNIEKTVGSPQCGPYCSTYPKGYFAFWLTYDEDNDLYEISINSNTEILLKLPASK
FT                   QKFNKIISRSSSNTNTNPNPNPNNTTFNVWYLTNVKQTPKSISTTTTTTTTPPWDKVEK
FT                   EVCDLSEIFMPCQGYNATIDPYINLGDLISMKFIIEKECNCINKINHLGNNYWLGFDFN
FT                   HNDDKILSIFLNESFILMYDWKNHQEYISPFTNESLSYDHMDLEILIGWSRLGLFLMDN
FT                   NHNGLIHIQNIPDNKINKIKQHSNEQKTLIRFELINKQFLYPNEILYQGYHTCSFYNDC
FT                   STEIISCSSQALIDTCNKPHPGMNWIIDTDISETNVNNGTWGSKLEFPTLINLFKVNNL
FT                   TDDIYTIYIFNNRISIQDEHNKISCDGYYPNFKKLNINGDHLTWSLGIDHSYLLYLNIH
FT                   DINNGKNYTVCVLPMDISSGALSIIYPKGYSPLKSNFTQQIFGFPNGGYEKSTSIGFYD
FT                   PNYNSSLGIFEPNKIYKKINSFFPVGINPAPIFGDYHNTPPGYFYNTTSGLFEIEDPTI
FT                   IKQDQINPYQPREFIKGISECDLELLSVCNSSSIIIKDNLIFKQDWTLFVMVSTGIPEY
FT                   EDNSNNIDLYNYKYDFINYDKDTGNEELILSLKLYNDSIIFRNEKTGDASIAGSPQCGP
FT                   YCSTYPKGFFTFWLTYNNDSKKYLISVNSNKEHLVEVSGYKSFFNKVKGEIRSNNNHIN
FT                   INTYSIWQLTNIVDNPISISTTTTTTTSPPWDSITFDNCNLEINIPCKGYAATIKDELK
FT                   MGNIIWISTKVHNGNIGITNFNNEEKYWIGINLKSSSSESLMNLYFNETFITLIDDLQG
FT                   RQYISRYTEEILIYEGFELTIGIAWSKFGVFILNEKMNSLITFQTHQEYPISKILPLHG
FT                   SRRQIYHFLFSGGFLFPGNTLYEGYTTCSLYKDCDSTSTGCSAQTLTNPCSKSQPGISW
FT                   VIESEILDTKVNNGTWGSDLELNNLLNVYLVNNGIEDTLAIYFFNNRLALQDLKENIVC
FT                   NGPYPKDISQNFGSVLNWILSVDENQMLYLNIKQKDQSIFSVCVIPFGDHLKPIRYIYP
FT                   RGYAPSTSNFTQILNSIPKGGFEPTSNNSKSGFYRPIFNSTSGLYNNDQYISLKNDDGS
FT                   IGKPFLPVGIHSAPYFGTSENTPPGYHYNSTTSQFEKNEDHPNPDEINPFQPNHIVDGI
FT                   SECDLFMFDTCNATSAQIMPEDTTFKQGWTLFILISTGIPIRDPNNVNNNDIHHQQEPN
FT                   IRFDFINVEIGGNNQQTLVLSLELFNDTVILRNEKTGDSSIAGSPQCGPYCSTYPKGYF
FT                   AFWLTYDPEIHVYTVSVDYNQQKLVSINSANMKFNLIKPICYNGSQNNNCNNVFNIFQL
FT                   TNKQKIPRSLSTTTTTTTAIPWFSQVLDECKLNIDIPCRGIHASIDNNNIPFSQGNILW
FT                   FNTTIISSKDKIHGLDSSTLYWFGYQFLFDSNPIFSLLFNETFVTFTDLISRIEYSSKY
FT                   TNESLVYPGMEMIFGIGWSRLGIFVVNSRNEALIQINTLTDITFNQISLYGSETIPTNF
FT                   FLTNDFVFPKQILYKGYESCSFFEDCPMNATCKSQSLTGICNRKDPGSYYQIETVIKET
FT                   FLTNSTWGHRLELNSLLAEFVINGGDFEEDLLAIYIFENRIAMQDLKHNVVCSGPYPKD
FT                   SIIDYGDTLKWSIGFDISNQMYLNVHNFKNIDGNFTICTLSTGIQNSDFLYLYPQGYAP
FT                   KPSTFKEFKNGFPKGGFQSSVSNSSLNGYYKPAYNSSTQEYDPELTYGINHPHFPPGIQ
FT                   AAPLNGSLINTPSGYYYNTATGLFEKYPNNTNIGINPFQPKELIEGLSECSLHMFDICN
FT                   STSISLKPKDTFFKQGWTLFVMLNNGIPTSVSEKNDFNYKYEFFNSKQGNKVVLSLYYN
FT                   NETVVFRNEVSGEFSVAGSPQCGPYCSTYPNGFFTFWLSYDYSSNNYIISVSSNQKYLL
FT                   HLDAHGAKFDHIKPCCGSEINNSFSLWQLSNTVIYPLRISSTTTTTTLPPWFETIYDEC
FT                   QLQTSSTTSFSQPCRGHSASLVDEDFSYGYLISLNFTLSRVLVNGANNVLSPILPISTT
FT                   TTTTTTTITTNTITNSKRMNLVSSTKANSNLKYIWNGFEFKDKNDQPVLSLKFNETTIT
FT                   LYDHKDDLEYISPYTNESTAYSGRFESLSLGWSRLGLFLMNSDFNSLIKIPTRNNFEFN
FT                   KITKLVHDNIPLNFTLKQDFMYPNEILFQGYHSCSLFNDCKSKSTSCESQVVSETCNRN
FT                   MNKTQWIIETNITDTQINNGTWGPNFELTELLSAFNINNGLEDVLSIYIFNQRIAIQNH
FT                   IGHSICDGIYPESRSLNIGDTIVWSIGVDDNKLLYLNVMNENKSKFYSVCTLKYNEDFN
FT                   YFKFIYPRGYSPSRSIFTQKIGDFPNGGFESSNPTEGNNGFYRPDLNNETGLYEPEKKY
FT                   NSSFPFFPVGIIPAPISGNYHNTPSGYYYNKTSNLFVKYPNNTSNELHPYQFQELSPGT
FT                   KECDLYILSICNSTIVNLKPTGSLFQSGWTLFASINTGIPESEQISSSSTNTGTYNYGF
FT                   QFINTFTSKIVLSINLYDDFTEIKNEITGEKAVSVSPQCGPLCSTYKGGYFTFWMSYDS
FT                   LNEEISISINRNRQILLKLRNAQAVSSFDRIQPCCSNSVMNSFSLWQLSNVAHIPQIEA
FT                   TTTTTTTSPPWQDSVHNECLLVENIHCKGFNATLKDPPVFHHENILWMNFKLPTQNCNS
FT                   PFNLNEKFWYGYFFTNKDKAVLSILFNETLISLYDWKNQQEFYSPYTDGSLVYQGQNLT
FT                   IGLGWSRLGFFLLNKDSESLINIKSMTDFSFDKVSNHGESLNPSIFLLKSGFLYPNEVL
FT                   VHGYRECSFFENCVSNSLSCNSQVLSQICSNPTAGMSWEIETEIMNTQVNNGTWGKRFE
FT                   SQDIMNVFALSPNGKLVSFVNSNTNGNLEDPGFIYILKDRLVLQNHLGSVCSGPLPGAK
FT                   EVNFGDKIKLSIGIDSMSMLYLNVFNEDDNEYNTVCTIGKIENGWRFKYIFPIGHSPSV
FT                   SSFVQIKLGFPDGGFKPTSTEPDSLYNPPYDKTTKTYHPELKYFNSYLYFPSSIVPAPI
FT                   DGNEANTPPGYFYNRTSSLFEKEQVSQNPEINPYAPEYIKKGVDICDLSLFSVCNSTGV
FT                   DLKPDNTFFNSDWTLMVMMSTGNPETQEIPGENNLKRQNYRYEFFNSNTNSLILSITYS
FT                   DSLVSLTNEQNGITVYSSSPQCGPFCSTYTNGFFTFWVTYSKIKSSYTITVNRNKEKLL
FT                   FLNGIDESFNQIRGKSLSSKTSYTLWQFINVSRDPVGISTTTTTTTTTTTTSTTTTTST
FT                   STPGLDNTSSSTTTLPPDLSGGCKLSIGTACTGGFGYFDKTNDSTWKEGVYVTIRFKFP
FT                   KIVKKRFTYYLDSSLRTLSSQTVFSLTLINKDLNVGSILFEPNKLKAVLNETSITTQYS
FT                   NGRIYSEGDDIEITLLKINGLFYIMDSNGLAMIEYPSLLISEDEIKSKLNFTFTDIYPS
FT                   IPTRLIFSVQNYQGYPFVLLNGYLHSTLTNYCGVDQTTIVNQAAKGVCNYPRKGMEWDI
FT                   YTKTVNTKLNSGYYGDLYDNEELISAYNINNGTHNTLGFLFYKKFVVLINLITHEQCSG
FT                   IHPDSEILKFGMDHDWSIGYNGNSIFLNEGKLSKNYNKFTICTLPLSREMLPFKYLIPV
FT                   GESPYSKMRVTQFGRGFPENGYPITEKNNEVPINGVLMAQILITNFDYFVQKQIADERF
FT                   KEFKELFISSIKSSYGPKNKHVGIVSLTPRNVQVNKVGNTALQTAKGDILVTFYMHSQV
FT                   GQKLADFSLEMSIKVIFNPTSLFGQIFEWSQLNFLTSGASPPIEKVINNTSCMGIYKKK
FT                   TELETIVNKYGYYSDLVTEYLPESVVGYFSFNHIIPNVPTFDDHQRFVLSFKKRLGELL
FT                   EIDYKSIGVIAVADTPIENGVLGYGVLSFYINSNSLELSTALVEQLSIRLSNPNNVFTK
FT                   NMDWKQIEVGYCNRPKFYMYQHDRRDGRRFNHYSLDNINLNDENDPFYISSDNENIDNQ
FT                   NEYEDIDNSEEISQGLDEFINSFSHHNN"
FT                   /protein_id="XP_626655.1"
FT   gene            <254389..>255648
FT                   /db_xref="ApiDB_CryptoDB:cgd3_730"
FT                   /db_xref="GeneID:3374137"
FT                   /locus_tag="cgd3_730"
FT   mRNA            <254389..>255648
FT                   /db_xref="GI:66358955"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_730"
FT                   /db_xref="GeneID:3374137"
FT                   /locus_tag="cgd3_730"
FT                   /transcript_id="XM_626656.1"
FT                   /product="conserved expressed protein"
FT   CDS_pept        254389..255648
FT                   /locus_tag="cgd3_730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved expressed protein"
FT                   /db_xref="GI:66358956"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_730"
FT                   /db_xref="GeneID:3374137"
FT                   /translation="MDLKLEFLNKTENRTTGCSVQCIFGKIILLIVSIILLLGLLVWIF
FT                   QEKLLFFPNINGKRDLASNFPGYRHPNENKMNSEDVVLTTDDNVKLYCWFIIHKKFDRY
FT                   SHGQSSAMHFSSNLTEPHHSEQVKKDGPEKKILDRIRKAPKYMKFHFPEFSDRYEQQEK
FT                   APTIVFFHGNAGNIGHRLPRFLEFYNLIGVNIFAVSYRGYGDSEGTPSEEGFYLDAKAS
FT                   LEYVLSRTDVVDKNMIFLYGHSIGGAVAIDLASKYNVTGVILENTFTNIKSVAFRVYPI
FT                   FKYFGFFFKFIQRLKFDSVSKISRVKSPILFVVGNEDEIIPPTHSVELYMKAGSPKSLK
FT                   KIYLVSGGSHNDTWIKGGMEFYLMLLQFIYNAIDYSKPELEVSSNNLINKSQEETLSSI
FT                   QEILKTKESSPINKLRKKTN"
FT                   /protein_id="XP_626656.1"
FT   gene            complement(<255929..>256984)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_740"
FT                   /db_xref="GeneID:3374136"
FT                   /locus_tag="cgd3_740"
FT   mRNA            complement(<255929..>256984)
FT                   /db_xref="GI:66358957"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_740"
FT                   /db_xref="GeneID:3374136"
FT                   /locus_tag="cgd3_740"
FT                   /transcript_id="XM_626657.1"
FT                   /product="hypothetical protein with 7 transmembrane
FT                   domains"
FT   CDS_pept        complement(255929..256984)
FT                   /locus_tag="cgd3_740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 7 transmembrane
FT                   domains"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66358958"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_740"
FT                   /db_xref="GeneID:3374136"
FT                   /translation="MIGNNDVLGILGTKPLNNLIKDNLFLENEQFNESLSDYWKSFLWE
FT                   FQFSRLYFKLARGDCRIIFSNSWLPYVNHSKVLLFRLFCLVFFCTIILYDIFTEIKIWR
FT                   IENLARYYTTNWCSIATIGYFLVLSIVSIQAQNLVSSSIDDNIYGKNIAEIEDIIGKAS
FT                   YLNWTCWYAWMIQSFLLPTGLIVNIGYWMVSHPNTSVTLILAIAKHAIASILVFWDCYS
FT                   TYQPFFLLHGLYLYAYIIGILLAIGAINLFPNSFLSLLPISINGLYTFFNFNDENHIKI
FT                   APSLLIFIFTLFYPLLLIFLWFLFREKNLLVDPLPNNNLISSSESKCEIMKAETSEKVA
FT                   LISNDEQLEKV"
FT                   /protein_id="XP_626657.1"
FT   gene            complement(<257380..>257964)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_750"
FT                   /db_xref="GeneID:3374135"
FT                   /locus_tag="cgd3_750"
FT   mRNA            complement(<257380..>257964)
FT                   /db_xref="GI:66358959"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_750"
FT                   /db_xref="GeneID:3374135"
FT                   /locus_tag="cgd3_750"
FT                   /transcript_id="XM_626658.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(257380..257964)
FT                   /locus_tag="cgd3_750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66358960"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_750"
FT                   /db_xref="GeneID:3374135"
FT                   /translation="MNKRKERSEGVEVSCHEQLMGGNFDIYGFGDKRRNLNEYYNGRQV
FT                   LGFIGDICEKENSVLAPTASLGTGNEITEAGVGSENVLGTRTVSGTEVEGRRLQDLESA
FT                   EEQQSYGQLVKKYESLQNSHTTLQKVVKSLLDKLSQLNELCSQKDRELSEYKVQLKKLV
FT                   DANETLNMYIQSSHSSIMSNSMINKFGSDIY"
FT                   /protein_id="XP_626658.1"
FT   gene            complement(<260720..>261238)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_760"
FT                   /db_xref="GeneID:3373811"
FT                   /locus_tag="cgd3_760"
FT   mRNA            complement(<260720..>261238)
FT                   /db_xref="GI:66358961"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_760"
FT                   /db_xref="GeneID:3373811"
FT                   /locus_tag="cgd3_760"
FT                   /transcript_id="XM_626659.1"
FT                   /product="HMG-like nuclear protein, Nhp2p, pelota RNA
FT                   binding domain containing protein"
FT   CDS_pept        complement(260720..>261238)
FT                   /locus_tag="cgd3_760"
FT                   /gene_family="HOG000055227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HMG-like nuclear protein, Nhp2p, pelota RNA
FT                   binding domain containing protein"
FT                   /db_xref="GI:66358962"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_760"
FT                   /db_xref="GeneID:3373811"
FT                   /translation="KVEEMKEDTTELSHVEDEIEMEGEEAITNKSAIADPIFGGKLLER
FT                   CLKLVKKVQEYEKEERKEKGSKKVRYIRRGVHEVTKSIRKGQTGLVLIACDIHPVDIIA
FT                   HIPILCEEKNIYYGYLGSKKTLGTICKSKRPASVLMISFNSESSVQDKPFYSIYSKVIS
FT                   NIKKVHPYI"
FT                   /protein_id="XP_626659.1"
FT   gene            <261918..>263036
FT                   /db_xref="ApiDB_CryptoDB:cgd3_770"
FT                   /db_xref="GeneID:3374134"
FT                   /locus_tag="cgd3_770"
FT   mRNA            <261918..>263036
FT                   /db_xref="GI:66358963"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_770"
FT                   /db_xref="GeneID:3374134"
FT                   /locus_tag="cgd3_770"
FT                   /transcript_id="XM_626660.1"
FT                   /product="ULP1 like protease with a chlamydin like cysteine
FT                   protease domain"
FT   CDS_pept        261918..263036
FT                   /locus_tag="cgd3_770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ULP1 like protease with a chlamydin like cysteine
FT                   protease domain"
FT                   /db_xref="GI:66358964"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_770"
FT                   /db_xref="GeneID:3374134"
FT                   /translation="MSVISTNSYLLGQKTINFNGISLGLDKAKKQLMNNSYLDDLILDF
FT                   FMEFAKELCVGIKENCSKGKYCVFSSLFYTILSMCGDYQDYLRLRKWVKRVSTPLLLND
FT                   AIVIPMHCNQTSHWWLIVICHPRKIFNLMNSSSPRNNSTTKIENSNRGWIICMDSLGGK
FT                   NIGQNEKKKAIINILKFLDIERQNNDSYFNLLEAGNIPTMVYDSVNTKAHNTNTSATHD
FT                   KLSETFRSLSNWEIIYNPRNLPFQENNFDCGIYIIEYAHLLFHYGTTIFNSMINTSSSS
FT                   DISYTTHLDQNKFSRNWFQNRRTVYTKVLEFMSNNESWNEDNFLRNKLVEIFDDSIKAS
FT                   NHNEKPSQENISSLQSRRRFVMSSLNKSYFNK"
FT                   /protein_id="XP_626660.1"
FT   gene            complement(<263254..>263889)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_780"
FT                   /db_xref="GeneID:3373946"
FT                   /locus_tag="cgd3_780"
FT   mRNA            complement(<263254..>263889)
FT                   /db_xref="GI:126644485"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_780"
FT                   /db_xref="GeneID:3373946"
FT                   /locus_tag="cgd3_780"
FT                   /transcript_id="XM_001388057.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(263254..>263889)
FT                   /locus_tag="cgd3_780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644486"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_780"
FT                   /db_xref="GeneID:3373946"
FT                   /translation="KDFNLKEINSTLYISKVSLNCSHDGILPDMAFEGATKRNKPNLVP
FT                   GNYVCSRINYVDLESGEIELTCITPEEKKTWSNNENYLGVLKNSNYKNTNIIEDYSKSD
FT                   RSSLPGESQSCIKDGMTVTVPQSVAQILLADQSYVLEALSKYFAYEICVGQNGIIWFSA
FT                   SNIKEMLLIMSALKVIPNCTKPQVSLNNFFWRAQITYIYLEISSLKLF"
FT                   /protein_id="XP_001388094.1"
FT   gene            <264787..>266397
FT                   /db_xref="ApiDB_CryptoDB:cgd3_790"
FT                   /db_xref="GeneID:3374133"
FT                   /locus_tag="cgd3_790"
FT   mRNA            <264787..>266397
FT                   /db_xref="GI:66358965"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_790"
FT                   /db_xref="GeneID:3374133"
FT                   /locus_tag="cgd3_790"
FT                   /transcript_id="XM_626661.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        264787..266397
FT                   /locus_tag="cgd3_790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358966"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_790"
FT                   /db_xref="GeneID:3374133"
FT                   /translation="MVEVARRKVLGGRGSMGIVNSLRRKLIHLVNWELGTSGDEGSILN
FT                   LLKLLLNSVGSEHFRSMTAIEIIQCLDNVMKVVLNKRTRSSWLLLLNNIGKSNVIFRDY
FT                   ILYCTLEILKDNDKSEILQNLDAKCIYWKLGNNFLYTLYSLILKDDTENDDIKRCMENC
FT                   LSEGISPPRELLDLYLRRNSCRDLSLLKGFRLTSNLLGHLTYNLSKIESLNDLEIQDYI
FT                   EILLNHQKSLERKMSSEAIRNPFSNVFSQALINIIEKGENPEITDGFFHHLSLVYLVNS
FT                   IDSSPWNLRLWKELLSYLKKVLAFLSLTCILDNSFNTEGGILRNLTISSISHKDFFQEL
FT                   ISFFRFDFNIESNGNPDLVQLHKVETLIKSILAIRKTLTNLDFYWRYFNFKDSKNIQSE
FT                   MQIVRFQVYSLLVLINHSNLYLNDHLRKTSNSLNSIVYNNSSESSLDMSFVLKLSEYND
FT                   LENYSTSITLKKINLSLLILPVSLLSLLESEEDAKSAFEAIQNSNAFGCIQNESFSSLF
FT                   DIWNELEKKYLNKNGESEQ"
FT                   /protein_id="XP_626661.1"
FT   gene            <266722..>267534
FT                   /db_xref="ApiDB_CryptoDB:cgd3_800"
FT                   /db_xref="GeneID:3374132"
FT                   /locus_tag="cgd3_800"
FT   mRNA            <266722..>267534
FT                   /db_xref="GI:66358967"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_800"
FT                   /db_xref="GeneID:3374132"
FT                   /locus_tag="cgd3_800"
FT                   /transcript_id="XM_626662.1"
FT                   /product="POP4 like ribonuclease P protein subunit"
FT   CDS_pept        266722..267534
FT                   /locus_tag="cgd3_800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="POP4 like ribonuclease P protein subunit"
FT                   /db_xref="GI:66358968"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_800"
FT                   /db_xref="GeneID:3374132"
FT                   /translation="MKKSDFENERGHSIYDIFTDQEKVTYFGNGNLNSKTICSSLKDAG
FT                   LDLKVMRDVENFLGNSGGIDELKQSGHSSSNPKLTGITTSVIRMDKVKEEKKSQDGQDL
FT                   KKLNHKVFKNEGFFDIAREIKLRKLSYSHFIPLHQLWKQYIKGLTESNSVNSGTNGAIR
FT                   TRGGIKLSQLSQNLSQADLHGSMISVISSRNISCVNVQGIVVKETKETFVIISADNKVR
FT                   TILKSQSIFGIVISNNYLVTIYGSQLCYHPCERIKHKFRHRDSLNITP"
FT                   /protein_id="XP_626662.1"
FT   gene            complement(<267695..>270655)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_810"
FT                   /db_xref="GeneID:3374131"
FT                   /locus_tag="cgd3_810"
FT   mRNA            complement(<267695..>270655)
FT                   /db_xref="GI:66358969"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_810"
FT                   /db_xref="GeneID:3374131"
FT                   /locus_tag="cgd3_810"
FT                   /transcript_id="XM_626663.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(267695..270655)
FT                   /locus_tag="cgd3_810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358970"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_810"
FT                   /db_xref="GeneID:3374131"
FT                   /translation="MFKLNNINNNNNKNNNNNNNIKPQNVLRNQLTMRYSFNNDQLYSY
FT                   SGGGNRGQLVPRNEMSGTVGYNNGVGFVNHQNYLEQVIKYQQVQLQQQQQQLLFTQQQY
FT                   EYSLQLQYQYQLQQQLNQNRFNIQRNSHIQNQPTIMNGPVTTLPDPQTFGKAENMYSEI
FT                   CYSNDQRELEVLEPYEILIIPKRDNTVTVRDVSHVDLSKNKSSRYQEMEVEVEIKKGDK
FT                   DIELETVRDELLSEKKINMNSDTSEEIEVNVYETRNFEEEKYSESSFDQKFNDFGYEPI
FT                   NNRSIEVDLKECYNCEIQDEQILESESELEEVSLNGNQGEIEIEEDSILVIKYKNNVGT
FT                   DILNLMEQNIDNCVIDGNSYYYENFVRSLSFGDYSPYESQVEPNLLGFGDNCFYIVNNG
FT                   PFSQSNHTSKLVEVLEDEKNEQEEKDNKDHFQETNKKEETEENIQTKKEKVQDIKSEVG
FT                   SPKNSRESLEELSEKIQRFNLLLEKINKMEQMNISFKEAFLSEKWNLNSNLNSETRGLD
FT                   GIKGKMEENQLEDDKSVSECSALGIVKDIYDSNPHIIYKNVEDRSFESSSERLADVEGE
FT                   LEQGEEHVQRYIQAINDYFAREGLLGVCESRLNTHRWERNYENAMSSLNSQFKDSSYNS
FT                   DAFSESDPESAVDSIAVSEVNSDFIETKENEVMDGVANKHCEDILDIPDKFVDEYNNDL
FT                   IKDEHNQEDKPPKQDLLQLEAEEIKTQEQNLIKNSRLSSPKDSKTQLFPLNPIHIENKM
FT                   AATSSISRTVLVSKTKNEELSNSTKNHQKVKIPTINIPNSNDIPKKTSSSNILKKPQND
FT                   LKIKGKTLSYANPTQKNANLAGSEFNKEIIDKDDEILARLSQCRVINSKTIKLATNNNN
FT                   NNLEGNKGYNIYEKSQSNVSFRPRLNTCSVPFSNSNNSSSTNNNFNQHANKRACEKMTR
FT                   GPASNNLFGGKLTNNQNRPHAPVQVRKEPNLGFKSLISSGIKVNMAELMKPRIIRK"
FT                   /protein_id="XP_626663.1"
FT   gene            complement(<271495..>271923)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_820"
FT                   /db_xref="GeneID:3374130"
FT                   /locus_tag="cgd3_820"
FT   mRNA            complement(<271495..>271923)
FT                   /db_xref="GI:66358971"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_820"
FT                   /db_xref="GeneID:3374130"
FT                   /locus_tag="cgd3_820"
FT                   /transcript_id="XM_626664.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(271495..271923)
FT                   /locus_tag="cgd3_820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358972"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_820"
FT                   /db_xref="GeneID:3374130"
FT                   /translation="MKRSFFLSLLVLFISYYQVNSQDAYHPFRSTALELADSKDQSSCN
FT                   ENCIQEKNDRALQEAGSSSNSGTNQGSSNSIGDIVQDNMNNLYKELADHAQEQAKNTWD
FT                   SLSSGAKAGIIIAIVVVAIIIIAGIIHCLCICKLCCCC"
FT                   /protein_id="XP_626664.1"
FT   gene            <274210..>274590
FT                   /db_xref="ApiDB_CryptoDB:cgd3_830"
FT                   /db_xref="GeneID:3374129"
FT                   /locus_tag="cgd3_830"
FT   mRNA            <274210..>274590
FT                   /db_xref="GI:66358973"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_830"
FT                   /db_xref="GeneID:3374129"
FT                   /locus_tag="cgd3_830"
FT                   /transcript_id="XM_626665.1"
FT                   /product="60S ribosomal protein L35"
FT   CDS_pept        274210..274590
FT                   /locus_tag="cgd3_830"
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L35"
FT                   /db_xref="GI:66358974"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_830"
FT                   /db_xref="GeneID:3374129"
FT                   /translation="MNKNSGLQIKQLISLSEEELTVKIDELKKELASLRVIQSTGTAPN
FT                   KLSRINVVRKGIARILTILSQRNIKSLREKHAGSKFMPLDLRKKLTRAKRRALTPQQAK
FT                   KMTVKASKKALNFPKRKFAIIA"
FT                   /protein_id="XP_626665.1"
FT   gene            complement(<274806..>276119)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_840"
FT                   /db_xref="GeneID:3374128"
FT                   /locus_tag="cgd3_840"
FT   mRNA            complement(<274806..>276119)
FT                   /db_xref="GI:66358975"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_840"
FT                   /db_xref="GeneID:3374128"
FT                   /locus_tag="cgd3_840"
FT                   /transcript_id="XM_626666.1"
FT                   /product="RSC6/BAF60A ortholog with a SWIB domain"
FT   CDS_pept        complement(274806..276119)
FT                   /locus_tag="cgd3_840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RSC6/BAF60A ortholog with a SWIB domain"
FT                   /db_xref="GI:66358976"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_840"
FT                   /db_xref="GeneID:3374128"
FT                   /translation="MARIPECIKEFSQEQYNQYENLLEYERLLDESILQQRYSLSDVWL
FT                   TLMDDKSIRCYRKKLRVHIFNTYESQKPTDAELESFSFDNDWTRKVPPSWTLKILGSII
FT                   QGDAYQPRFTSIFSKIIIQLSETETIIWDKKTSPTPECDGLEIHRIGDEERDIDILFFL
FT                   DYRTPHYSLSPQLEEFMGTSLANLPSIVKRIWQYVEMKGLQNSKASHDSIMIDEYLGKL
FT                   LSVDTEHVLLKDVPDLLKQHLLPPKPIKIRHRLALKGDWIDNESTYDFTIDLTENVPGD
FT                   ITLWLPNMSTRIQESGEFSNINKALEELYHKNQSILSKIYSSCNKINFYQGFANDPVDF
FT                   IHSLLTTKHFQLYGNNSINNILSDPNAIYEYQIADKYAEYYRQPWVPRAIEKYLSCKNK
FT                   NFEERVNKTVASVSACEKIRRRSGFGQDQRIQSHPNQQ"
FT                   /protein_id="XP_626666.1"
FT   gene            complement(<276957..>277325)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_850"
FT                   /db_xref="GeneID:3374127"
FT                   /locus_tag="cgd3_850"
FT   mRNA            complement(<276957..>277325)
FT                   /db_xref="GI:66358977"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_850"
FT                   /db_xref="GeneID:3374127"
FT                   /locus_tag="cgd3_850"
FT                   /transcript_id="XM_626667.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(276957..277325)
FT                   /locus_tag="cgd3_850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66358978"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_850"
FT                   /db_xref="GeneID:3374127"
FT                   /translation="MFDFINKYVGEVANASASENTEKTLSETGSTPPPEESSDEESDVI
FT                   SHTMDWGFLDYVEHLLMLSRSDEGEDLEITKTKVIQDSWSSIDNRALSLHKALLIKVSL
FT                   KVFIHLLLFTIKYSSIFI"
FT                   /protein_id="XP_626667.1"
FT   gene            <277955..>278524
FT                   /db_xref="ApiDB_CryptoDB:cgd3_860"
FT                   /db_xref="GeneID:3373810"
FT                   /locus_tag="cgd3_860"
FT   mRNA            <277955..>278524
FT                   /db_xref="GI:66358979"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_860"
FT                   /db_xref="GeneID:3373810"
FT                   /locus_tag="cgd3_860"
FT                   /transcript_id="XM_626668.1"
FT                   /product="ARF1/2 like small GTpase"
FT   CDS_pept        <277955..278524
FT                   /locus_tag="cgd3_860"
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ARF1/2 like small GTpase"
FT                   /db_xref="GI:66358980"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_860"
FT                   /db_xref="GeneID:3373810"
FT                   /translation="RVYTAEMGLALTKIWRNLFGKKDMRILMVGLDAAGKTTILYKLKL
FT                   GEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYYSNTDGLIFVIDSNDRE
FT                   RINDARDELARMLGEDELRDAVLLVFANKQDLPNAMSATDITEKLQLSGIRNRNWFIQS
FT                   TCATSGDGLYEGLDWLSRTLASRSNN"
FT                   /protein_id="XP_626668.1"
FT   gene            <278955..>279026
FT                   /db_xref="ApiDB_CryptoDB:cgd3_865"
FT                   /db_xref="GeneID:3373950"
FT                   /locus_tag="cgd3_865"
FT   tRNA            278955..279026
FT                   /note="codon recognized: GAA"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_865"
FT                   /db_xref="GeneID:3373950"
FT                   /locus_tag="cgd3_865"
FT                   /product="tRNA-Glu"
FT   gene            <279294..>280141
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_870"
FT                   /db_xref="GeneID:3373945"
FT                   /locus_tag="cgd3_870"
FT   mRNA            join(<279294..279623,279905..>280141)
FT                   /db_xref="GI:126644489"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_870"
FT                   /db_xref="GeneID:3373945"
FT                   /locus_tag="cgd3_870"
FT                   /transcript_id="XM_001388058.1"
FT                   /product="flavoprotein, putative"
FT   CDS_pept        join(<279294..279623,279905..280141)
FT                   /locus_tag="cgd3_870"
FT                   /gene_family="HOG000187629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavoprotein, putative"
FT                   /db_xref="GI:126644490"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_870"
FT                   /db_xref="GeneID:3373945"
FT                   /translation="MKKRNVLIGVTGSVAAIKIHEFIKKLKEKVISNNIEIEIKVVATD
FT                   SAKNFLNGLALDLLVDCQDEFGNWKSMGDDIPHISLRQWADLYIILPLSANTLAKLSNG
FT                   LCDNVLTNIARAWDFKKPIIVCPAMNSFMWEHPITLTQINILISFGYKVVFPIEKKLAC
FT                   GEYGMGGMQEIEKIVEQILLELNSS"
FT                   /protein_id="XP_001388095.1"
FT   gene            complement(<280483..>280893)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_880"
FT                   /db_xref="GeneID:3374184"
FT                   /locus_tag="cgd3_880"
FT   mRNA            complement(<280483..>280893)
FT                   /db_xref="GI:66358981"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_880"
FT                   /db_xref="GeneID:3374184"
FT                   /locus_tag="cgd3_880"
FT                   /transcript_id="XM_626669.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(280483..280893)
FT                   /locus_tag="cgd3_880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66358982"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_880"
FT                   /db_xref="GeneID:3374184"
FT                   /translation="MVNINSPRKDLSVLAQCMNPVEEEMQEEQVFHPDSVILPPVSAVP
FT                   FDYYPYSPRYKYPEVTCSYPFVSSPPYVVHYMSNLGVPSFFQQLDISIDQRRNVFQRNS
FT                   GRNRGLQFEKGEENFGKYWSETQPSRPLGCMG"
FT                   /protein_id="XP_626669.1"
FT   gene            <281592..>282482
FT                   /db_xref="ApiDB_CryptoDB:cgd3_890"
FT                   /db_xref="GeneID:3373809"
FT                   /locus_tag="cgd3_890"
FT   mRNA            <281592..>282482
FT                   /db_xref="GI:66358983"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_890"
FT                   /db_xref="GeneID:3373809"
FT                   /locus_tag="cgd3_890"
FT                   /transcript_id="XM_626670.1"
FT                   /product="ybr061c-like, FtsJ methylase"
FT   CDS_pept        <281592..282482
FT                   /locus_tag="cgd3_890"
FT                   /gene_family="HOG000162368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ybr061c-like, FtsJ methylase"
FT                   /db_xref="GI:66358984"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_890"
FT                   /db_xref="GeneID:3373809"
FT                   /translation="IDLQNKKKILNLKIYNSIVLQMGKLSRDRRDIYYRRAKQEGFRAR
FT                   SAYKLIQIDEKYNIFDKVTRAVDLCAAPGSWSQVLSTKLLNNSEYNEGQPKETDQIDSN
FT                   NGEAPLIVAVDLQEMAPIYGVNIIKGDITSQLTVSRILEYFQGKKADLVLCDGSPDVTG
FT                   LHDIDEYIQNQLLVSSLSITSKIMRKGGTFVAKIFRGENISRIYQQMFCYFELVDCCKP
FT                   ESSRNSSLEAFIVCRYFKFDDQDSTNVNFEIPDPLTVPFISCGDLSEYDPDKTYETEYT
FT                   SSLEPIQPPINAPYH"
FT                   /protein_id="XP_626670.1"
FT   gene            complement(<282501..>283145)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_900"
FT                   /db_xref="GeneID:3374183"
FT                   /locus_tag="cgd3_900"
FT   mRNA            complement(<282501..>283145)
FT                   /db_xref="GI:66358985"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_900"
FT                   /db_xref="GeneID:3374183"
FT                   /locus_tag="cgd3_900"
FT                   /transcript_id="XM_626671.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(282501..283145)
FT                   /locus_tag="cgd3_900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358986"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_900"
FT                   /db_xref="GeneID:3374183"
FT                   /translation="MEERNIEENNEDDDLFGEDIAFSQESVNRRLGKVQKRNRLAKKVC
FT                   INKESQQNETREKISSNDNNHIEEDSDYEEFRPAVRKKISRKEDTVLTIEKTQKKVGTK
FT                   NEQVSQVITIEDEEREKSVIKLNVKVYKRKESDIIVIKTLVVALYRNDLVKKLVTYISK
FT                   NLNPKPEKYLEDIKVYFDGDCVNMEMEIKEIGIEDEEQLEVKVPFECNWIK"
FT                   /protein_id="XP_626671.1"
FT   gene            complement(<283644..>284480)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_910"
FT                   /db_xref="GeneID:3374181"
FT                   /locus_tag="cgd3_910"
FT   mRNA            complement(<283644..>284480)
FT                   /db_xref="GI:66358987"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_910"
FT                   /db_xref="GeneID:3374181"
FT                   /locus_tag="cgd3_910"
FT                   /transcript_id="XM_626672.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(283644..284480)
FT                   /locus_tag="cgd3_910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358988"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_910"
FT                   /db_xref="GeneID:3374181"
FT                   /translation="MTGSELRTPVSGCQWLGYNRVHIRESRTYKVSPKKKVEFMRYEYN
FT                   STSGCELENYSRQIIGYGDWDVNKYTRGNQTLVDVRINWRKVIIRSRMNHVNILDDLNK
FT                   INWLYKSLSPVYFYDLNLLNTCIEHLTIVPDYDISAIDSKTIKIDGETIKISNEKLNID
FT                   HIPDSKVEEALLRMVTGYSGNVISDMVKKEFSIEKDWEEFFKHKSPRMRKICQWKDIKE
FT                   FCLMPPSEIIHKHSCKLPSVDHLISSDLETLKVALYPYNSTLPDTDLIEFSKYKTC"
FT                   /protein_id="XP_626672.1"
FT   gene            <285974..>287590
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_920"
FT                   /db_xref="GeneID:3373944"
FT                   /locus_tag="cgd3_920"
FT   mRNA            <285974..>287590
FT                   /db_xref="GI:126644492"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_920"
FT                   /db_xref="GeneID:3373944"
FT                   /locus_tag="cgd3_920"
FT                   /transcript_id="XM_001388059.1"
FT                   /product="calmodulin-domain protein kinase 1, putative"
FT   CDS_pept        285974..287590
FT                   /locus_tag="cgd3_920"
FT                   /gene_family="HOG000233030" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calmodulin-domain protein kinase 1, putative"
FT                   /db_xref="GI:126644493"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_920"
FT                   /db_xref="GeneID:3373944"
FT                   /translation="MGNTAVGNTGTRLRAPVDAVVNTTNKKAPVSEKPSQPQIPNKTSD
FT                   VKKGGTMGGERGSVTTGMFVQSGSGTFAERYNIVCMLGKGSFGEVLKCKDRITQQEYAV
FT                   KVINKASAKNKDTSTILREVELLKKLDHPNIMKLFEILEDSSSFYIVGELYTGGELFDE
FT                   IIKRKRFSEHDAARIIKQVFSGITYMHKHNIVHRDLKPENILLESKEKDCDIKIIDFGL
FT                   STCFQQNTKMKDRIGTAYYIAPEVLRGTYDEKCDVWSAGVILYILLSGTPPFYGKNEYD
FT                   ILKRVETGKYAFDLPQWRTISDDAKDLIRKMLTFHPSLRITATQCLEHPWIQKYSSETP
FT                   TISDLPSLESAMTNIRQFQAEKKLAQAALLYMASKLTTLDETKQLTEIFRKLDTNNDGM
FT                   LDRDELVRGYHEFMRLKGVDSNSLIQNEGSTIEDQIDSLMPLLDMDGSGSIEYSEFIAS
FT                   AIDRTILLSRERMERAFKMFDKDGSGKISTKELFKLFSQADSSIQMEELESIIEQVDNN
FT                   KDGEVDFNEFVEMLQNFVRNE"
FT                   /protein_id="XP_001388096.1"
FT   gene            <289055..>289567
FT                   /db_xref="ApiDB_CryptoDB:cgd3_930"
FT                   /db_xref="GeneID:3373844"
FT                   /locus_tag="cgd3_930"
FT   mRNA            <289055..>289567
FT                   /db_xref="GI:66358989"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_930"
FT                   /db_xref="GeneID:3373844"
FT                   /locus_tag="cgd3_930"
FT                   /transcript_id="XM_626673.1"
FT                   /product="DnaJ domain, possible zf-CSL following"
FT   CDS_pept        <289055..289567
FT                   /locus_tag="cgd3_930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DnaJ domain, possible zf-CSL following"
FT                   /db_xref="GI:66358990"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_930"
FT                   /db_xref="GeneID:3373844"
FT                   /translation="FVQRLEMASNWEDSLNPYSLLGVKRDASERDIRLAFLRLVRKFHP
FT                   DKNISELNQEKDTQIANNGEQGDHNSRITVKYHALYDAYCILKDPEKRKEYDLSAFNES
FT                   LSNYNSMIWHKSVNLEELEYMDEDGKEVFAYFCRCGGLIFLEKKHIEEGYNLFSCDGCS
FT                   SKIMITF"
FT                   /protein_id="XP_626673.1"
FT   gene            complement(<289618..>290244)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_940"
FT                   /db_xref="GeneID:3374177"
FT                   /locus_tag="cgd3_940"
FT   mRNA            complement(<289618..>290244)
FT                   /db_xref="GI:66358991"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_940"
FT                   /db_xref="GeneID:3374177"
FT                   /locus_tag="cgd3_940"
FT                   /transcript_id="XM_626674.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(289618..290244)
FT                   /locus_tag="cgd3_940"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358992"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_940"
FT                   /db_xref="GeneID:3374177"
FT                   /translation="MHENNENDLSLFKLKKLPQFPRLTSLNLNISLEKHSEECEKPEYK
FT                   ESHPKCKKKKPRDTLPQNVNNENTIIFQLGSSISKKKCVDVLKKKEIVTEKNHYSPKND
FT                   NIEETNNTQQKTKEELLQIGKNHSIESIQNIYQKILMVSIEMNESRESSSKEISNMITE
FT                   INQIKESLVDYWIELTLTQAKSMNNNLESNSDADTVLNQALTKQE"
FT                   /protein_id="XP_626674.1"
FT   gene            <290983..>293103
FT                   /db_xref="ApiDB_CryptoDB:cgd3_950"
FT                   /db_xref="GeneID:3374180"
FT                   /locus_tag="cgd3_950"
FT   mRNA            <290983..>293103
FT                   /db_xref="GI:66358993"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_950"
FT                   /db_xref="GeneID:3374180"
FT                   /locus_tag="cgd3_950"
FT                   /transcript_id="XM_626675.1"
FT                   /product="hypothetical conserved protein"
FT   CDS_pept        290983..293103
FT                   /locus_tag="cgd3_950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="GI:66358994"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_950"
FT                   /db_xref="GeneID:3374180"
FT                   /translation="MENIPLLKSVENKDPSLNWNIDVSAELEKYLSAIELLDEDMNYSQ
FT                   STEANGYGYNNENITSNNGSYMQMFNFVEAALIIQNSTSLYSKKIEHLHSLVFDAFHLL
FT                   STGKSQLNDGKIGHDEHTNSSNQLANKNNIAEKNTAFLMSNMVSVPINLLQPGRNINLQ
FT                   FEQFGNNSLNDDISAKYSSYSSYIGVSSLGNSISLPQYRIDTSSNTLFLDEADLGYFTS
FT                   NDSVVEHEYLGDMFAENGMDYDSFQKEDQDHELRQNDEVYDDDMVVNEDNGPLGAELDE
FT                   IEIESQDYIENFDNKENELLDNMDEKGKKDVKSSAGGRRNKNKEDYWVFMDEHMKLGKD
FT                   KPLKPGRTYKIPSRNYTISLENLSQKEDILDFIDIYSLSSYFMGLTKIEGEKYKLGSQK
FT                   LPFFSDLKPPKLSVERLLTFDDPDYDYLRLLEPELNKSASSWKKYHSKVFFESMDKKRR
FT                   ELLNSGSGNDNDQETSEFNDLGMGEISEYYLEQTQDVLSDPELPLDPIEDHIQDDENLI
FT                   EGTQNQEEQIISDSNLVDIIDFEQNLSELHTRINTWTGYVEPLLQAQNSRPEFNIHEEG
FT                   KMIIERMKKFNIMEQPIRFEEVTNGFSKWQVCRSFLATLMLSNNREIDILQENQNAIEE
FT                   EADFFSIKLLDEDEQNQALNTNINNTEKVSVVNLDFPKKKKTKKDFEEESNELENKLDK
FT                   GQRTSRKRGNKT"
FT                   /protein_id="XP_626675.1"
FT   gene            complement(<293124..>293684)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_960"
FT                   /db_xref="GeneID:3374179"
FT                   /locus_tag="cgd3_960"
FT   mRNA            complement(<293124..>293684)
FT                   /db_xref="GI:66358995"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_960"
FT                   /db_xref="GeneID:3374179"
FT                   /locus_tag="cgd3_960"
FT                   /transcript_id="XM_626676.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(293124..293684)
FT                   /locus_tag="cgd3_960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66358996"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_960"
FT                   /db_xref="GeneID:3374179"
FT                   /translation="MSWNPSVIHCKYAKLLFQFLIFFIDNVCTLVLCGKRSQLEDNADY
FT                   KIDFFRNTGKYPSTGYLESNGLYGTPLILKSQDSTLWIILFGVCLAAFIFGIGIFMIAN
FT                   FGGNLKHSEDKLAELESNEYFYDPLESPEEEIKRLNKLQGKFVSTLNYPNPNNYNHCHH
FT                   PQFSQFGNYYSSNQQYYSSSSLK"
FT                   /protein_id="XP_626676.1"
FT   gene            <294291..>294764
FT                   /db_xref="ApiDB_CryptoDB:cgd3_970"
FT                   /db_xref="GeneID:3374178"
FT                   /locus_tag="cgd3_970"
FT   mRNA            <294291..>294764
FT                   /db_xref="GI:66358997"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_970"
FT                   /db_xref="GeneID:3374178"
FT                   /locus_tag="cgd3_970"
FT                   /transcript_id="XM_626677.1"
FT                   /product="hypothetical protein, possible 2 transmembrane
FT                   domains"
FT   CDS_pept        294291..294764
FT                   /locus_tag="cgd3_970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, possible 2 transmembrane
FT                   domains"
FT                   /db_xref="GI:66358998"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_970"
FT                   /db_xref="GeneID:3374178"
FT                   /translation="MSSTYSTFVSSIGAIETGVMGTLAGGPSYFIPFAIFGYYKTRADV
FT                   NAATNRMMEIADSSRNPRKNFTRSIKMRNTQEFSGQQNSYFWILTIVAVALGVIAISLL
FT                   SCLVGITPDDDYRESKKRRRKLMENPKITPEEFAVTMANYTPNEYRYREWNRI"
FT                   /protein_id="XP_626677.1"
FT   gene            complement(<294999..>295631)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_980"
FT                   /db_xref="GeneID:3373943"
FT                   /locus_tag="cgd3_980"
FT   mRNA            complement(<294999..>295631)
FT                   /db_xref="GI:126644496"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_980"
FT                   /db_xref="GeneID:3373943"
FT                   /locus_tag="cgd3_980"
FT                   /transcript_id="XM_001388060.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(294999..>295631)
FT                   /locus_tag="cgd3_980"
FT                   /gene_family="HOG000282275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644497"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_980"
FT                   /db_xref="GeneID:3373943"
FT                   /translation="PFRTTLIKFQASVPSLVKEGQVWRLLVSLFLHASIWHIVFNIIFQ
FT                   IRLSLSCEVKYGRILNFTIYFISGLLGNLFSVAIRSSCVVAVGASTSGFGLIGAQLAEL
FT                   ILFWHTLQNKEQVVINILLFGILMILITWGNPSSAIDHWGHIGGFVSGTCLGIICNFKS
FT                   DLKPKWYKAAFGVSIALISSTLIGPIIRIWAFELAPCVVFPEKLMNP"
FT                   /protein_id="XP_001388097.1"
FT   gene            complement(<296846..>297388)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_990"
FT                   /db_xref="GeneID:3373843"
FT                   /locus_tag="cgd3_990"
FT   mRNA            complement(<296846..>297388)
FT                   /db_xref="GI:66358999"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_990"
FT                   /db_xref="GeneID:3373843"
FT                   /locus_tag="cgd3_990"
FT                   /transcript_id="XM_626678.1"
FT                   /product="CG6144-like AlkB"
FT   CDS_pept        complement(296846..>297388)
FT                   /locus_tag="cgd3_990"
FT                   /gene_family="HOG000210721" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CG6144-like AlkB"
FT                   /db_xref="GI:66359000"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_990"
FT                   /db_xref="GeneID:3373843"
FT                   /translation="VNLPIYPIFLLFRVHKLIIYLYYFECLDWITPEQEKTLLENISRS
FT                   SFLNVKLNGRQTQVWGGTVSESGIVNQKDLPEWLESISQSLVDYNIFSKEETPNHVLIN
FT                   QYEQYKGILPHKDGPLYYPRVAIISLESDTLFDFWNPSLDTQENKFPLFSLIVPKLSLL
FT                   VFQDLCYTQLLHGISSR"
FT                   /protein_id="XP_626678.1"
FT   gene            complement(<297683..>298210)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1000"
FT                   /db_xref="GeneID:3374176"
FT                   /locus_tag="cgd3_1000"
FT   mRNA            complement(<297683..>298210)
FT                   /db_xref="GI:66359001"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1000"
FT                   /db_xref="GeneID:3374176"
FT                   /locus_tag="cgd3_1000"
FT                   /transcript_id="XM_626679.1"
FT                   /product="hypothetical protein with possible 4
FT                   transmembrane domains"
FT   CDS_pept        complement(297683..298210)
FT                   /locus_tag="cgd3_1000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with possible 4
FT                   transmembrane domains"
FT                   /db_xref="GI:66359002"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1000"
FT                   /db_xref="GeneID:3374176"
FT                   /translation="MFLNVLKLTPLGGGPAPLLKNQIVRQCYSLMFLNIFIAIWSISSI
FT                   LYSKFTNANFGSEISTYFFIVFLIGSVNSIFFSKLGSLRYCSDSEWSNRLILILIINLV
FT                   QYGAILWGCWISYKVFMSRYLAGTKMYYYFIFSRWMYNTLFGMTAFFSFSVIYTSFIYS
FT                   KLLVSLTHQRVL"
FT                   /protein_id="XP_626679.1"
FT   gene            <298411..>299166
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1010"
FT                   /db_xref="GeneID:3374182"
FT                   /locus_tag="cgd3_1010"
FT   mRNA            <298411..>299166
FT                   /db_xref="GI:66359003"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1010"
FT                   /db_xref="GeneID:3374182"
FT                   /locus_tag="cgd3_1010"
FT                   /transcript_id="XM_626680.1"
FT                   /product="hypothetical protein with 3 transmembrane domains
FT                   within C-terminus"
FT   CDS_pept        298411..299166
FT                   /locus_tag="cgd3_1010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 3 transmembrane domains
FT                   within C-terminus"
FT                   /db_xref="GI:66359004"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1010"
FT                   /db_xref="GeneID:3374182"
FT                   /translation="MNDEVEKLRRQAEIRKRRLLERSSDRLKLIYPNYEESENNESLES
FT                   IADVRYGESSKSKPISEYESSINETNSRKISKNDTFSDFSQEEIGNQREKQDSRSGFKL
FT                   VSYIEYWNQREFEKFRKVGSCILGIFLFMIHNFVPDSCLYQFFSAKIRINSISGIVSFI
FT                   VYQFLVSQVYLYSYFSIFLNYSGSNDNENKKWYKSIFGCNNTQKVDYLVIMNNIIQFAI
FT                   ATRNFISEWFLLVTFYSFFSFIHICFLVN"
FT                   /protein_id="XP_626680.1"
FT   gene            complement(<299321..>302638)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1020"
FT                   /db_xref="GeneID:3373942"
FT                   /locus_tag="cgd3_1020"
FT   mRNA            complement(<299321..>302638)
FT                   /db_xref="GI:126644498"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1020"
FT                   /db_xref="GeneID:3373942"
FT                   /locus_tag="cgd3_1020"
FT                   /transcript_id="XM_001388061.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(299321..302638)
FT                   /locus_tag="cgd3_1020"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644499"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1020"
FT                   /db_xref="GeneID:3373942"
FT                   /translation="MENHFMQVDQQNDEFEKYCEFIRENIIGELCPIKTPFGLRNMVYS
FT                   DWTASGRSLRFIEDSLKEDVAPYYGNTHSIASNNARQSTWFIYEARESVRQFIGGNPED
FT                   AIIFVGQGSTGAVSKFLKIMDASYWISIIKKFKTSYINQNLFKDISVNVIQDRWKSFKC
FT                   VSCETQYDTEAAFRRHFNKNHREKDFQSKSDSTQNEDNMDHYRITFMVDPSSHHSLFLP
FT                   FIEYSKRYSQGFKALHNDLKYKLSFSLVYLNLNKRGEVDIPNLKDELIKLKNNNILNIP
FT                   ILLISAGSNISGRLNDYTKISTISHQYGGITIVDFAATAPHTRPNMSPPLNPQGYVDVG
FT                   VFSSHKLLGGPSTPGVLIIKRELLLSEKPSDPGGNSVFFVSMDDHEYILNKEEREESGT
FT                   SDILGISRLGMVMKLDMKVPQYLKQSKERVLFERVIFEWSQFNQKNGPKIDILGFEELI
FT                   IENQELKNGQYLTSLPIISFLIKPFNFENNQVKLDFVSENNSKIVTILDNEGNDFYLHY
FT                   NFVCSLLNDLFGIQSRGGCSCAGPYSQRLLGFDKEKTRQLYQDLVVRGIESVRPGFTRI
FT                   SLHWSDNLETVDYIIKSVIWIAKHGWKFLPLYIFEESLGTWRHRSEWKSLDKIHRRWLG
FT                   DSIGKFYFDKFDQLGSKSSLNNESKLLSNSEPIFERNFEMANEIVRNLEDIIVNSKSHS
FT                   NQAYEKEFKLDSAFKEIIYQNNQHFNNSINSSDLSNINDFELLSESNLRWFITPKYIQN
FT                   IIHLLRKNNNNNISIPDTLSTLNCMHANSESFEFGGNTKESTRQKQKQEIEDFEKQSCK
FT                   KNNALENVRLFPKPNDFGVIRKQVGQAIKKFDMIREGDKVLVAVSGGKDSLTMLHILLF
FT                   LQRVAPVKFEVSAATVDPQTSEMDASKLIPYMESLGVKYHFISYPIVDIAAKVKEKQKK
FT                   ISYCAFCSRMKRGLLYSCMKKNGYNVLSLGQHVDDICESFLLSLMNNGKLNTMKANYFV
FT                   PEYNVRVVRPMIYCREKDLANFALKAQLPIITENCPACFSQPKERRHMKQLLSQEESHN
FT                   PTIYSSIMNALYPLISINHTNTMVKEEEFISNDDALKTMSKLDEDISGELLLTSCSR"
FT                   /protein_id="XP_001388098.1"
FT   gene            <302991..>304388
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1030"
FT                   /db_xref="GeneID:3374175"
FT                   /locus_tag="cgd3_1030"
FT   mRNA            <302991..>304388
FT                   /db_xref="GI:66359005"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1030"
FT                   /db_xref="GeneID:3374175"
FT                   /locus_tag="cgd3_1030"
FT                   /transcript_id="XM_626681.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        302991..304388
FT                   /locus_tag="cgd3_1030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66359006"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1030"
FT                   /db_xref="GeneID:3374175"
FT                   /translation="MSEELKFNGQDAPNEEIHEKKDEDQVGMTFSEREANMNQTAECEE
FT                   YLEDEEYYEEDEDELNASLDPELLLEEGRKLRKKKKFDEAIVKLYWAMTNRMNLLNITE
FT                   ESGIDPRLSEYYLIYADVLFEKEENSTNFFSKRNEQDTMNSFSSSSSSSSSSSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSDPTFIESTVMNMANNSVAEATDEEVAWENFEAAKLA
FT                   YIKLIYLKKRGDYDAYCQGIIPEYLANLFSSNELNDGKFEELLREVCSCNSEERSRIPD
FT                   KDITDLSYVFIRLGDILQLAEKYYEASIEYKNSLFILETFKLPEDTTESSLICLAQSTL
FT                   FSGKIKDSKYLFERALNLVRNHFEGKNGMTAPTDPQQIEAYKLTLEDLQLTLDDINRKL
FT                   AVNQEDQKPATAIPKLEEIKKENSFNKAQLPENEPVKVINTVDINGSPCENTVDNKKKR
FT                   RIDLSKV"
FT                   /protein_id="XP_626681.1"
FT   gene            complement(<304794..>305138)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1040"
FT                   /db_xref="GeneID:3374174"
FT                   /locus_tag="cgd3_1040"
FT   mRNA            complement(<304794..>305138)
FT                   /db_xref="GI:66359007"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1040"
FT                   /db_xref="GeneID:3374174"
FT                   /locus_tag="cgd3_1040"
FT                   /transcript_id="XM_626682.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(304794..305138)
FT                   /locus_tag="cgd3_1040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359008"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1040"
FT                   /db_xref="GeneID:3374174"
FT                   /translation="MCNKLEIVINNNKATNYQNSDEIHTFQIYQNEQIKDNSTIKKEIS
FT                   SNTSQINFQDLSLLNDKLASLLFNKVSSSNNYCQQSFEKNNYGLTQSETIQFKRSIINL
FT                   VNQMSKDFSF"
FT                   /protein_id="XP_626682.1"
FT   gene            <306079..>310209
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1050"
FT                   /db_xref="GeneID:3374173"
FT                   /locus_tag="cgd3_1050"
FT   mRNA            <306079..>310209
FT                   /db_xref="GI:66359009"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1050"
FT                   /db_xref="GeneID:3374173"
FT                   /locus_tag="cgd3_1050"
FT                   /transcript_id="XM_626683.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        306079..310209
FT                   /locus_tag="cgd3_1050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359010"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1050"
FT                   /db_xref="GeneID:3374173"
FT                   /translation="MRRFDVVPITSEFSENPNITITSLCYVPVIGYIYAGTNFGDILLY
FT                   KYEDFHGIQKNDGSDVLGFDLNKDRIVGKERCVRIKNISQKCKRIDKIFPIICYDTVVN
FT                   DEMENRVLIGGVILCICDGNLLYLDFRLIGKINLLCKGVSSVSIWKDSFNINTFQTKFC
FT                   IATKKKIIFYNTCLLGDLLDIQDILEYDNEVNNNPSIHNKKRSSLESRSSVVKNGKEST
FT                   IQNEDASKGYTSGVNSWFGFSTNNSHSNNNSNGNNNNVDNSHKTSAKDEVGYNEDYLSS
FT                   IEFIKVDEIQIPSRLASFTESICNIEWCDNWVCFVIANTYFIMNIDDQSINDILNLDQL
FT                   GNNFQPQIIILPEQEFMLTCQDNLGAFFSFSTLEPSPKSMIQWPSEGLTGVVLSSPYLL
FT                   GGTKSGIIQIYSLANYDANPLIKESKTSNNSSSLRSTNELSSVGGNNRGFSNNNSHNSV
FT                   QTLQLDDEITCISTGGTCEGIFFGPSSVITAPLGPMVVVSTKTKIYALTPIPIEESIFG
FT                   LVNRSQGKQALNVLRTYCNSNDLLYNSLLYKTQCLIGWFEFKNLQFEKAFQSFKQAHID
FT                   PRVLIILFWKDLIPIEWDLKYSNGSLSDLYEYAKLPWMNSKGNLSEDLSPDVKFHESLL
FT                   KSVLRKKGLNKLPPSIDLFVRSLLLNKSEFNSNLQINIEGDVEKIDEYIYFANKSFKMF
FT                   LLSERGKYTSNIENSKDNFHQIGKQSEIQKSYSTGKIMDIAIIKLIINEFNCKYKRSQD
FT                   ISLSNRIILNLLEIDSEQKFNDKGNKDYYLKQEEIMESEIEDEDELMNKKVFRNVFTEF
FT                   TVDEYEEFLLSSGRYDILAILLAYNSSYLRSLEILENMVNSSDKSSLEAYSSNNSNFIN
FT                   TYLIIFQVLLHLCNSEITPIHIQANLLKRYSRFILDKFDICPIDRLFTLKPVDKFPLTI
FT                   DEILGLFNLLPTMASNRLTKSYLETIIATQGDNIELKHKINLIEIYINDISTSIETGIH
FT                   NLIGDGSNYINLFNDNFRPSKLAIMLEDLEDFDTEILVKHISFNSHFKYKVHDNIIIEY
FT                   IIILFRSNRHNQALNYIINVLENIELAEIYTLAQIYHNKYAIQSDNMNLKVNVIEKSEF
FT                   EISFQNYQQNNLIKDSKQAYRKLKFFTEFKLWKIFKDEYSNISSPIQQNNTGDLEMNSW
FT                   LEILDISHNELSLISEEYNKVKDINEQSNYMKLINKLTSLNGDRNLQNIYSYGSMDSNG
FT                   EIIALVKILIESWRSCIQDRSIEKAEKLQNSTINILNKYSFHPDISIGNILQVIPKEWP
FT                   LLKMINFLKNSLVSSIHNQTSKSISTNLSAISFLRLYEKWSNTRSNHVTITQDMICHVC
FT                   SLKLGNKPCALYPNGSCVHTHCLSNEYYSFNSY"
FT                   /protein_id="XP_626683.1"
FT   gene            <310605..>311201
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1060"
FT                   /db_xref="GeneID:3374172"
FT                   /locus_tag="cgd3_1060"
FT   mRNA            <310605..>311201
FT                   /db_xref="GI:66359011"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1060"
FT                   /db_xref="GeneID:3374172"
FT                   /locus_tag="cgd3_1060"
FT                   /transcript_id="XM_626684.1"
FT                   /product="U1 like C2H2 zinc finger"
FT   CDS_pept        310605..311201
FT                   /locus_tag="cgd3_1060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="U1 like C2H2 zinc finger"
FT                   /db_xref="GI:66359012"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1060"
FT                   /db_xref="GeneID:3374172"
FT                   /translation="MSGVNSLGRKVWDKEFYSKSKEERDRIRSLENAEHEKKLEKKEEI
FT                   SEEDAKKMREMYLDISKNVGLSKSHTSGDDVRKNISGYWCEVCNLGFNDSHSWIRHLNS
FT                   QSHNQKMGTSLYVEKKSLESVKRRLSELIHDYDHGLGIFSKHNKNESKNGVYGQGIKGG
FT                   NKVKDKDRVSSEEENMSEDETKNQMLQYNFPSSFS"
FT                   /protein_id="XP_626684.1"
FT   gene            complement(<311229..>311540)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1070"
FT                   /db_xref="GeneID:3373842"
FT                   /locus_tag="cgd3_1070"
FT   mRNA            complement(<311229..>311540)
FT                   /db_xref="GI:66359013"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1070"
FT                   /db_xref="GeneID:3373842"
FT                   /locus_tag="cgd3_1070"
FT                   /transcript_id="XM_626685.1"
FT                   /product="synaptobrevin like SNARE"
FT   CDS_pept        complement(311229..>311540)
FT                   /locus_tag="cgd3_1070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="synaptobrevin like SNARE"
FT                   /db_xref="GI:66359014"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1070"
FT                   /db_xref="GeneID:3373842"
FT                   /translation="KLCNVLKGILQALDGQAEVLEDETESFLQDSIKVKNKFWWKNIKY
FT                   TLILGCLVSLIFIIAFANLFNTIFGNGINLLNLLKSNSIASKSYSGSNNNNNNIVLAL"
FT                   /protein_id="XP_626685.1"
FT   gene            complement(<311568..>311912)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1080"
FT                   /db_xref="GeneID:3374171"
FT                   /locus_tag="cgd3_1080"
FT   mRNA            complement(<311568..>311912)
FT                   /db_xref="GI:66359015"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1080"
FT                   /db_xref="GeneID:3374171"
FT                   /locus_tag="cgd3_1080"
FT                   /transcript_id="XM_626686.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(311568..311912)
FT                   /locus_tag="cgd3_1080"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359016"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1080"
FT                   /db_xref="GeneID:3374171"
FT                   /translation="MEWKLYIWIPPLDKGKIAYSVCCKNEKYPERLIYSYLRELNKSTL
FT                   RIERINENMPNKINELNGIKNFKEDIKSLVSQYDDFENFDKIVQLEDSAKEIAGTIQNN
FT                   IQILLNNKVS"
FT                   /protein_id="XP_626686.1"
FT   gene            complement(<313233..>314606)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1090"
FT                   /db_xref="GeneID:3373841"
FT                   /locus_tag="cgd3_1090"
FT   mRNA            complement(<313233..>314606)
FT                   /db_xref="GI:66359017"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1090"
FT                   /db_xref="GeneID:3373841"
FT                   /locus_tag="cgd3_1090"
FT                   /transcript_id="XM_626687.1"
FT                   /product="Rrp9p/U3-55K-family snoRNP-associated protein
FT                   with several WD40 repeats"
FT   CDS_pept        complement(313233..>314606)
FT                   /locus_tag="cgd3_1090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rrp9p/U3-55K-family snoRNP-associated protein
FT                   with several WD40 repeats"
FT                   /db_xref="GI:66359018"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1090"
FT                   /db_xref="GeneID:3373841"
FT                   /translation="IMKRKFQQIKKNQGKKKNENEEIVSSSDDESFLNNKKSVDYQDHK
FT                   NSHFIGRTLGSNVESDYENGEEEDDDDEEDTFFENDDERRVSLAKKYLKKIDALDDDDI
FT                   KKSLNILEGKISQRDIADSFNITSDSTFYKGHKLSPTCVTLDKDGRTAYTGGKDCAIIK
FT                   WDLETGKKIIFPGSRKDFECGGHFEQVKTICYHKETNLICSGGEDKVIRIWDHRVQKCI
FT                   EKFHGHTNTITGIVSEPNSDIDQIISVSFDKSLKVWSLKSRSHMNTYYGHTNKITSCDI
FT                   ILKDRPFTGSEDNTSRLWKLSADSHLIFYPSNNNNNNDLSKNIESPIDSVSCLNNVNYI
FT                   TGQQDGTIHIWSQFKKKPLFTSNDLHKGGIYSIKSIPFTDLFFTGSDDQEIKAWKWSNQ
FT                   NNNISLINSIKISGFVNDISVSDKLIVAAIGQEHRLGRWNSIKESKNGLLVVPISYNN"
FT                   /protein_id="XP_626687.1"
FT   gene            <315211..>316602
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1100"
FT                   /db_xref="GeneID:3374170"
FT                   /locus_tag="cgd3_1100"
FT   mRNA            <315211..>316602
FT                   /db_xref="GI:66359019"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1100"
FT                   /db_xref="GeneID:3374170"
FT                   /locus_tag="cgd3_1100"
FT                   /transcript_id="XM_626688.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        315211..316602
FT                   /locus_tag="cgd3_1100"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359020"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1100"
FT                   /db_xref="GeneID:3374170"
FT                   /translation="MKSNKYQEFESLPNSLLFEKKSKSQVLRQNDLITNIVRDNLDNGN
FT                   KLFNDEHDVNNFDDLPFVIPSKRIIIEWPLHLLKNLKALDFENNDFSKYELENIEICKI
FT                   VSNNVREKGAQEWEQAQKCEEEPVQEQKKELIQELEEEPVQEQKKEPVQEYNKEPIQEQ
FT                   KKELIQELEEEPIQEYNKEPVQEQKKELVQEHNKEELFQEHELEQTQNRNRNQNQNQSQ
FT                   KQQLTIQKQLNIQKPQLNVQKHQLEQTKFPTNLRLKYMQIYIMGGYAKKHFHNKEQNSY
FT                   NIRVEIKKNQEIQAIKVINILEKDDMHFFHHGNNILSSFQSNNSEYHRKFISSQIQANK
FT                   RMFRLNSHQYKLQIFKFLNIKIPIKCDDQIYLYLGNSQSKHEFNDVQKDHQIHRRNAIL
FT                   PITKQNLLKLTKDGGFQTLLELHDHFYTFQTNITQQNSTHSFLSQNFNHPDTFIGYILL
FT                   SIQKA"
FT                   /protein_id="XP_626688.1"
FT   gene            complement(<316698..>328244)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1110"
FT                   /db_xref="GeneID:3373840"
FT                   /locus_tag="cgd3_1110"
FT   mRNA            complement(<316698..>328244)
FT                   /db_xref="GI:66359021"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1110"
FT                   /db_xref="GeneID:3373840"
FT                   /locus_tag="cgd3_1110"
FT                   /transcript_id="XM_626689.1"
FT                   /product="P-type ATpase fused to two adenyl cyclase domains
FT                   and 21 predicted transmembrane regions"
FT   CDS_pept        complement(316698..>328244)
FT                   /locus_tag="cgd3_1110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="P-type ATpase fused to two adenyl cyclase domains
FT                   and 21 predicted transmembrane regions"
FT                   /db_xref="GI:66359022"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1110"
FT                   /db_xref="GeneID:3373840"
FT                   /translation="SDFVLLTFSKRKKMTESFGKSIIVATEDENINGINKKPVWISRKI
FT                   ILNLSGEVKGANKYPSNKYSGCKYNLLQFVFVSLWTRSKRFPIAISFLSILISFFTKQK
FT                   NQYFKWIILGFVLIFAILPPFIMDIYIYAKIRFQDYKINSRYCIVFDKDKMEFAVSKWR
FT                   NLKVGDIVCVLDGEQFPADVVVLHSSGKKAYISSEMVDGSRLVRTCEPVGTQTDLERAI
FT                   KDFILFPARITCDVPSGDINHFEGSLKWEGKPRAKALTIENFALMFSRLRFANWVLGIV
FT                   VYAGTDTKIAIRQHSALENRNRYNPATRLEKIVSQICIFMFLIVSCLGINIFTNKDSNF
FT                   ETYINKFISLLEVKGKVQRERWLTIAEFAAFFNFFVPITLTAITDIIRIVGIFRFSRNK
FT                   ALTTDYTDEIYNQSLLTYLRLNSCISKEPNFIQVFDDIQDKNNPDSKNSSYNDLKLKLQ
FT                   QNHIDKSSSKPLDITFNKCDFLDSFGAVDISLIHQNSIMETQPMRLKIISLNNGQEYMF
FT                   KKTQKITACPKFSIISGLLWKHNSVSWQSNESSRFSKGSIKVIRPGRRISMTNFGLIPP
FT                   NKLELFHYFSVLLAISKLNVIKNKDKNFKSDKNSFGRRGKTSNFDIQNNKKKIRNYYTK
FT                   LLFQIKGLKNALIDLPPDPIKVEPRDIWPPLPNIKLNSQQSNRQTSVKSINDLSSITSV
FT                   SVEMDLDLESASKSKINTDCDHHFHPALPIHLFPKRIIQLLNHIILSNQRQRVVLKDSG
FT                   SFNGQANYQQEEPLNSGIDHHRNQGRKDYQVFDTRKIQINKEDNEEILYLLFNNIVKLT
FT                   KNFYGWNTGRKYKIPNEYSMLVKNLLMESIDYSLSTCFKGEKEDKNAKLKRISSLNQET
FT                   DRSLSLISEESEYSSRKSSILIDMLYAMAICNSTVPHLRLIKQNRVPGMKRNISENNFS
FT                   SSNETLEPHPKVGGMKGLKKDRITSGKRINYYHDIPHEIMNKSIFPFNGHANSNLSNNS
FT                   SEAKINHDKDPNNRLKNDLKIPFFTKKKTKAVSKSLNVSRSPTINSERRLYIASKSMSM
FT                   GESMSSDFLNRSSSSRVLSSNDSRLFGKFLNGNKSNAKTSKRSNDGRSIRITHRYNTNY
FT                   EKLHKQRRVGCLNSHAKEILLTKYYLNYYFNASQFGEELRKSSRDEDQFFESDSENAEN
FT                   MFNNKCWKNLGKRMRNLSFSYRIKSREEKICNYYENFPRSYVKYSGIDEHDLTIVHTAA
FT                   SCGMRLVLVNSQYVVVESLGRTVFSSLIYKSEDKSKQEISMIVKFFQNKDATLYVRGVA
FT                   EHILPLLNPSLIRPQGHNSATSQCTDLEASKNNNNNTINMASQNYEDLILKIRKLQCQG
FT                   YKVFIFAKKTISENELAKMSLRHKLSEHNNGFRFLLDSSADDYFQKLKTKLEYLGHVGI
FT                   EYRIQNKVPKSIRTILDYGIKPWFLFSVSSVNSIRLMHKIFPNYDKIPLIRLDRLPLKN
FT                   KNKAMSFLSSVYNELKIIMNNNYRVIDKFYLVAEKMIKMENSSKFGEKPVNEDVCSEFE
FT                   ESGNDFFENKKISNIELLKALITISSLNGEIQLSQLESVMTENSITDHLENSGSRNNFC
FT                   NINEDWLGWGGSISGHGILNSLPGIVFSALQLNEIFESRDLLNYFFSVALISPFVVVSD
FT                   STTSDINTISNYLKNNISPRPLILGISGITGNVPVLSSCDISVSVSLSNDISDKDKKIN
FT                   GDYDSKSVKDKNNDKVRLYRLGKIFKVWRLIKKNNKSIKISDTTNNYLLNNFKEEDNSL
FT                   TISSSRNLDNSTEKDSYFTSEALSEKVENSKLKKKSTISVHNYTIQDIFKNSDDNFVIN
FT                   PVTDVSVRKFHQIIPLLSRAGRLTYYRISLAIFNNIFKLFLLIIPNLLFQFYCEWSWTL
FT                   LQLLDIVSLYIIFWTVLLPVFYGIYGVDVPKYLLDLPYLYNSSRSGYYSHWINYFSVFM
FT                   ESFVLGIISFYLSVIMCSTSPYKNGISPDISTLSASLTIYCIMGSLFSFLIKIKSFSTS
FT                   MLVTTLFKLCSILLITLLLSIKKHNSDFTFRLYALYAQHSYIFFLSIPLFISYVVLYNL
FT                   IFKIIIHHIIPDPATCVKDWWLIHISQSSRVLKSPIILKMKNSFKKMKPACFVSSIFSL
FT                   IRISFWYEWIMIKIHLQLGIDHQDEYMNPILFESLKIPTLTNLIVSQYQKYFIWKLKNK
FT                   KNIRQISNKEEDDQSNSINNLTSVEKKEINECHHHMIELNLQPQIIVSSNSINSNNNQL
FT                   PLRDLHSETMNNEINIQNQMRNVSAGSLSYKKLMKFFRPIEMNYFGDNRVSGQDWSFED
FT                   WKRRVIFHANIVWSPKQIYMQSVAPITKKWRAKGIRSLQFAQSLRKFSSRELEEYNSFL
FT                   LDYALFLADNRVGLVGIQNNDSNYSRALRKSAFSNNIDMISNERSTAQNTRYGKNLDGF
FT                   SNTVTSVSPITNNSSNVNSRTQEPSTVDLNINLTGSSSNYGRISTFSEDVKALLNPFKL
FT                   TFKVNQLELEYQIERQIEAYEHRNALRAVLCVISGIFLTLGPFSVNVSNTDYSWVGILS
FT                   VIFCLAIFMNFVLSYTYGKNKLSLRSQLPLLVMISVSSILTSSHGFALAVIFPIISFII
FT                   FRLGFIPGVYVTIIGFLSVVIGQFIWNMPSSYWIRYLPILLGINTFCGFLGYRSELLYR
FT                   AQFLLETHTNDLRQRQRQILDTMLPSFIVERLLIDQKNNPRFSSENVEDRGTVSILFCD
FT                   IYDFHSIVALLQPKKLISLLDCFFLTLDCLIDSYNCTKIETVFETYLVASCLDPYDEAS
FT                   ANFENFKSKKSNKSSYRQKPRKVTVKKSLKDIINLLRFALQIHKIGSSFFYEIPNTKNM
FT                   DLSQAETDNQMIGVSPLASLPCSSKDRKGNKNNSFIFTGQEMALKQLKLKIGIHSGRVI
FT                   SGVVGTNKPQYALFGDTVNTASRMKSSCETGKIQVSSMTHDLVKDISILKWKEKRSFVK
FT                   GKGMMDTFTLESVSGSAYPNYTHIRKQEIRGKGVGAIQIGNYYVKNTSDFDILVLDDIL
FT                   LKYLAKSNDDKKVSQKDSNSVSYSKKLTKEQERTSSPFISSIQLPQPPLPPLLPPLSTS
FT                   VQNEDERKESRFSQEFPPETFKPIQELGKGIDDCREEAEYDKEDNTEDTPLQDGLLKEI
FT                   GRQDSFSLNENIGGDIELHLKSQDSSSIGFFKKKELNSAFLVASEHETVAKSNRKRMKT
FT                   RFRKSTEHSFISISRNSFDYHQKIERSNSDQFAYSVRKDSNYQKSNIIDRRKKEKISDL
FT                   MSLTLGFKDNEIEQKYLITYYSDLTTLKTIEESLVIVIVTLVLQTLIYTILPCGQNHED
FT                   GIPGFRILWTVRIIYISSVFLSWLVLFSTYTNYQIQSSTEISGSVIPGISESGLIRGGG
FT                   VGEEARQLSGDKWKGQLSLENTKHVGGPILFLNAVLAGGASMLMLTILWQFTMVDNSIS
FT                   LWCDEEILELLLLATVHHNAGLLFKYIVLFDLLIMFLILTIFSVGINVNLEGIVVYCVA
FT                   LLVNIIAAYSRERTGRAIFYGTLVAGNCEKKAEELLVAMLPRKVLVDFQEDKLKLAYIH
FT                   KNVTFLFSDICGFTQWAMTVEAESVVYMLSSLYAQFDDSLSKFGLFKLFTIGDAYVAMS
FT                   EPEIDPYEQKSLNVSSQKIKKKNKDNQANISFGTVGGGIGSLGMNFGLGINYLNSVNSY
FT                   LSHNSSLRSSSPSILSNPISSKQSSSSNGSNNSYNTKNRQIYNLNISQMEGYTPAEGAR
FT                   RSIAMAHDMLEKIAFVREKLSLPELSMRIGLHYGGCIGGIVGSSRLRYEVWGHDVIIGN
FT                   RMESCGTPGNITISGQLHEVLSKNFNHLFKFSYVGKVSVRKQQIDMYKTRIRKNVQLKI
FT                   NKVSNSENMSNLIRRNIIYNNEKHMEN"
FT                   /protein_id="XP_626689.1"
FT   gene            complement(<328782..>330485)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1120"
FT                   /db_xref="GeneID:3373839"
FT                   /locus_tag="cgd3_1120"
FT   mRNA            complement(<328782..>330485)
FT                   /db_xref="GI:66359023"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1120"
FT                   /db_xref="GeneID:3373839"
FT                   /locus_tag="cgd3_1120"
FT                   /transcript_id="XM_626690.1"
FT                   /product="SNAPc like transcription factor with 4 MYB/SANT
FT                   domains"
FT   CDS_pept        complement(328782..>330485)
FT                   /locus_tag="cgd3_1120"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SNAPc like transcription factor with 4 MYB/SANT
FT                   domains"
FT                   /db_xref="GI:66359024"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1120"
FT                   /db_xref="GeneID:3373839"
FT                   /translation="INVESTNKVNMDKLYMKALDSIKKIDERELDYIDILFKDEIYLWQ
FT                   KDLVINYDEITKKLERQKHNRGRYKIMTRLVDNEGNLPLSNIDTIKKNNLRRNLPNFRK
FT                   KYEWNNNIWLPNEIKKLEKLVKVHLFKSILEIKVKLGTDHFRFNIQDSQDNFDEDVSSK
FT                   MMELNKLLLNLSQKDSNFNIDEYWTEFWNLIALDLGNRCERTGRDCQITWYHFIDPNIN
FT                   RKPWEKAEDLRLLALVSENEGFNWFKIAQELNSGRTPYQCILRYQRSLNKNLIKSSWTK
FT                   QEDEKLLSAVESLGGFDLIELNKRSTSKWNFVANLLPGRTNQQCRTRYVRSLKKDLKHG
FT                   SWSLYEDVRLQFAYFIYGNNSWIKISRHIKGRSDSKCRERYMNMLLPDIKKGKWSEEEN
FT                   KMLILAVNRFGPGNWSLIKNFVIGRTDADCSKQWEKLDPASSFQYDIIRATQKHMLPLS
FT                   YKWIGLSRSNHKLLNAIQSQNQGFNKNDFIQPKLSGSDFFVKPAQNILSIAQYVLSTYN
FT                   NNFNSQNDVSNYSISQLIQQLEQNRTNNQLVDQILLKVQRSLINLIKRKY"
FT                   /protein_id="XP_626690.1"
FT   gene            complement(<330813..>331499)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1130"
FT                   /db_xref="GeneID:3374169"
FT                   /locus_tag="cgd3_1130"
FT   mRNA            complement(<330813..>331499)
FT                   /db_xref="GI:66359025"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1130"
FT                   /db_xref="GeneID:3374169"
FT                   /locus_tag="cgd3_1130"
FT                   /transcript_id="XM_626691.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(330813..331499)
FT                   /locus_tag="cgd3_1130"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359026"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1130"
FT                   /db_xref="GeneID:3374169"
FT                   /translation="MAFNIFVEYLYILVIFKVNYVISIRNNKSSNKNPTSILNKLGEYS
FT                   VDLKIIELQKKVDLCSSTLSKTNNELISARLRIAGKQSNSQEIDNNKSEEEIIDELTKK
FT                   IQEINQECNSFVDLLLLKRIYRFSQITLDENINTEIQVKEEINNVIRNLVITENNAPFI
FT                   RSLINKAKCNNFSINEHCKLLTSKLLYYMAITPKEIIENFENVQLVDTELAQNCTIQKI
FT                   NNENQV"
FT                   /protein_id="XP_626691.1"
FT   gene            complement(<332977..>333897)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1140"
FT                   /db_xref="GeneID:3374168"
FT                   /locus_tag="cgd3_1140"
FT   mRNA            complement(<332977..>333897)
FT                   /db_xref="GI:66359027"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1140"
FT                   /db_xref="GeneID:3374168"
FT                   /locus_tag="cgd3_1140"
FT                   /transcript_id="XM_626692.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(332977..333897)
FT                   /locus_tag="cgd3_1140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359028"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1140"
FT                   /db_xref="GeneID:3374168"
FT                   /translation="MFTYSLVFVILSVIILPCDIIPYKYGSFNLFLNNWLSISENNRFN
FT                   IFSFSQLKKSQGLTRFSGFEMLSQLEDMNPEEMFEKIESRDESWLLQLTTNELELLLDK
FT                   LKFLLDLQLNRHNELLSTLQIELSESQETVNELKVSEEFINKLLKCILVLLTQIVEKKL
FT                   FKFEISLKQLKDSNRFTELELIQRELLFLQEIKDFIRNLFFVYYCKNPLVMNSSLCSFL
FT                   TSVYSDTEAKFLSKTENLYEAYDKYENEWEDINDESIKLMNKRKKKKSNLKKKKFKSKA
FT                   KRINFKKTKLKSRKKVKYQRKFNLN"
FT                   /protein_id="XP_626692.1"
FT   gene            complement(<334767..>335738)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1150"
FT                   /db_xref="GeneID:3374167"
FT                   /locus_tag="cgd3_1150"
FT   mRNA            complement(<334767..>335738)
FT                   /db_xref="GI:66359029"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1150"
FT                   /db_xref="GeneID:3374167"
FT                   /locus_tag="cgd3_1150"
FT                   /transcript_id="XM_626693.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(334767..335738)
FT                   /locus_tag="cgd3_1150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359030"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1150"
FT                   /db_xref="GeneID:3374167"
FT                   /translation="MNLSFIYVMGFFPVKFFPILFFSITINNGLFSRNYEESLIDFSLS
FT                   QLSAESESNDGSSRSLRSFLSLESFESCFSEFQSQSSYYTALDYGSDDSTDKVPCEFEC
FT                   KYSKEEILKSIRKGNYKKLKKIRTIFLEELMDEIITKVMNIILNYERQMSRKENLLAQY
FT                   EVHKQLNKNKIKKIKKEIKLLKLETDCYLTRLDLYLYNLFKHLFSIKIKNFKSTTKVLK
FT                   SSLHYNKINSLQREIAFNYELLSFLEAAFLHYLCNNGLFANRHLCAFILKQSLKITKFN
FT                   EKIISLHKKAIDKIGVFTRPDSGSESRLETIPEEPSNSYEPF"
FT                   /protein_id="XP_626693.1"
FT   gene            complement(<336403..>337890)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1160"
FT                   /db_xref="GeneID:3373991"
FT                   /locus_tag="cgd3_1160"
FT   mRNA            complement(<336403..>337890)
FT                   /db_xref="GI:66359031"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1160"
FT                   /db_xref="GeneID:3373991"
FT                   /locus_tag="cgd3_1160"
FT                   /transcript_id="XM_626694.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(336403..337890)
FT                   /locus_tag="cgd3_1160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359032"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1160"
FT                   /db_xref="GeneID:3373991"
FT                   /translation="MKRSKFSLLYIILKFFILFIFFVYLKTRHDLIKYDHTLTQNNFKR
FT                   SHSSKLNQFYQILSISFINNGPTNANGEGAKDISDNESGTSSTSGNPSPNNEFDSDNGK
FT                   QDKTHSMKICRSSSCPNLGPISSSRSNSSSNHNSNSEIKSRSKSEPWLRSKTKSRSKTR
FT                   SRSKTRSGSKTRSRSESRSRSGSRSRPITVMKKRSKSDSSVNPKPTTSKPAPLNLEDRI
FT                   GSSGPLSSKEELGIYCLELSVEEVLKILQSKDTSRLSDVSSFSLSMALDELIFMNSSLY
FT                   SKLVDLEKAIQREKSKLNPEDRNYERRLSTLKDFTKTESSGIIKQSEQLFKLVQILFEI
FT                   LYSRKIQAFESTTDAIISQNSDPKVITSRRIVFSSELISNLTVLYNMLHCNQSFLSSLL
FT                   FCRFLQDYIENNRRVNSALTKYMMSLEESNGVIESSSKVNRGRKSKRKTRMKKKASRSK
FT                   SLLKDPECENQEKKIRKLDSKFRKLFTSSNIGLESIE"
FT                   /protein_id="XP_626694.1"
FT   gene            complement(<338793..>339695)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1170"
FT                   /db_xref="GeneID:3374166"
FT                   /locus_tag="cgd3_1170"
FT   mRNA            complement(<338793..>339695)
FT                   /db_xref="GI:66359033"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1170"
FT                   /db_xref="GeneID:3374166"
FT                   /locus_tag="cgd3_1170"
FT                   /transcript_id="XM_626695.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(338793..339695)
FT                   /locus_tag="cgd3_1170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359034"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1170"
FT                   /db_xref="GeneID:3374166"
FT                   /translation="MLFKCLLCIVFFSQISNIKHCAPAPDIVRKSHKKHGVEFNAEISL
FT                   LQTGARSLSYGFKRQASGGIPPDPYENLVELYEAEYNPTATVGLLQKYNNVFLRTLSKR
FT                   TLENTQDFLVRALRSDITDCIILEEKLDVKLSVYLVEPEKFHEEIQILLTNYKAMIESK
FT                   VESIAKYSKILTRVMSSLLSRMIKEYRTTSYSLFKLNNDNIQAIQRGLSFYQGLVSYLT
FT                   DMGRMLSCNHNYMKETALCAFITTSIADYSSRYSSLIETLPGTKEYQMFEDIDHEEDIK
FT                   EKKIGKSVGKKGKHGTKKK"
FT                   /protein_id="XP_626695.1"
FT   gene            complement(<347128..>358734)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1180"
FT                   /db_xref="GeneID:3373941"
FT                   /locus_tag="cgd3_1180"
FT   mRNA            complement(<347128..>358734)
FT                   /db_xref="GI:126644582"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1180"
FT                   /db_xref="GeneID:3373941"
FT                   /locus_tag="cgd3_1180"
FT                   /transcript_id="XM_001388062.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(347128..358734)
FT                   /locus_tag="cgd3_1180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644583"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1180"
FT                   /db_xref="GeneID:3373941"
FT                   /translation="MKISIPKGDNYILAVSSLPQSQRELILKLSSDDVTNYDSYLDSFQ
FT                   RWIWDKGDLQCWASVLNRFDDYINSYIIREELGNPFLLQHLTLTDESTELSHSNENILK
FT                   QANGYIRDVSEEMMKKILKSTFLILENCTSKSLYASTIGLIALLDSSNPDIVCWSLRTL
FT                   TTTCSNWKKPKRYIDSETVYHLQMRLSTLCYLPIHTRSSNKSGIENKENEALSSLTSFY
FT                   KEETWKNPDDDDLIEVYIPPFICNHFIRKDSDSEEKECKMCFDYHKSHILMIQFKDLIS
FT                   VNSKPEVDDLMRKYKVPICLKSIVNHYVRILKSYSDKWLRRKWVDVKYTTLLSFPGFST
FT                   NNLVNICQVNTTLIPDSIEILEFCHLSIFEGNSKVKLNNNNEQYRFITSMRSIVELLTL
FT                   MLQDRIFPKVIVQALNFTNSYGLISRIIWDILYYINDHKDRPLPKFIKKPPESLNQYKY
FT                   NDQNLSNNLLDFEGDYSQFNILEYIDPSIFNNVNYPLPDQVIQRLSEIQINYDKIEENN
FT                   GNEDGENCYYKGNKLDNQTSVELHKKYNTSLSSYMDLESAKDEILLINNYYENLDLEFQ
FT                   KKTINDSSKIIPNLIMAEFEEEMINFVMELIGIYILVMQLYPPPNSIVTNSSSSSTSYI
FT                   YIPHHITILIAFIDFISTIRHPYYIILVLPICRALETLLEKKTYISFLLQQNKPIYKIM
FT                   LSRLQYEIGLLQSEKYYFDSPKEEYKNKIIKDEGVILIRQWIIKTSLKFMELFIHPNNN
FT                   SLVSNSDSNPIISQSKIQYELLMSEDSIYRSCLMLILMYPETYSLLNYSLVIQLLIPLV
FT                   SNDPTIVPDLINNHLIPFILYSINFGILQNDDILNILAVNLPIFFLHNDGIKLMKSINF
FT                   KPLILLSQFLTSSHAIHIDRMGEIATLVGNAFEEIVRYHSQLAKTISLISVSAILQIRF
FT                   IQKCLPKWEPISEISKESLDSPEEYYTPIKIPKKSKDLLISDRMAIVGRFLCGYLSNHD
FT                   TINQFILQGGPYHVLRSIVDDSLPPAFAAILTNHPLISLFTFLGTSRNISIADLQYQVL
FT                   PTLQEACKDFKNVEVDHNSISRLSKVVTCIFAINCMFRNAANYNHSRIVQSYLISKDIV
FT                   KLQDSTSPCDYCPYGASIMSLYNQAVNMIAPIFPKLLEFLYFNASEKYLQDSLLSNNNM
FT                   SASLLNPSFQSHAHPLLIKKDNSSNNQPTNTQNNSSGINNAQESPTCSTSYPVLSVWPQ
FT                   LSVNDFLWSTQIKYAYSNVVYYEQNSENLSEISKDTDLMPIIMELCRISCCNIRSCLIL
FT                   ASRLTNTFKKKNNASLLFRNDXGXPXXLXXXISXXXXXXFSNCRPFLXXFXNLFQNCPX
FT                   HLKILIIPVLRXLXTLCMSFPLLHAMNTRKHEMGQICCYIAEIIDVFYRVCIDDKQNNT
FT                   FYIFLIDLSYKTGIFEKIMSLFHFSMSTYWMVLGKXIGKHNTENVNKMLPPLNPSSRLK
FT                   YSSEFLGQLSEYILPKLSSVHNLNGLLYLATKSMHNNILLLEHFSSWKRYLNSTXTTHL
FT                   HKSKFHLNNCXPIISNTNSAELNIFDSSLDSFFRMEFNSVELTESILLMIITNIQLWWK
FT                   EVLTNYYLDMAHNNWLIFYPIRCLSSTFKIMLHIFDIQSDSFNSFVAKNFDQSNDKTVK
FT                   XNSISDADARSSSSTSNDNLQXSSNLNIDSSVQNHDASLTXQDENTVNSILERLNMMGF
FT                   DSRVSEHAIFCFGNNIEVIVEYLTGVTERNENKTMISEEAGNYMYSFRRIGKVLSEQFE
FT                   LGKLIXYKTLSKEDKKSEILRXYSTLPSELYYLSKNVYYSSPIVCDIMLKFSPLLKKIN
FT                   MLEKVLFHIYTSMKMLLERNQSVFSXESSNHRYQFIKEELSFLQDEXLNNDKFPIIFNS
FT                   FYTSLNNSTPLIDSNSNFNKLNYQEIYSNLDXYSKKCAPTKKIHLSLIPDLSLLSILLY
FT                   KKTDLKSFWISIDSNYIKLTSTQNKNSSKSKNKSNISNSNTEQVPEQSFHPINSLLSFV
FT                   NIFTQGHYIFDSXHDGFTFKNMEKYIRDNLGEGNGQXTGQNNQNGNNINSNSNSNNMKS
FT                   XQRPSSLVWIPANKETESKEYNDKGIKLASRCPIWFEYFCLILWRLLPIFEQSIPVSES
FT                   SNTPFLVSQKNQKDIIFTMLDILTHFPGINGSTSMAVLGVITILTRXFNNSLLLLSYTP
FT                   FYMIEMHKNKDKTQNIACMCMGNTLGGGLGVLYRLPKTAYFDGILQVLSLITIQVLEDF
FT                   TILTQLIENKLDELFSKQLSTQIQSGEIYGENLQVVNXTENNTENQENENPNSCKYFSF
FT                   YPRSFTLNYKKDLKLLEKKEIEYPFIVLSLNSVIGELFPYIQRCPEIFYQVLNYFCVLH
FT                   SIKTGNESSSNSKXNSEDHCSDXNYKAKSEPXENDDVLMNDENKXKDDSAFTXIKYTTF
FT                   NDLMENQEIYSKYNIPVNENLLLQWKPLNYRNSEATQEEQNKYLELKEKLKYVQGDSAL
FT                   RPSSTCMFILMSIFDHMVLFGEIXNKSKFGKKRGINSCLRGRKDDEIFSLSLDSLTYIM
FT                   IRIALTYPVNINRISKVPILSICNENNARLWQEKKREFYSYRYRNSSNLKLGVSCFCLN
FT                   LQKSLSTIDSENKKELKAALEQEFSGISTVIPNIHSLTNNIIKFKPYSFEFLLNQLFVT
FT                   QSLKINFLPFIFRNIASYIVMNSINCMTSMPTCTCKKCKQAGSPSSGTEENSPLKMAGW
FT                   QLNLDWQTYNLKCMPNLSTIKKSNIKDVHFMEMDHFIYFLHILIGWNKFVLKKFMVYTV
FT                   NSLRNLLASLDKFKGNSNRHNWRSEYVNSYFLLNILQYLIVLLQVYPSISDPGLLRKAS
FT                   IYNILSKLYVKLPYSDLSNIILFCMKNLIYSRSVMMPNSEXLAAIKEGSLDSKVKKVRN
FT                   SIGVGNGNDQLXDDQLEVDLDQFGFQFNSSDEDFDDDLDDSLEDDFSEEFDLTSLDGLD
FT                   XEDIDDBDEDDDDNDVEDMDDDXEDDVEDDEDDEXDDLFLDETMINDGVIDIEGEDDDL
FT                   SNDDIVGDDDLTSDVDDVDDDDDDDDDDDDDDDDDDDDDXDDDDEGDDEDGMNFDESDM
FT                   XSGMSSEDSDVDELRRTPRIRDEYEFNYIYQMNNQTNINGLEDVPMNTSSEEVEEDGGE
FT                   NINEILMRDAERNGQNRIILNNLRXSAFRRNTSTGGGSSSSRRRSGRGYNRSIRDDLDN
FT                   DLNFDDDEDBDLDIDDLDDEIFGEEYNSEEDNEDINILQGINNIVTNTNITPTLLISDG
FT                   VNNTVVQGTENSNVTGSANXNSNSDNNINNNNNNNNNNNSSSIEQXSELEQALPEQRNE
FT                   REATEESEAXXENSNNGAGYSXLRTPPHPLRREELISNTTIRNSNQLNEVNENILGNEV
FT                   SPAPLRRRIASQGNNYLDDMMMVLLREDDDDFEIDNLQFLEDLSSLGGVXGSAGLSLGG
FT                   EGGRDDLQVQFLGTQGVGTGLLNNLIPNTNNTVYNESLNSSFYLDSTEAHWPPMPLNQR
FT                   NIFINSRNIPLXFLILNSLTFVPNTSNLNPPSNNDLILQWMSYGGYLTNPVLSHYNIGN
FT                   VRNXDSSGNSXGGSNNXNSFSINNSTNNNSQPAFGWHFHNDISLPTEHPFLTRNIIIDN
FT                   NMGINSSGNSNNHGSGSGNNNSNSHTNNLSWYSNGPLYDSQRSLIGEIHSSSLRNNSEL
FT                   SILMDAIRNADNLTNNDDXITXMQNNSNNGNGITNTCTEGGATSTNXNLGGXSSLRGSN
FT                   LNVSTLIRNIGDINRNNNLDRLLTDENNSTVSLIPLVLVSQATSFLRDAVSSKIPIETN
FT                   NINLFTTNIEQDEESDNHTFDLQERGDVICDNQLDDNTENMDSIQGGEEXXQHQDQEQS
FT                   DDDNEDDEXXXDSXXIMMMTALMMKMVKKLTKKAMKTWRMKDYWIAK"
FT                   /protein_id="XP_001388099.1"
FT   gene            <359068..>359451
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1200"
FT                   /db_xref="GeneID:3373838"
FT                   /locus_tag="cgd3_1200"
FT   mRNA            <359068..>359451
FT                   /db_xref="GI:66359035"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1200"
FT                   /db_xref="GeneID:3373838"
FT                   /locus_tag="cgd3_1200"
FT                   /transcript_id="XM_626696.1"
FT                   /product="possible prefoldin-related protein"
FT   CDS_pept        <359068..359451
FT                   /locus_tag="cgd3_1200"
FT                   /gene_family="HOG000196242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible prefoldin-related protein"
FT                   /db_xref="GI:66359036"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1200"
FT                   /db_xref="GeneID:3373838"
FT                   /translation="AILEEIEVKMASTSNEHELITKEFLETQKKFEQINERRRILVAQE
FT                   SENQMVSKELELLESDAVIYKLVGSVMVKQSLDDAKSTVSKRLEYITGEIESVNKSFES
FT                   LQSKLVEKSNQVSYNYQLFITFF"
FT                   /protein_id="XP_626696.1"
FT   gene            <360691..>362085
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1210"
FT                   /db_xref="GeneID:3374165"
FT                   /locus_tag="cgd3_1210"
FT   mRNA            <360691..>362085
FT                   /db_xref="GI:66359037"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1210"
FT                   /db_xref="GeneID:3374165"
FT                   /locus_tag="cgd3_1210"
FT                   /transcript_id="XM_626697.1"
FT                   /product="hypothetical protein having a signal peptide,
FT                   conserved region, and three or more transmembrane domains"
FT   CDS_pept        360691..362085
FT                   /locus_tag="cgd3_1210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein having a signal peptide,
FT                   conserved region, and three or more transmembrane domains"
FT                   /db_xref="GI:66359038"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1210"
FT                   /db_xref="GeneID:3374165"
FT                   /translation="MKEVAELHLSALIIITLLLSFGSALFSGLTLGMMTQDLLHLKISS
FT                   SSKNNKNAAFYAKRLLPLRTNGNFLLVTLLFGNVTVNTGLSILISELTSGWLAFTVSTI
FT                   LIMIFGEIIPQAICSRYGLYIGGFFSPFIRLIQIILFPLLKPISVILDKAVGKTNEKIY
FT                   TREELNTLLEHHSKKDIISVYELGLIKRVIFSNFTLSDIMIQIDEFHIYYIDSQLETNQ
FT                   IEDFIKKGISKLYIIDNHSTYSELFKDDFQQCLTYTKKNDIIYLDIPNTNDHQSNYIEY
FT                   SNSPITSETYDSDCSICNDSPHSKSGIILGYIDLDQLSKQNKIFQNKNNSNRISTIVNT
FT                   KSFIRLTNIVISNKMMDLIRNKDTLSILTSISNIKDKILCIQGSTSISTLFNVLCQYNL
FT                   SQNDIIIIYSTIGNGHKIRYDGVITLTTLYEYMFSSEKYVVNELKEDICSNLLLKHQHP
FT                   NISSYF"
FT                   /protein_id="XP_626697.1"
FT   gene            complement(<362294..>363166)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1220"
FT                   /db_xref="GeneID:3373992"
FT                   /locus_tag="cgd3_1220"
FT   mRNA            complement(<362294..>363166)
FT                   /db_xref="GI:66359039"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1220"
FT                   /db_xref="GeneID:3373992"
FT                   /locus_tag="cgd3_1220"
FT                   /transcript_id="XM_626698.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(362294..363166)
FT                   /locus_tag="cgd3_1220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359040"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1220"
FT                   /db_xref="GeneID:3373992"
FT                   /translation="MRTVYTVNTRNKFAALSLSDDEDDQQIITKQEPVKSTAGNKENPS
FT                   SLIYPKNEVTPNAPASALDTTSKMSRGARKGNTVHRGGRGGYTSSHGRVFDRRDASGKA
FT                   HRVSKQNDSAGIEDEIIDKEKKYNNTNSSDVASNNQLDDNVADSEESQNKVDETKEKES
FT                   QMISYEEYMKKMAPKRLEVPKTEIVKGNTTAKDFEKEGLQRYVRDDGSNTTTNKNNKNK
FT                   ANKNNTKSDKGVFNYFELVEKYTSRNSYNRRGNDDRRNRGNQRPNSSLQVRREAPDVSD
FT                   TRAFPVLGQ"
FT                   /protein_id="XP_626698.1"
FT   gene            complement(<363535..>364644)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1230"
FT                   /db_xref="GeneID:3373993"
FT                   /locus_tag="cgd3_1230"
FT   mRNA            complement(<363535..>364644)
FT                   /db_xref="GI:66359041"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1230"
FT                   /db_xref="GeneID:3373993"
FT                   /locus_tag="cgd3_1230"
FT                   /transcript_id="XM_626699.1"
FT                   /product="SPAC14C4.06c-like PWI+4CCCH domains"
FT   CDS_pept        complement(363535..364644)
FT                   /locus_tag="cgd3_1230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SPAC14C4.06c-like PWI+4CCCH domains"
FT                   /db_xref="GI:66359042"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1230"
FT                   /db_xref="GeneID:3373993"
FT                   /translation="MESSSGGGSSVGEVVTPEVQSKITSKLQEIFGDDDVSVLTDYICH
FT                   MVNHNQPKEHIINELKEFLSDEASQFGTWVFQLVESSKNDYSTNNNMPNINHDNGLGKN
FT                   NSSPNDTHKSSTQSNQNKDSLDFAISNAIKNKSGSGRSKPFQPASSHKNNHSLINHESS
FT                   SGPMVGNNRLPRVNYRNAPYTRSNNFNQSGAPYNSSNQAANSSTGPSSTHGKIKIRCKN
FT                   WPNCDKGDHCFYIHPSEACKSWPLCPYGPGCFFIHPTVPCRYGLACYNSLCNYSHPNGW
FT                   DPNHVEAPVFKYGGYKNSSLIINNNKQSQTIGNANSNSAESNNDNSTNTISINLNQENT
FT                   DMPSYDSNCNANTGHFNLESEKNNSFGHN"
FT                   /protein_id="XP_626699.1"
FT   gene            <365006..>366376
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1240"
FT                   /db_xref="GeneID:3373990"
FT                   /locus_tag="cgd3_1240"
FT   mRNA            <365006..>366376
FT                   /db_xref="GI:66359043"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1240"
FT                   /db_xref="GeneID:3373990"
FT                   /locus_tag="cgd3_1240"
FT                   /transcript_id="XM_626700.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        365006..366376
FT                   /locus_tag="cgd3_1240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359044"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1240"
FT                   /db_xref="GeneID:3373990"
FT                   /translation="MKEDSNHGLLLDVPFTSPICTINSTDDKILVGTWDGYFYQICLNK
FT                   KDDVVTVQIEPSYPIRYISALKDSNCEVDPHTGAQKSYELILGGTYRTKVRMKNRINSP
FT                   ITPLEELEISSDSHYQIIETRSSLEPFESHTKGIEFGNKYHGGPLFLFSSTINSYFGFN
FT                   SEKGEIEILIGNFNLPDREFVILDYDFLNNHLLIVERSPERLDYYALCSLQILELPNSQ
FT                   NYLQEEVDSSNITNLAEIPPKYILNFPIKNPLFITSNIKSDLTLNSSAEYNNFKDSTHV
FT                   YKYLYSTMFSISDFKKRPLNIFKSMYNLCDAKFWGFNSFIFLVSNHTIIAIDVLFSKDN
FT                   EFVTNTNTKCKFCIKSPDRNITSISTTNYNYLVALTEKNRIFLLNRNGEIVYSISNITP
FT                   NKSNFRWVWPAHVFVTHTGTIIFSTTKGLYYIHCDLLDKRKTQFTKNQSFIIDLPNN"
FT                   /protein_id="XP_626700.1"
FT   gene            <366851..>367761
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1250"
FT                   /db_xref="GeneID:3374065"
FT                   /locus_tag="cgd3_1250"
FT   mRNA            join(<366851..367140,367673..>367758)
FT                   /db_xref="GI:66359045"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1250"
FT                   /db_xref="GeneID:3374065"
FT                   /locus_tag="cgd3_1250"
FT                   /transcript_id="XM_626701.1"
FT                   /product="ribosomal protein L14"
FT   CDS_pept        join(<366851..367140,367673..>367758)
FT                   /locus_tag="cgd3_1250"
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L14"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359046"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1250"
FT                   /db_xref="GeneID:3374065"
FT                   /translation="KMTLFTRFVEPGRLCRIQYGPDTGKMCFIIDVINMNRILIDGPST
FT                   NVARQSIPLKRLALTDFKAKIPRGARTGTVKKILEKDNTIENFNKTTYGQKCAAKIFKA
FT                   NMTDFERHALLVARKKRQYLV"
FT                   /protein_id="XP_626701.1"
FT   gene            <368216..>369016
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1260"
FT                   /db_xref="GeneID:3373988"
FT                   /locus_tag="cgd3_1260"
FT   mRNA            <368216..>369016
FT                   /db_xref="GI:66359047"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1260"
FT                   /db_xref="GeneID:3373988"
FT                   /locus_tag="cgd3_1260"
FT                   /transcript_id="XM_626702.1"
FT                   /product="RING domain protein"
FT   CDS_pept        368216..369016
FT                   /locus_tag="cgd3_1260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RING domain protein"
FT                   /db_xref="GI:66359048"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1260"
FT                   /db_xref="GeneID:3373988"
FT                   /translation="MGNLIERENRGVQYPVREQITRRLSNTEYIFSEALNRNDPRISLN
FT                   NEKQEKKLISVSKSKAIQNQCHINGLSIRYIPSLKRMRFEYDCIQDSILNIYNSNSLEE
FT                   NLINTEKPIFSHIVPKSLNKEFQCDLKSDLKQNFVLEIKPKSSSTNNTETIQLTFCEQI
FT                   PKKANNALESQIEIKRQCVLYNGKAFEIQNIFGLSNKSSKASKNDEDSEKCVICLTNNR
FT                   ETILLPCRHACLCKICSNTLFKNTQDCPICRNSVLGVVNIEDSK"
FT                   /protein_id="XP_626702.1"
FT   gene            complement(<369134..>369724)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1270"
FT                   /db_xref="GeneID:3374088"
FT                   /locus_tag="cgd3_1270"
FT   mRNA            complement(<369134..>369724)
FT                   /db_xref="GI:126644654"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1270"
FT                   /db_xref="GeneID:3374088"
FT                   /locus_tag="cgd3_1270"
FT                   /transcript_id="XM_001388063.1"
FT                   /product="centrin, putative"
FT   CDS_pept        complement(369134..369724)
FT                   /locus_tag="cgd3_1270"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centrin, putative"
FT                   /db_xref="GI:126644655"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1270"
FT                   /db_xref="GeneID:3374088"
FT                   /translation="MKNIMRSRPSSSSSLGVNGISGLGGGSGSNLGGNGIGNSYMGSVS
FT                   KRTELTEQQKMEIKEAFELFDGDSIGYIDIKEVKVAMRALGFDPKKEELKKILSNVELN
FT                   NGMVSYNDFYDLVETKILQRDPKEEIIKAFKLFDDDETGKITFKNLKRVAKELGENISD
FT                   EEIQEMIDEADRDGDGEINQEEFIRIMRKTNLF"
FT                   /protein_id="XP_001388100.1"
FT   gene            complement(<369952..>372090)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1280"
FT                   /db_xref="GeneID:3373989"
FT                   /locus_tag="cgd3_1280"
FT   mRNA            complement(<369952..>372090)
FT                   /db_xref="GI:66359049"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1280"
FT                   /db_xref="GeneID:3373989"
FT                   /locus_tag="cgd3_1280"
FT                   /transcript_id="XM_626703.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(369952..372090)
FT                   /locus_tag="cgd3_1280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359050"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1280"
FT                   /db_xref="GeneID:3373989"
FT                   /translation="MELNSDKNFSITGIRKKTRKAVRPEIGESNIGIGCTSISRPSLMG
FT                   MEKQRQEESNLSSLFSKRTSALKAEKKSEPRDENKVEALRQNLGSMGLNNRNREINDGK
FT                   SSILKKSFKEDMIEKTVVVATEDTDAQIELNSTTNCPFLVGSGSEASYERSSEVKTVLR
FT                   KSRYDYEQIYDEDSVSLKDLVSNLNSESMGVFGTSHDIEELSKWFSKMVGKFETFGLNI
FT                   QSKLERLEQDLEENTKDLKGYGGDLEQVGINKTTNREEDENNLQNEPMSISERYSELIR
FT                   LKNKLLEELSNVENEIMLEEMRIKKEESERRIRIEEYKSTRQVYKDELSSLTIIICWIE
FT                   ECLQNFVYPIQRKQSEYKLEISREGDLLKLIQEEISKIEKQEKVVLEKLREIQEIKRYK
FT                   GEEKELLEEQIRLSQASKSDKIKNANFKEASMISQTIQVLQQEVLELEDSYSSVLHQEK
FT                   EFMEKIERIRKSRQDEINRMDACKHEVLLNRKQRRQQLKLKVEQLKECKFSFDSEIFSE
FT                   NTSFILNLLSEKFYSQINSVLSFEIGLINQHDLEDGKEHGNVQIQPQQKQAESTEHSSQ
FT                   LENKQPDAITGSESELKPEHVLEEESPPSLNYEGVTVEYKHSEIQSEKEISSFLDNNYN
FT                   TNDNNSSFDDRSGFDDKDYESQALSCDLVCTNNAHIARKADSDIYHETEIVSSSSSKKE
FT                   SGGESTNLDDPTQNSLSF"
FT                   /protein_id="XP_626703.1"
FT   gene            complement(<373119..>373940)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1290"
FT                   /db_xref="GeneID:3373836"
FT                   /locus_tag="cgd3_1290"
FT   mRNA            complement(<373119..>373940)
FT                   /db_xref="GI:66359051"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1290"
FT                   /db_xref="GeneID:3373836"
FT                   /locus_tag="cgd3_1290"
FT                   /transcript_id="XM_626704.1"
FT                   /product="14-3-3 domain containing protein"
FT   CDS_pept        complement(373119..>373940)
FT                   /locus_tag="cgd3_1290"
FT                   /gene_family="HOG000240379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="14-3-3 domain containing protein"
FT                   /db_xref="GI:66359052"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1290"
FT                   /db_xref="GeneID:3373836"
FT                   /translation="ILRTQHTIRDSELNIKNSKMSDSVNARESNVYMAKLAEQAERYDE
FT                   MAKYMKDVVEARQESEELTVEERNLLSVAYKNAVGSRRSSWRIISSVEQKEHSRNAEDA
FT                   SKMCGKYRSKVEAELTDICNDILTMLDKHLIPTATSPDSKVFYFKMKGDYHRYISEFST
FT                   GDSKQSSAEDALKAYKDATVVAKDLEPTHPIRLGLALNFSVFHYEILNEPRAAIDMAKE
FT                   AFEMAIEQLDKLSEDCYKDSTLIMQLLRDNLTLWTADLGASGEAEGAPEAS"
FT                   /protein_id="XP_626704.1"
FT   gene            complement(<375082..>375591)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1300"
FT                   /db_xref="GeneID:3373837"
FT                   /locus_tag="cgd3_1300"
FT   mRNA            complement(<375082..>375591)
FT                   /db_xref="GI:66359053"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1300"
FT                   /db_xref="GeneID:3373837"
FT                   /locus_tag="cgd3_1300"
FT                   /transcript_id="XM_626705.1"
FT                   /product="60S ribosomal protein L12"
FT   CDS_pept        complement(375082..>375591)
FT                   /locus_tag="cgd3_1300"
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L12"
FT                   /db_xref="GI:66359054"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1300"
FT                   /db_xref="GeneID:3373837"
FT                   /translation="ITMPPAGKADPSEVKYLYIRQLGGEVGATSVLAPKLGPLGMSPKK
FT                   VGDDIAKGTAAWKGMKVCVKLTVQNRQAKIDVVPTATCLLIKELKEPIRDRKKVKNIKH
FT                   SGNLSMNQVISVARAMKFKSRAKAFSGTVKEILGTCNAIGCTVDGQKPVDLQKMIDAGE
FT                   IEVPTA"
FT                   /protein_id="XP_626705.1"
FT   gene            complement(<376193..>377113)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1310"
FT                   /db_xref="GeneID:3373987"
FT                   /locus_tag="cgd3_1310"
FT   mRNA            complement(<376193..>377113)
FT                   /db_xref="GI:66359055"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1310"
FT                   /db_xref="GeneID:3373987"
FT                   /locus_tag="cgd3_1310"
FT                   /transcript_id="XM_626706.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(376193..377113)
FT                   /locus_tag="cgd3_1310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359056"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1310"
FT                   /db_xref="GeneID:3373987"
FT                   /translation="MTEISEGQTELLQAFCEITTCDITTGRTILESTNWDLENAISLYY
FT                   EQQNANVYEGNNFNITEQVNTNNITVNQYENLNEQQETNIDQTNEGKHLNTLKLKKCFK
FT                   MFLSVCGTSLSAIFGFFKTLFCVPNLNNRAQDNVSIRNFNRSVISQIEQVQIEEARRIR
FT                   EEQDLEYMRSLNLDSMKQEKALEKKRTKDLIRERREKLQAEFQQDRDIEQESLSRVCVK
FT                   NSAGKKFQRNFHKDDSVYEIFKWIDSLALDKNNLISDKFSLRLPHSKSVEIDDSYADKE
FT                   ITISEIGFYPNTLLLINNFDEDSDD"
FT                   /protein_id="XP_626706.1"
FT   gene            complement(<377549..>378148)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1320"
FT                   /db_xref="GeneID:3373986"
FT                   /locus_tag="cgd3_1320"
FT   mRNA            complement(<377549..>378148)
FT                   /db_xref="GI:66359057"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1320"
FT                   /db_xref="GeneID:3373986"
FT                   /locus_tag="cgd3_1320"
FT                   /transcript_id="XM_626707.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(377549..378148)
FT                   /locus_tag="cgd3_1320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359058"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1320"
FT                   /db_xref="GeneID:3373986"
FT                   /translation="MVGDGFDELSPGSSQTSNEDVFNMDEEMEYSGAVKDYSMNTTSSR
FT                   VVENEDSGILSNEMVDLVLDYISYKAGEGSNVTGIEKVDSTIQNCRNSGFKKSIILSYL
FT                   VSSGYLDLNEGVENGEPIEDSLSYIQSMLHQKSKYIPENIEEITLAISSATKLFILELM
FT                   AKINKQLNDSGSNKRVITTKHVYDAYISQEKLIPDL"
FT                   /protein_id="XP_626707.1"
FT   gene            <379040..>380584
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1330"
FT                   /db_xref="GeneID:3373985"
FT                   /locus_tag="cgd3_1330"
FT   mRNA            <379040..>380584
FT                   /db_xref="GI:66359059"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1330"
FT                   /db_xref="GeneID:3373985"
FT                   /locus_tag="cgd3_1330"
FT                   /transcript_id="XM_626708.1"
FT                   /product="hypothetical protein having a signal peptide"
FT   CDS_pept        379040..380584
FT                   /locus_tag="cgd3_1330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein having a signal peptide"
FT                   /db_xref="GI:66359060"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1330"
FT                   /db_xref="GeneID:3373985"
FT                   /translation="MRNSHFLGFLLLLLLVLSKQGEALKVKSFFFGLGGGDKKEEKNEN
FT                   KQEQGPKSTQDTNGINPAAGVSKSEGNPPENSSKPPEEAKKPEGSHPEEKPPVEAKKAE
FT                   GGHSEEKPPENHPPAEGGEPKQDNLPFIPSPPPPPPSIAPEHEPEHPPSSSPPPPPPPP
FT                   PPPPSGCSCGNEKPLSDCCHETVYGEKKTGEKRNATITGTITGTITDSVLTAKTGDEIT
FT                   VKHNSDKPTPECERSNKQSVTTVTHEAHTNLHSVQSGKLPSLEASPNVGKSKFPNGANF
FT                   IPLVLDANTGQYGVELKTMDLLVTGQDEKIKPFDMLIPFVNESGQIKFVTRRRLRQLVK
FT                   SGLSKGFLEGVPPFTQEAMVEGAAEPKENNEEKNNEEKKSEEKNDEKKPEEEKSSESSA
FT                   AEKGKEAANSAKSLLQEAETVLTGGSLFEPSEKKEDDNKKEEKDDKKDDDNKKDDEKAE
FT                   EGESSSEKKDSSESEETSESSGSETSKSSKSDDVDSAMGAQDSASVHASEEEEEEE"
FT                   /protein_id="XP_626708.1"
FT   gene            complement(<380837..>382603)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1340"
FT                   /db_xref="GeneID:3373984"
FT                   /locus_tag="cgd3_1340"
FT   mRNA            complement(<380837..>382603)
FT                   /db_xref="GI:66359061"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1340"
FT                   /db_xref="GeneID:3373984"
FT                   /locus_tag="cgd3_1340"
FT                   /transcript_id="XM_626709.1"
FT                   /product="NMD3p like protein involved in nonsense mediated
FT                   decay"
FT   CDS_pept        complement(380837..382603)
FT                   /locus_tag="cgd3_1340"
FT                   /gene_family="HOG000168152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NMD3p like protein involved in nonsense mediated
FT                   decay"
FT                   /db_xref="GI:66359062"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1340"
FT                   /db_xref="GeneID:3373984"
FT                   /translation="MMFDSNDGGRMVGSMENSQMHMDANATVYGEMDGMSYRVERPKYM
FT                   NCCVCGVATEINPSRMCINCIRSEVDITEGISRQAIISFCRQCERFQKPPWVSCQLESR
FT                   ELLALCLKKIKGLNTVRLVDASFIWTEPHSRRLKVKCTIQKEVMNGAIIQQSIVVEFFM
FT                   QAQQCDDCRRSFTPHTWNTVVQVRQRVEHKRTFLYLEQLILKHGAHEKVSNIVEKPDGL
FT                   DFQFQQKSHAQKLVDFITHYFASKVKNSRQLISQDLSSNTHNNKFTFSVELCPICKDDV
FT                   VFIPKNLCISLLGGISSLLLCKKITNRISLIDPFTGREADLTKEKYWQYSGSNGSSFIP
FT                   LLSRSSLVDFYVLNVERINTTGKHSAVGSDHNQGKNNKVCIAEVEVCRESDLGIPDSSV
FT                   IVTTHLGAYLNSGDWVSGYDFRTLNNFGVVEDISEFVQWRERNHDVILVKKVFRKNQNN
FT                   LDSSIQRPWVLQRLPKEQLAFDNANSKSSFNQDLEQFKAELEEDSEMRRDVNLYWDPRI
FT                   QESSREIYQKARKPRHLVKKDKLSKNQSQGQFESDDMIMDDEGYQQDHDDEFSQQVDIS
FT                   ELLDGLSINDLQ"
FT                   /protein_id="XP_626709.1"
FT   gene            <383756..>386827
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1350"
FT                   /db_xref="GeneID:3373983"
FT                   /locus_tag="cgd3_1350"
FT   mRNA            <383756..>386827
FT                   /db_xref="GI:66359063"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1350"
FT                   /db_xref="GeneID:3373983"
FT                   /locus_tag="cgd3_1350"
FT                   /transcript_id="XM_626710.1"
FT                   /product="UB domain containing protein"
FT   CDS_pept        383756..386827
FT                   /locus_tag="cgd3_1350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UB domain containing protein"
FT                   /db_xref="GI:66359064"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1350"
FT                   /db_xref="GeneID:3373983"
FT                   /translation="MNREENPSGGSSEVSQENPENHEGIQNGENISEDWNPVEGDIRAT
FT                   VSNDRHQAQNNNLDTGIHTSNSLSSENYVVVGSSENEMSEEKRFKIVVRPLNGRDLTVE
FT                   ASQTSTIRQLKVLIEVQSGIEAINQRLIFRGRCMLDDDTVGTYIKEDGVIIHLVPYARN
FT                   QRNEGSAQPASESRSRASGTGGNAANIHNLFAATSGIPGLNTSIGGFPGAMMFGAIRLD
FT                   GETGLPLEAEDLMQRVLRTFGDAVNGNGIDQNLMNISTGTGDNRNLGSVTFDSFAVGQP
FT                   TTIPGFSGLISSTERSNQESLSSNTDANRTTTSASTGATANNSANSSATVTGTEGRRSS
FT                   NTNGANMNRSGSNTDSRLNNNSAQAQGNFRGGNGEGIRGDPMNSNPIGRIGTIVSRIFQ
FT                   AFNQPVGEGIQEGETRSEGRVSQAGIGNGTGLETGARADVGSGANQTVASDRTSGNTTS
FT                   QDVRGRVISSPASGLSWTQIASSGALNTGRTGVLPIGRPGLAVATIPISNFSIPITIRA
FT                   TSSTGIPSINLSQSSNTVASVAAPAQGESASARAPTDTGSTPSSNTNVSEAYRTSSNNF
FT                   FRNISNVLEESANQLRTVAAGIREMSGLEGPSRTEQNREGSSSSSSLPPIPSSVSSRSI
FT                   SGENLALSGQTSDYIQHHSHRLYISNEVVHRFLPWDSLNELMDILERDCGWRRPRITIP
FT                   PPVDSIDASPLAIFISVYLQAMSIVQSNLMQIQAWQERFARLDIPRLCYTVHLLALISH
FT                   ISAHIGSLLAWLFQNMAQHVEQDRLIEGLQWNRSSNEIENPIDIVEKRQDTSEETKGMD
FT                   VDEETPCELIGEDILNNANLNQDNQDIKDNTGNVAKMFERDSSSFGFNNANTNSSSNVG
FT                   YDQNNEEIINKLPDEIREKWERWTGNPQNFSRNVFASFSTRPFSDTYQQGDVFSSSSSF
FT                   GFSQPSNENGNTSGSRINSHPSSQELLRMIIHQTEANLNISSSSNSRNYTNIQAEYRSM
FT                   LIRDLINIARNDSDFLNNRSRFPYLQRIISLLYE"
FT                   /protein_id="XP_626710.1"
FT   gene            <387414..>388295
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1360"
FT                   /db_xref="GeneID:3373835"
FT                   /locus_tag="cgd3_1360"
FT   mRNA            <387414..>388295
FT                   /db_xref="GI:66359065"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1360"
FT                   /db_xref="GeneID:3373835"
FT                   /locus_tag="cgd3_1360"
FT                   /transcript_id="XM_626711.1"
FT                   /product="methylase"
FT   CDS_pept        <387414..388295
FT                   /locus_tag="cgd3_1360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylase"
FT                   /db_xref="GI:66359066"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1360"
FT                   /db_xref="GeneID:3373835"
FT                   /translation="ILDLAIMADYGTTEYWEERYKKDSNPYDWYQRWENMREIIKEYLK
FT                   FDDKILVVGNGTSRLPEEIYDDGYQSIEAMDISTVAVEIMHERFASRNIPCQVGNVLDM
FT                   YQYSDDGYDVVIDKGTFDSILCGENSHINIDTMMRELVRVLNYDKGRYICISYGQPNYR
FT                   LNYLKSMKEWEVTTIPIKKPANDQIYKLKNYNDEDSNSQENVNITTSTRPDLYHYIYVC
FT                   TVVNKNVPEIGNSLNLNDDENGDIKTDNDVELNADNIQDPNNFEQDLGENQEDERNEFQ
FT                   VPDENKVLENSI"
FT                   /protein_id="XP_626711.1"
FT   gene            <389676..>391142
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1370"
FT                   /db_xref="GeneID:3373982"
FT                   /locus_tag="cgd3_1370"
FT   mRNA            <389676..>391142
FT                   /db_xref="GI:66359067"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1370"
FT                   /db_xref="GeneID:3373982"
FT                   /locus_tag="cgd3_1370"
FT                   /transcript_id="XM_626712.1"
FT                   /product="hypothetical protein, transmembrane domain or GPI
FT                   anchor at C-terminus"
FT   CDS_pept        389676..391142
FT                   /locus_tag="cgd3_1370"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, transmembrane domain or GPI
FT                   anchor at C-terminus"
FT                   /db_xref="GI:66359068"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1370"
FT                   /db_xref="GeneID:3373982"
FT                   /translation="MLINNENVRAEEENGRRPTRNETIVYKIVNYMSSLIGGINDNVGR
FT                   NNPCIGILSPMSPVMITDHVKTVGNTMVLPSPEPIIQMIPNQNLRNNMFFNVYSNDKKY
FT                   VHKFGPKVTPYTNLNNGLLAINEKGDQIVTGNISLMSSPTDMCLNSSRNKLINPSSYFS
FT                   RLRNPISECGGLVKSPINSCFSGQINKANESSITEILVSPELAQTLQQIISIISHQIEI
FT                   DDSENFININNIKGSVKINRFQRINKKSTIGGLNYALMSYSASIIQKHFRNFDNNRMVR
FT                   YINPVTRSKFSKNQIMNAIHIIQRYWRIYMYRNQIMRELLIKNVMTARNAASCKIASLW
FT                   KGYKTRKFMDSIIKDVYIKWIWNNDDSANNNCSSEISNTQNYEYSKYEVKLRGSFTCKP
FT                   WQEHLKLNWDNQENCFLINICLTKGAHYLQFIINDEIKACGSMEIVVLPIIGVSNKINI
FT                   VGESYKSSRKFILLSYQLTHFLLFFIFIFQ"
FT                   /protein_id="XP_626712.1"
FT   gene            <391837..>393795
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1380"
FT                   /db_xref="GeneID:3373981"
FT                   /locus_tag="cgd3_1380"
FT   mRNA            <391837..>393795
FT                   /db_xref="GI:66359069"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1380"
FT                   /db_xref="GeneID:3373981"
FT                   /locus_tag="cgd3_1380"
FT                   /transcript_id="XM_626713.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        391837..393795
FT                   /locus_tag="cgd3_1380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359070"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1380"
FT                   /db_xref="GeneID:3373981"
FT                   /translation="MFSRLYNRNVDSNNQSSGKSNRIRITLNDRINSREAAKFPITESR
FT                   SFINHGEKDDYSVVRRSNTIGRIIQNGSQQIFYPINPNNNFTRQQMRGCYNSNIVQNSH
FT                   SNFQQNGSIDSALSSRRSNEFNTIQSLRSTSDLASKISSNVVLAEDQEPKIAGNKVKSI
FT                   TSSIPLNLIEKDSAERLKSSVNSQINEIEDSENERLNSNRNRYGLSLDLYSLTEDSARK
FT                   IKPELSVELECSINETSENNEVLVRSISLQKEKLPNLEIFPLETVNSPNSKSNNRENCQ
FT                   LRRFIDNSEITGLISKLNKSAFYFVRFNLLLHLAAIVIQCYFRRYLCKKYLYFRKYGPI
FT                   KLLNTSAMQIQACWRSFLTRFGASLCEGTPSNNGSHKCINEYNWSTLHEKNFTEIVKKR
FT                   NQNAKCIQNFWRNIYLKNINIEREILTNSIFSARALAKETIEKFLLGYLVRKNADSRYK
FT                   LVPIKWSWSVQEISEIFILQKIRNRWSEPKKMWLNQEENVYRYNLFLSNGIHQVVFKVY
FT                   YKNKECKGDQDYKILCNSSLETTPSDEFQFVNNISVYNNNYTVSAFKYMRDRISYINFS
FT                   TINYLDNLNPDIMQNIEQDLGYIALSPSYKQRLDIEYSETEYENSPYKEFDRIKNDVIN
FT                   TPSTNLDYSPGTQHFIH"
FT                   /protein_id="XP_626713.1"
FT   gene            <394828..>397236
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1390"
FT                   /db_xref="GeneID:3373980"
FT                   /locus_tag="cgd3_1390"
FT   mRNA            <394828..>397236
FT                   /db_xref="GI:66359071"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1390"
FT                   /db_xref="GeneID:3373980"
FT                   /locus_tag="cgd3_1390"
FT                   /transcript_id="XM_626714.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        394828..397236
FT                   /locus_tag="cgd3_1390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359072"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1390"
FT                   /db_xref="GeneID:3373980"
FT                   /translation="MENSAINHPFKKKLNRVLELKLGENEELINGLISLDTVDDISEGI
FT                   PKHLVTELLNTKGQNKCRSMQLLIYKYHLMVAESCLDSLKPFIDDLRAMNNEIRSFEKE
FT                   FNENVTTQLTNWNKFTFPLLEEFSMIQDQIQLVENKKNMCNTMLSHLSTNFVGDIKNLK
FT                   SSMDESKGNLLLSLVAIYNKCMASEINSKKLIEILSGDSLDSQNTSESVLSKLKSDREY
FT                   SSMIPQILINLKALILDLELKRNQLATEITSFLVDLVISKSPDEFNDQFEQSQNDEDET
FT                   EGIEKGTEEKVCIFGSQSFQESVEILELHHKEQCHSLLTCVVETRSKYLEYRFNHIIGH
FT                   GISIGDNNYSSNLLDYLESIFEWIRVCGVSIESEFLIKAFGYQMCEDCEFEEKHLDFNQ
FT                   SDTSEPESLDNMAKNILNSITHTLCIPFSGAIRDILRQFHPPQTSRPDSTHHFGNLTSL
FT                   KIGITIGIKIAHLINNYVETLIPMFKILPKRFSSKPKQARLAFPLLIQRFKDLREEAIA
FT                   QYYVYAGIVKENISSRISEIITTDFSISILVMEWSSLLKDILSTIQNGVLAISNDNIPK
FT                   IEDINSTLTSMLDTFINPMFNAICSVATSDKTPLASIIRINNVNYCLSVLTTFQKMKVL
FT                   LEKQIEIANQIINDEVSKLTDFLKEEFCDKYRFGELLKELEAKKEGLTTPQVFEGSANS
FT                   NTDPKLEPNSNYNSSESDPGQDPLLILSQVIIDQFFESILRFGAIPFANADRIQDKQIR
FT                   NNILKNLFAHISRQYELIFDQITLIWPQKSSFLRHDPQQIKLIFSSLTV"
FT                   /protein_id="XP_626714.1"
FT   gene            <397691..>401674
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1400"
FT                   /db_xref="GeneID:3373979"
FT                   /locus_tag="cgd3_1400"
FT   mRNA            <397691..>401674
FT                   /db_xref="GI:66359073"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1400"
FT                   /db_xref="GeneID:3373979"
FT                   /locus_tag="cgd3_1400"
FT                   /transcript_id="XM_626715.1"
FT                   /product="pyrophosphate-dependent 6-phosphofructokinase"
FT   CDS_pept        397691..401674
FT                   /locus_tag="cgd3_1400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyrophosphate-dependent 6-phosphofructokinase"
FT                   /db_xref="GI:66359074"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1400"
FT                   /db_xref="GeneID:3373979"
FT                   /translation="MSNYKQTELKRNKGDSRDVSLLSASSLHEGQSNMQMWRRRWEPCL
FT                   PHILRSPLSIKEVSAFEGMGKMERSDVSAYFPLTSGNSLVKFEAISDGSSSWKKFPARR
FT                   IGVVLSGGQASGGHNVIAGLMSYIKLCNQSSQLFGFLGGPEGVYSGRYRELTEDDINGI
FT                   LNQGGFNIICSGRHKIETEEQMRASLEICEKLKLHGLVVIGGDDSNTNAAVLAEYFKRN
FT                   SSSTVVVGCPKTIDGDLKNEVIETSFGYDTAVKTYSEQIGSIMDAIKTEGYGYYFVRLM
FT                   GRSASHITLECGLQTRANMILIGEEIKEENRSLMSIVDEIVEMILKRDSLGKKHGIVLL
FT                   PEGLIEFIPEFETLIKELNLILLKTNDRKQIIDSLSQEMKTLFLELPSDVQNQLLLERD
FT                   PHGNVQVAKIATEELLVHMAKEKLERVKKDYILDNVKTHYFGYEGRCALPSNFDASYCF
FT                   ALGHTAAALIDNQRSGYMAVVRKLSLTPEQWEPAGCPLTYMMNIELRKGKSVPVIKKYL
FT                   VDLKGQSYLAYCQVRSEWKLNDYYRNPGPIQFDGPNSGVTNYMISPPRVEDLLRMEDRC
FT                   ENKMSHKLSGSESSQNRSKDDMKIQKILLSTASKFNDDLIISSSCRDLDAYIITKCLPH
FT                   QTGRHNSKILQLKEEEYSSGFTEIRENSQSKSSMGNSLACESLGLILSCLSTPGTQNVI
FT                   CGLVNGLPSLKQLIVFKSLSDFSEGKALKVDLTSEGSLAFFENSLNSGGCIFPNGVEIK
FT                   MNVSEKKSSNTTLKANDNQEFTNSSCVLSCKGLVSNDFLSQLLSFFNMRAIAIVGNSEA
FT                   ATFGASISEQLICMSLNGMKSEIPVVFVPVCLENSISHQMIETCIGFDSVTKSISTLVG
FT                   NLLTDSASATKYWYFMKMIGDKTSNVALEVGIQTHPNLVVIPERYADGKLSVYGSEMAG
FT                   VTLDDIITEICDIICLRSNQGNNFGGLLVSEGLFDQVYPTREYRKIFSRFSTQNLCNAS
FT                   NSGCEILGSESLSRYEKKVVEDFKLIFSDIDTRLIENLINSRKICDVRTEIILSALVQK
FT                   ELKFRRSKNKIKNGMNPVCFSFTDQVRACIPSDFDSTLGLMYGMLASKIINSNLVGGYV
FT                   TGIKGVLSQTDSWNMYAIPISSLMTLNIEGDKIQDSRNNSNLSFESKKLLTESTLGNAG
FT                   HQLEFICKLNSVNLRNNPSFKLLMNHIEKWEVDNTYANPGPIQYFNLFKNLFNRTLFES
FT                   EYVYTRNLKEMDQILLEIKTLCQLGVEKDILNSTIQHLKAIQNSISIMSSCNHRKSKPE
FT                   QIECIQKTNSIANYTSNLKCKSNNNETNLEMIVNNIINQETCN"
FT                   /protein_id="XP_626715.1"
FT   gene            <401708..>402040
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1410"
FT                   /db_xref="GeneID:3373978"
FT                   /locus_tag="cgd3_1410"
FT   mRNA            <401708..>402040
FT                   /db_xref="GI:66359075"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1410"
FT                   /db_xref="GeneID:3373978"
FT                   /locus_tag="cgd3_1410"
FT                   /transcript_id="XM_626716.1"
FT                   /product="small hypothetical protein"
FT   CDS_pept        401708..402040
FT                   /locus_tag="cgd3_1410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359076"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1410"
FT                   /db_xref="GeneID:3373978"
FT                   /translation="MCAIIYFTKNLVRDESRESLRCQEVTQLLLSLHRTTANPFPCSVS
FT                   SLRRYGFHYLTSHLGLHQGNSRDCSLVMGSHRAMLLPGCSDTVSHPKPLTTPLGYSWAL
FT                   SQPVTI"
FT                   /protein_id="XP_626716.1"
FT   gene            <402238..>402468
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1420"
FT                   /db_xref="GeneID:3373834"
FT                   /locus_tag="cgd3_1420"
FT   mRNA            <402238..>402468
FT                   /db_xref="GI:66359077"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1420"
FT                   /db_xref="GeneID:3373834"
FT                   /locus_tag="cgd3_1420"
FT                   /transcript_id="XM_626717.1"
FT                   /product="conserved small protein"
FT   CDS_pept        <402238..402468
FT                   /locus_tag="cgd3_1420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved small protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359078"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1420"
FT                   /db_xref="GeneID:3373834"
FT                   /translation="FSIKMSALFNFQSMIVVVLLSICTCSYLRPKIPGLIDNKKSGFLG
FT                   ILGKMAVIGDRLSPYVSFACILMAGMTLFYR"
FT                   /protein_id="XP_626717.1"
FT   gene            complement(<402673..>403047)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1430"
FT                   /db_xref="GeneID:3373977"
FT                   /locus_tag="cgd3_1430"
FT   mRNA            complement(<402673..>403047)
FT                   /db_xref="GI:66359079"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1430"
FT                   /db_xref="GeneID:3373977"
FT                   /locus_tag="cgd3_1430"
FT                   /transcript_id="XM_626718.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(402673..403047)
FT                   /locus_tag="cgd3_1430"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="similar to Pf gi:23613644"
FT                   /db_xref="GI:66359080"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1430"
FT                   /db_xref="GeneID:3373977"
FT                   /translation="MTNSSNEVKTDQGEKNVSISEPVRQTICISDVNQLSEKERVELRR
FT                   QKFGACGPSTEAEKRLARSKRFGSTSEDDKRKLRQERFGMISEADKIKNRRERFGTMSR
FT                   VNDPDHEKKIQARKLRFGLK"
FT                   /protein_id="XP_626718.1"
FT   gene            complement(<403867..>404544)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1440"
FT                   /db_xref="GeneID:3373976"
FT                   /locus_tag="cgd3_1440"
FT   mRNA            complement(<403867..>404544)
FT                   /db_xref="GI:66359081"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1440"
FT                   /db_xref="GeneID:3373976"
FT                   /locus_tag="cgd3_1440"
FT                   /transcript_id="XM_626719.1"
FT                   /product="U1 small nuclear ribonucleoprotein c like finger"
FT   CDS_pept        complement(403867..404544)
FT                   /locus_tag="cgd3_1440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="U1 small nuclear ribonucleoprotein c like finger"
FT                   /db_xref="GI:66359082"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1440"
FT                   /db_xref="GeneID:3373976"
FT                   /translation="MRRNKEVNNKHYCQVCKIWIENHPNNIRSHQEGGRHNYNLRKLLK
FT                   SENYRELQKKKDEEEVRKEFMKLQGVEQTSNREKKRIKLIDKEVRSGSSTTFGDNVFTA
FT                   NYTFDDSKNIFEKKDHNESHDKTNEMGIIGKWEEVKESESAFLGNITLEQQDHTQIPNP
FT                   FKPIEGCVQIKKNSLSQKVYSCISDIEGSFEEQQFNEKSTSDYQKAKNEKIKIVFKSRK
FT                   IPR"
FT                   /protein_id="XP_626719.1"
FT   gene            complement(<404820..>405839)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1450"
FT                   /db_xref="GeneID:3373833"
FT                   /locus_tag="cgd3_1450"
FT   mRNA            complement(<404820..>405839)
FT                   /db_xref="GI:66359083"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1450"
FT                   /db_xref="GeneID:3373833"
FT                   /locus_tag="cgd3_1450"
FT                   /transcript_id="XM_626720.1"
FT                   /product="replication factor C like AAA+ ATpase"
FT   CDS_pept        complement(404820..>405839)
FT                   /locus_tag="cgd3_1450"
FT                   /gene_family="HOG000224155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication factor C like AAA+ ATpase"
FT                   /db_xref="GI:66359084"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1450"
FT                   /db_xref="GeneID:3373833"
FT                   /translation="GNKLVKSKQILEMSTQIWIEKYRPKILDEMVGNEEVLTRLKVLAK
FT                   HGNMPNLLLSGPPGTGKTTSIHCLASEMLGSKYGRAVLELNASDDRGIDVVRDKIKSFA
FT                   REKIDLPEGRHKIVILDEVDSMTDSAQQALRRLMEVYSESTRFALACNQSTKIIEPIQS
FT                   RCAIIRYSKLTDAQIRKRLFEIIKMENIPYVDSGIDTLVFTADGDMRIVINNLQATYHG
FT                   FSMVSRDNVLKVSDIPSPEKIKSILDSCVKCNWRLAHSIVEELFIGGYSPLDIVITMRN
FT                   VLKRYQLPERAILEYLKEVGRCHFVMLDGCATPLQLDKLLGQLCMISARCGLNSNKTN"
FT                   /protein_id="XP_626720.1"
FT   gene            <406652..>408265
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1460"
FT                   /db_xref="GeneID:3374031"
FT                   /locus_tag="cgd3_1460"
FT   mRNA            <406652..>408265
FT                   /db_xref="GI:66359085"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1460"
FT                   /db_xref="GeneID:3374031"
FT                   /locus_tag="cgd3_1460"
FT                   /transcript_id="XM_626721.1"
FT                   /product="GAF domain containing protein"
FT   CDS_pept        406652..408265
FT                   /locus_tag="cgd3_1460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GAF domain containing protein"
FT                   /db_xref="GI:66359086"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1460"
FT                   /db_xref="GeneID:3374031"
FT                   /translation="MLNIPELKETLSWDDIYSLFESSLRISSNLDPKLLVNTILCECRK
FT                   VINCRDCNLFIYDSINNVFYHGFDTSKYIISDSLLKKVLITKKYEILDDSDSDNYQLEN
FT                   NHDIKTRRFSNNAIYIPIYNTEKESPIAVLEILDKFKLNKDGIEVKDSFTQIDIIKLRC
FT                   MSRVFSISVMNCEKYREVRNTKEKADNLLNLVQSLRPDLGLQSNLFTLCIHAQEIIESE
FT                   HCIALIGIPERQQIISLISDTGNELLFNYEIGDIIHRIIETRHSLIIQNTGDDNKPRFE
FT                   NRLVECSCSSIRIVIGSSSVSTSNDDQFIRLLQKVYGGEKPIYNALVFPIYAERDNWSC
FT                   IPTPSQRISSISSLSSAFSSFEIGHDYDDLVSVSPRNNSILNSSIISSSIVAPGSPKSD
FT                   RVGRSSLVAQTHTNTRSSSLSPSNQFSQSNNTQAISLIVLINRLGVFKEKSKFTENDVR
FT                   LLEPFGRIVAPNIGTLFQTSLFSYLQTIYNTDRNISFNKYQDKMPQDPPSFAFPHSNWK
FT                   NRHSDVIFEEDEDGAKDLEK"
FT                   /protein_id="XP_626721.1"
FT   gene            complement(<408413..>409357)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1470"
FT                   /db_xref="GeneID:3373975"
FT                   /locus_tag="cgd3_1470"
FT   mRNA            complement(<408413..>409357)
FT                   /db_xref="GI:66359087"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1470"
FT                   /db_xref="GeneID:3373975"
FT                   /locus_tag="cgd3_1470"
FT                   /transcript_id="XM_626722.1"
FT                   /product="dual specificity phosphatase"
FT   CDS_pept        complement(408413..409357)
FT                   /locus_tag="cgd3_1470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dual specificity phosphatase"
FT                   /db_xref="GI:66359088"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1470"
FT                   /db_xref="GeneID:3373975"
FT                   /translation="MEALKRLIDKRSERMAVVENISGSTESELILPERVNFYFAALRIL
FT                   HQLKRKTPEPMKGMQIQETISLICSLDQVISLYGALVTSPKSTIEDYEEKVESNMRTII
FT                   SSINRLGFRDILQKEVQYSNKENLDLHRAQRIIPGIFLGGSTVANDLKKLKDLGITHIV
FT                   CCLQGACKFPNEFLYLNIPIYDTPFEDISKYFSSSFDFIHNALSQSTVERPNNVYIHCA
FT                   AGISRAPTICTAFLMRELGISSLQALNLIKLSRPYVAPNPGFLNQLYNYQLFLTSAKVC
FT                   QKRQQISNSNQTQIQVQGVPYQTNLKRNVGRIK"
FT                   /protein_id="XP_626722.1"
FT   gene            <410017..>411843
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1480"
FT                   /db_xref="GeneID:3374030"
FT                   /locus_tag="cgd3_1480"
FT   mRNA            <410017..>411843
FT                   /db_xref="GI:66359089"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1480"
FT                   /db_xref="GeneID:3374030"
FT                   /locus_tag="cgd3_1480"
FT                   /transcript_id="XM_626723.1"
FT                   /product="pp2c; protein phosphatase 2 C, possible
FT                   transmembrane domain near N-terminus"
FT   CDS_pept        410017..411843
FT                   /locus_tag="cgd3_1480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pp2c; protein phosphatase 2 C, possible
FT                   transmembrane domain near N-terminus"
FT                   /db_xref="GI:66359090"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1480"
FT                   /db_xref="GeneID:3374030"
FT                   /translation="MFRDKVRTFSSGRRFACQMKSFLKNRRCISGCATAFLAGGLSAWL
FT                   YLDSREKPESYFFNKLKSSYKVGCASQETSNKLFHQKILNQNLSLKTEKSNYVELIGEQ
FT                   GPVKSMVLGSEGTSAKISISAIQVNANNPIEDRLLIQRMRLNLPGGENKDFVISAVIDG
FT                   HGGWQVAEYVQNNFIRIFQKELSQYMSSLVREGSANESNPISQINETDIIAGLFYSLKK
FT                   TYYILDEELKSKLEVAYNLGFSKLASVGACTTVSIITEDAILTANSGDCLSVYCNENGI
FT                   WLPLNEQLSAMNPQEQKRLEEIHKHEKDNLIQCKQILHEKFLMGLYTIPKYRGCYVKGI
FT                   LQPSRAIGDFRLKSMDFNYNWEKDLSTEKLLPTFSYVLKDKESEQSKKEQHRENEDLNE
FT                   DEFPYSYDLINGNNSINMRRDSYRYFVKNPLSFPYVRSEPMLHLFFYNSLNKNLSSTDN
FT                   TSVEKISPNEYSLTPVHTNSSLKVEYITPEYKHLPISEYSNSNEFIRDFTLSKIRNAYS
FT                   YIQNPMNSSKKSFLVLGTDGVWDFLTPKDVTNVILNSKSVEDGVRRILKKVLNNAGINS
FT                   IEKLKSLPKKRKVFDDTSIVLAEITPNKHDND"
FT                   /protein_id="XP_626723.1"
FT   gene            complement(<411859..>412269)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1490"
FT                   /db_xref="GeneID:3374029"
FT                   /locus_tag="cgd3_1490"
FT   mRNA            complement(<411859..>412269)
FT                   /db_xref="GI:66359091"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1490"
FT                   /db_xref="GeneID:3374029"
FT                   /locus_tag="cgd3_1490"
FT                   /transcript_id="XM_626724.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(411859..412269)
FT                   /locus_tag="cgd3_1490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359092"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1490"
FT                   /db_xref="GeneID:3374029"
FT                   /translation="MKITPKMFICEVPEKILEDGDCCWIHGFVVDVEIDQDGELDMITL
FT                   DDGTSNIRVSIKDKLNDANCDNFHEDTIKTYRGLIEELVQKGRLISIVCQLNKGVFKVL
FT                   HVSDSINGNGDSKNEWINNSIRSRGSKEDDAL"
FT                   /protein_id="XP_626724.1"
FT   gene            <413261..>414238
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1500"
FT                   /db_xref="GeneID:3374019"
FT                   /locus_tag="cgd3_1500"
FT   mRNA            <413261..>414238
FT                   /db_xref="GI:66359093"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1500"
FT                   /db_xref="GeneID:3374019"
FT                   /locus_tag="cgd3_1500"
FT                   /transcript_id="XM_626725.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        413261..414238
FT                   /locus_tag="cgd3_1500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359094"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1500"
FT                   /db_xref="GeneID:3374019"
FT                   /translation="METMSREYEQLKNSILELANGISNISENKNLPILLNILMDGIGAY
FT                   NSMISRQSNFTDSMLEMSFWSIELMDTIYATNGGMTTLLDYTLEKIQDQFPSILNTFDE
FT                   INYLDKFSTRYKISEIYRGLVRLNFGLDQRIKSLEEMINKRQKSRNKSKAWELYNREEV
FT                   LLKINNLRELSDFLKYEFISLIKDILFFSKYLGIDDEHNSAINSSHETDTDSIKGSYDD
FT                   LISEIETVCEIFQNGQVHKTREIMDRIISNLDVEEFEEILGAFNLLNWLKGRVSICLGR
FT                   NLENNIEEISAICSNKQQESSSSDLDKDDERLLNHQETRYYDED"
FT                   /protein_id="XP_626725.1"
FT   gene            complement(<414420..>415415)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1510"
FT                   /db_xref="GeneID:3374086"
FT                   /locus_tag="cgd3_1510"
FT   mRNA            complement(<414420..>415415)
FT                   /db_xref="GI:126644756"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1510"
FT                   /db_xref="GeneID:3374086"
FT                   /locus_tag="cgd3_1510"
FT                   /transcript_id="XM_001388064.1"
FT                   /product="cyclin-dependent kinase 3, putative"
FT   CDS_pept        complement(414420..415415)
FT                   /locus_tag="cgd3_1510"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin-dependent kinase 3, putative"
FT                   /db_xref="GI:126644757"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1510"
FT                   /db_xref="GeneID:3374086"
FT                   /translation="MEVHSSTVGCQTECTSTFEDTQGLEKNYSMVRVIGEGTYGIVWEG
FT                   LRKDTGEVVALKKIRFDSDEILDEVGLPSTAIREIVLLRELKHPNIVALLEVSCTGMQI
FT                   WLIFEYCETDLRRYLRLNRKKGLSINQVKSLLRQLLSGLAFCHGKRILHRDLKPQNLLL
FT                   SDSGNTLKIADFGLARTFTPPLKPNTHEVVTLWYRAPELLLGQRCYNCSVDLWSVGCIM
FT                   VEMISGKPIFPGDSEIDTLFYIFRLLGTANESNWPGVTQLPCYKSVFPQWKVNPKLNLH
FT                   ALLPNLDQAGVDLLFRLLQYCPKKRITALEALQHPWLNTNTQNINVEMTI"
FT                   /protein_id="XP_001388101.1"
FT   gene            complement(<416323..>418092)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1520"
FT                   /db_xref="GeneID:3374028"
FT                   /locus_tag="cgd3_1520"
FT   mRNA            complement(<416323..>418092)
FT                   /db_xref="GI:66359095"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1520"
FT                   /db_xref="GeneID:3374028"
FT                   /locus_tag="cgd3_1520"
FT                   /transcript_id="XM_626726.1"
FT                   /product="hypothetical protein with transmembrane or GPI
FT                   anchor sequence at carboxy terminus"
FT   CDS_pept        complement(416323..418092)
FT                   /locus_tag="cgd3_1520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with transmembrane or GPI
FT                   anchor sequence at carboxy terminus"
FT                   /db_xref="GI:66359096"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1520"
FT                   /db_xref="GeneID:3374028"
FT                   /translation="MQACNNADLHHNNDEISITNPINIIPNSGFQQYFDFSRTHQCYIG
FT                   QFSGPYEQRNITYNNGVLYSRDEHIVFNLKMNKIITASESFGELLGIVHCHIYYLNEIN
FT                   MVSILHKLAVLSQSNNFKGRIKRDERFRLLLDVIVLRSNFPCRFSPKELSNIAWSLVKL
FT                   GLNNHKIFDFVCNESIIQLERFISINLSIILWSFAKAGKFNKNLFVYAIPKILSELDNL
FT                   EPQQISNIAWSYSKVGLVSPHLFENLKRKSIQTIDKFLPIHISMLCYAFSLADIVPTDL
FT                   YELISKMEICSFTPKAMAHIFWSFSLAELKSPINWLFWILDSDRISLLTMHELNLLISS
FT                   FSLNFIKGFVLIKHSNSNDYNIINNNDLQKISISKALAIKDRDPESCVIEWNSSYHLLN
FT                   IVQVRQENNFNDYDYFIWDTLDKLSTRLYEKFKGIKEISDVVWMLTFIGKDTSKFIQKA
FT                   NKKLPNDLNQIFNYQNSQKSLGESCCNSIENISLVSNTCDLSPFSTCCNSESPDGSSTI
FT                   TSEKAHKDLDQVLTCTSKKHCSSEVQVSLISYSPTSINSDSNHLDSKNTNSIPSILALF
FT                   AYNIFLVFIVLVF"
FT                   /protein_id="XP_626726.1"
FT   gene            <418487..>419101
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1530"
FT                   /db_xref="GeneID:3374027"
FT                   /locus_tag="cgd3_1530"
FT   mRNA            <418487..>419101
FT                   /db_xref="GI:66359097"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1530"
FT                   /db_xref="GeneID:3374027"
FT                   /locus_tag="cgd3_1530"
FT                   /transcript_id="XM_626727.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        418487..419101
FT                   /locus_tag="cgd3_1530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359098"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1530"
FT                   /db_xref="GeneID:3374027"
FT                   /translation="MKLNFDFQGVFKSINLKENLNFNNCVSAYNNIKSYAANAFKSCED
FT                   DISLFLEGKPFVLSNINYNELSNKLIKVRKNIENGLKGGKGGFGATIKSQKRKVNVREL
FT                   SVDLCRDLKTGKRIKDLNKSGNNVESKVEGSSRTKSSSSTNSGSISRNSKVLENSCSIV
FT                   NSENELLTQYQSHVLNLENKWKNISKSVDFGMNNLNQKVNV"
FT                   /protein_id="XP_626727.1"
FT   gene            <419504..>424354
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1540"
FT                   /db_xref="GeneID:3374025"
FT                   /locus_tag="cgd3_1540"
FT   mRNA            <419504..>424354
FT                   /db_xref="GI:66359099"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1540"
FT                   /db_xref="GeneID:3374025"
FT                   /locus_tag="cgd3_1540"
FT                   /transcript_id="XM_626728.1"
FT                   /product="large protein with signal peptide. cysteine-rich,
FT                   threonine-rich, possible mucin"
FT   CDS_pept        419504..424354
FT                   /locus_tag="cgd3_1540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large protein with signal peptide. cysteine-rich,
FT                   threonine-rich, possible mucin"
FT                   /db_xref="GI:66359100"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1540"
FT                   /db_xref="GeneID:3374025"
FT                   /translation="MLYLKFILNILIFFAGKTLSEPLPFSSDEVTVVPFPPFIPVAGGY
FT                   VPEPQNNGTTIDYVQKSRNDYFGSELSQIVNSPNFHLVTIQNGEQNKQVWAFVLGNEKK
FT                   VFAYRTENISITDPLHLGSNWNVISNSESNVWPVKMRFVYPSCHNMVKDKDEEGVDCGG
FT                   PCKPCNMFNSCRIGLDDLRTHKILKYSTCIGELKHGEFCSLTCPVGYRMKDLTKMKSEI
FT                   YSQCYDGRLNQLIFGNMQAPMTGESYYSREYRGFRNMLESEVSHLDQEFNELCESPFEY
FT                   MCKYISLRLKRSSLEEDGEGINYRMPCEGIFTAVPRYHGKKSYWVSVNSRGERVTLFWK
FT                   ENTWICVNTLSNSVLGYIQDSNPALLLSEEHMSNLVWIPWSENGPLNQNRSYVILRCSK
FT                   KKPREVPGRCNSLTMQGWNYGTNYNGIWVSVGESTDIFNGDIRGIYIKPYSNLVLLYNM
FT                   YKLQWEIYERLGDVSYEKLKQVMRQDGKIKDRVLNEENTYLKENNKGWVLRAMNPHPNP
FT                   SPPKGKWLTTPKSNFEEENILQIKYYHIDVYCDSSVTTLSGGDVHLSPIKLVRAINEDP
FT                   VVCSSEKPVTSFSLNLDFSNLAFKPRNSYIDRYDGRFSGNGCKYMEVKGTTIEATECSG
FT                   FFRKEELTQGETIWKKIASNSRIVLFYWTGIKWICTRNDSSNTILGYIDNEEQEEGYWL
FT                   NKIDSSAGAYIKTRTTLKCFKNHPQESGAEHSCNRALLKGWPIGMEALNGNWDLNRYEV
FT                   YIEGNKNGDELSRSKKEIKYYEHRRSDGCKLYLYFDDNVGYTVITNNHPKSRPELENKK
FT                   DKKNKYIAIYKDELQGTPILKGQDSHHVQWLYYPIDEDNMANLSSPRALSSTYIYTKCR
FT                   DNEEHYSKRQNSQGRGFDEEDMNNSINFSNEGENKNNSQLQNTSTKKQNRVSLGGRKLA
FT                   KGKSISKISQCSEYKIMGFNKPLESLNGIWKRDESYPKQGETSSAESILELYKCTNSND
FT                   KDIYIYYSEAPLNKTGWFLDYDLNPLNGFIALGTNSTSDGLTSSWRLWSLTEKKWNNLD
FT                   LSLECQDQTNNSNVNNKKTIFTTTDSKVLVNGFEVLESESPKELSIIPFEDVEDHIKTA
FT                   PIREMPIPFFTASLPLIGQLAANAFPMIKGISSLAPKKPKPTNEDLLGSPVTASAILPN
FT                   LDIFSTAEQLRQNITKSRQNERPSIYYDPSLLPRNSMNGNNIPSVMPYDQFGPPVNMYN
FT                   PRNDIPNYNYLPGQHNMFYSPIGPGNIHNNNMFDPSLGPSNNYFYNPYNNNNFNGIQQQ
FT                   QNTGNEMRDISYLNNQQQQQQQLLQQQQELQKEQLEQQQQLQSQQQQQQQKLQKQQLEQ
FT                   FYHPTQNAQQINEIPTLAGDHESVNGQLLYYVNGNFSQGGNNLEIPVSTSTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTTSTTTTTTTTTTTTTTTTTTIATTTEIENSNRDNMIPGISEEG
FT                   RKECPEDKEWVVEHGKLLTESGSITNKYKVIIVSILYQEDLKLNYLQGVYSFNGIFNGR
FT                   PSYRHFVNGVRNESNNLPELKTSNLDVSLFYDKRLRSWIFGDLENIGYNTEESIYIRSS
FT                   QSDCLVPWDSTITWKNASNSASLPLIISVRAGESINY"
FT                   /protein_id="XP_626728.1"
FT   gene            <425070..>427523
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1550"
FT                   /db_xref="GeneID:3374026"
FT                   /locus_tag="cgd3_1550"
FT   mRNA            <425070..>427523
FT                   /db_xref="GI:66359101"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1550"
FT                   /db_xref="GeneID:3374026"
FT                   /locus_tag="cgd3_1550"
FT                   /transcript_id="XM_626729.1"
FT                   /product="sec14 domain containing protein"
FT   CDS_pept        425070..427523
FT                   /locus_tag="cgd3_1550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sec14 domain containing protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359102"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1550"
FT                   /db_xref="GeneID:3374026"
FT                   /translation="MHKSKSLDNYQEWDNKLAEEYEYSPLIITEKISEYTMPSEILLYN
FT                   PTEDDIFTKFHAGSSNEFKIRQIFLHVDLLEQEEEMLIEFDNFLTKNCIKLPEFIKPLI
FT                   LRVLMFNKRRHPNTYIQRSMNHLISMFKWRVSTYPLSDMESNLREDLESGIIYWHGRDY
FT                   CLRPILTIRLSKVNKHFPLERFIRLIVFCMEWGMRYLMCPGKVETCLALIDMKGVSLTS
FT                   FPISTMSEISSLLTNQYSFRLYRMFILHDSLFIQTVWSLMKQFLTDLQQHKIVLSRNEI
FT                   KTQLFKTVHPNQVEEHFGGLQKNKTFPFYPFIFPSGPFSDPKLHPNNGFTRVVNQCNIE
FT                   QMDNFSKVTNCHLLFNKFNVLGKLYYNGNKHNKILWDEKGLEELNDTISSFLNINLDDD
FT                   KNSFSFDKNSNHLNSNIKSANNHDHYYNNNHNYYVGNNNNNNNNNNNNHHHHHHQHRHQ
FT                   HHHDNNNNLLHNSNNDFSINEILNSDKKNNDDIEQIEKLELKSYLMEHTDNMKLDNLSI
FT                   PNQKIQSTNNEDRDLSAEINIGIINTINMNTDIANIGDMSQHFIREYSVLSESPNLAEN
FT                   IAMIIEDSQSFFSASSSLYINEDNDENPCVEDFHHNLIIDNPCCDHNVFQSFGVLPIAM
FT                   ESFKNSGKKSKSCLKSSNYCKNSNIVNEENNKSNLINTYNPKTSNNAILNNFIEENGII
FT                   NNKELSNQTKSLKDVNKKNNNNINDNSSYIISNDILRDYDQIVPKRSNLSLSSPIIDIN
FT                   PPVSALNTSSSRISSMENTKLNDSFSYIGKSHESQKISRKSKIKSKISRVINKIKNRTS
FT                   IIENE"
FT                   /protein_id="XP_626729.1"
FT   gene            <428308..>428904
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1560"
FT                   /db_xref="GeneID:3374024"
FT                   /locus_tag="cgd3_1560"
FT   mRNA            <428308..>428904
FT                   /db_xref="GI:66359103"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1560"
FT                   /db_xref="GeneID:3374024"
FT                   /locus_tag="cgd3_1560"
FT                   /transcript_id="XM_626730.1"
FT                   /product="apicomplexan specific region near N-terminus"
FT   CDS_pept        428308..428904
FT                   /locus_tag="cgd3_1560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="apicomplexan specific region near N-terminus"
FT                   /db_xref="GI:66359104"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1560"
FT                   /db_xref="GeneID:3374024"
FT                   /translation="MISNEGLITVYYFIPSDGDKENNPNTFKVKGTHSTLTTKQIKDSF
FT                   PLPGIYYFRFKVRVGNTYAWMDPLNDDDIVPLYDDAIIAKVLRINWDYKNKFTQRLNNK
FT                   QDAYSISSGVIPSPNSLNQAFYQSQPPSQASQPHHPSSPPPPPPPPPPPPPPPPVLRHS
FT                   VTASATIPSSSNSNNIDLIDLNCEHSKWNSNSGYI"
FT                   /protein_id="XP_626730.1"
FT   gene            complement(<430128..>430616)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1570"
FT                   /db_xref="GeneID:3374087"
FT                   /locus_tag="cgd3_1570"
FT   mRNA            complement(<430128..>430616)
FT                   /db_xref="GI:126644760"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1570"
FT                   /db_xref="GeneID:3374087"
FT                   /locus_tag="cgd3_1570"
FT                   /transcript_id="XM_001388065.1"
FT                   /product="sporozoite antigen, putative"
FT   CDS_pept        complement(430128..430616)
FT                   /locus_tag="cgd3_1570"
FT                   /gene_family="HOG000246454" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sporozoite antigen, putative"
FT                   /db_xref="GI:126644761"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1570"
FT                   /db_xref="GeneID:3374087"
FT                   /translation="MSEWDDMVKEWLIDTGSVCAGGLCSIDGAFYAASADQGDAWKTLV
FT                   REDHEENVIQSDGVSEAAELINDQTTLCQAISEGKAPNGVWVGGNKYKIIRVEKDFQQN
FT                   DATVHVTFCNRPQGGCFLVDTQNGTVVVAVYDESKDQSSGNCKKVALQLAEYLVSQGY"
FT                   /protein_id="XP_001388102.1"
FT   gene            <432151..>436314
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1580"
FT                   /db_xref="GeneID:3374023"
FT                   /locus_tag="cgd3_1580"
FT   mRNA            <432151..>436314
FT                   /db_xref="GI:66359105"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1580"
FT                   /db_xref="GeneID:3374023"
FT                   /locus_tag="cgd3_1580"
FT                   /transcript_id="XM_626731.1"
FT                   /product="alpha glucosidase-like faimly 31 glycosyl
FT                   hydrolases"
FT   CDS_pept        432151..436314
FT                   /locus_tag="cgd3_1580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha glucosidase-like faimly 31 glycosyl
FT                   hydrolases"
FT                   /db_xref="GI:66359106"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1580"
FT                   /db_xref="GeneID:3374023"
FT                   /translation="MRSNRNYGLYKFAMALNKAARSFMGVVLNYAKRKKQRNEETSPFA
FT                   IRYRAFRDLINNINSGSLDGEFFSIWRVDWDSITICEENLKRGKSSTLSFMLLNTYKSD
FT                   LPPLEVDIKLYSIGIIRFVVNETDQFIKMNRFQLPYNDIIKDKLLDAHYLINTRDKLKI
FT                   TQAKDDNSISIEFEIVDSLINNDLDTESEKRMRKNLTEFEEKISRKVFKLVLTCNYFKV
FT                   ETFIDNRLIHTINPNGNFNFERVRPFISKSHPNIKKEDLMKIANAKKISQDDTSASKIF
FT                   DSIEKKIGITNYFEEIPSLLKERKYQKKGWGVFESKLKESCGNEYINGGNIMEIIDSYD
FT                   VYSKNSWYDIYDRFPDYKIYGPTCIGTDIRVHNTSNIYGASEHSTEVNLPEYSSSYRFY
FT                   NLDVFTYKNDKPDALYGSIPLVLSVHNDEKNSFISGILWLNPSDTFMDIKRKFNKIDTW
FT                   WVSETGIMDFILMVSDNFDSFYYNYHMLTGFPTLTPRFGLGKHQSRWFNCKDSDVLELS
FT                   TTFEENKIPLDSIWLDIEHLNKRKCFTWNIENFKNVPEMLGELDIKGRNLIVIADPHIS
FT                   IDDNYHVYNKLQNQPYLSNNILEDDEKVIPITITKTEPISNPWIKIRNHQEWEDFVGVC
FT                   WPGKVKYPDFLNPKVREIYSSFYTNKHYPIMNYSNIGFWIDMNEPSVFSSSELTLPKHS
FT                   FHYNDIEHRQVHNLYGYYHLKSTFNGLLTCAAQRIIFLDNISNTNEIVSSFHGSHSAID
FT                   KALANENKRLNDRLKQDKSILNLISSGRKILNQDNLLELGNVIKNIQRPFILTRSFYIG
FT                   SHCYGFTWTGDNKADYDSFSSVISMNVSNSVCGLSYTGSDVGGFYGHPCKCLFINWHKL
FT                   SIWMPFYRVHSHIDSPKREPWEFGGEILKYIRKLVVTRYELLSFWYTISSLYSFQGKPM
FT                   LKPLNWLLFEFKNHDLIGKNESILKICECQSFLLGDTFLIYSTLQNQCTCKKNNNSLKS
FT                   NDFNNNGLNTGYIANYTPLSILLPYKSKRSNQKYSSSCNDKKYRICTYVDKTLWYEYNS
FT                   FNFFVLDNSNYIYDYLLDIETPFPCFVKEGCIIPYQSGNVLSSAQQLQITTRLKVYLEL
FT                   INNCDDYYIDEQLKNSIKNAKNITNSGNENMILAQGNLFLDDGVSYNYLTGEYLMNTFY
FT                   FIKNETIKNNSFELSDSDNSKPDFYFDSSIDTSSISLSSSSTLMANIMQKSPPMTPSSI
FT                   FSSVSSSSFYSSMTSQSDNVTSITSLAESSIISNSKHIYEIYSVHKSIQVYNPTTNQVS
FT                   RINTNYDAIRNNWIYRNDIYLETISVFGIIHKPKIILLNINNIFSESNINPTNKVIKKL
FT                   DFTLVNLENVNESESNKLELYNVEINVAKLVNLINNNWKISIYI"
FT                   /protein_id="XP_626731.1"
FT   gene            complement(<436391..>438769)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1590"
FT                   /db_xref="GeneID:3373832"
FT                   /locus_tag="cgd3_1590"
FT   mRNA            complement(<436391..>438769)
FT                   /db_xref="GI:66359107"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1590"
FT                   /db_xref="GeneID:3373832"
FT                   /locus_tag="cgd3_1590"
FT                   /transcript_id="XM_626732.1"
FT                   /product="Spb4p, eIF4a-1-family RNA SFII helicase,
FT                   DEXDc+HELICc domains"
FT   CDS_pept        complement(436391..>438769)
FT                   /locus_tag="cgd3_1590"
FT                   /gene_family="HOG000268803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Spb4p, eIF4a-1-family RNA SFII helicase,
FT                   DEXDc+HELICc domains"
FT                   /db_xref="GI:66359108"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1590"
FT                   /db_xref="GeneID:3373832"
FT                   /translation="YEYYGKKMKERKRTPKNKGNEEINYRGFEALRPSISEGSLDFIQN
FT                   HLGFRFMSPVQEVTIPELLTHKDVAVEACTGSGKTMSYLVPVVEILLKSQIQSRGISNF
FT                   NMGSLILTPTRELSTQVFEILERYLDIINQYREKGGSGNVLKCLICIGGGNINKTFDYI
FT                   KQVAEEEASEDNSKYYILVGTPGRIFHLFENLKDGFDWNIKSSLEILILDEADRLLDMG
FT                   FENHINMILHSMPKQRRTGLFSATLNSQVQNLIKTGLRNPKYIKVSISCNNLEKQNTNE
FT                   KQETSTSIEDAECDISVPIGLTCFYVELNPLLKIEFLIRFLLNMKRELESGKQIKCIIF
FT                   FLTCRSVEFYFKYLSKLFHNHSKNKQNKSQKNGYFMESSLGNLCKLHGQMCQKSREKSY
FT                   EIFRNCDSGVLISTDLTARGIDIPDIEWIIQFDAPQDPSYYIHRIGRTARAGKLGKSII
FT                   MLQPHEGAFIEYIEKKTMRKILSYNHLEGEKNNTGIIYDGNYNSIEDPFYKTSNNLKLC
FT                   YCTKLNEEIIKKDEFLNNSCNINRVGLCTIRKFMYSDFEFYEKAKKAFVSYIRAYKEYQ
FT                   LPFIFPFKSLSIGEIAASFALLRIPRVKEILGKSNISGKFITGSKNIHPDDFNPNPKPP
FT                   SNIETSKDQKDNFENSKKRKELKDIQVDLEKNNNSKRSRSEKRATKRKIELDEWQTLQF
FT                   ENNLAKKLKTGKITYKEYQNRLNQFYKDEEISNNDNNYDNTNNSDSSNDDISDTSDFDS
FT                   DHSTRKKNNDCSNLKTANGSNKQKIPKWVIQGKKNKKKR"
FT                   /protein_id="XP_626732.1"
FT   gene            <439824..>441101
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1600"
FT                   /db_xref="GeneID:3374022"
FT                   /locus_tag="cgd3_1600"
FT   mRNA            <439824..>441101
FT                   /db_xref="GI:66359109"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1600"
FT                   /db_xref="GeneID:3374022"
FT                   /locus_tag="cgd3_1600"
FT                   /transcript_id="XM_626733.1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains"
FT   CDS_pept        439824..441101
FT                   /locus_tag="cgd3_1600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains"
FT                   /db_xref="GI:66359110"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1600"
FT                   /db_xref="GeneID:3374022"
FT                   /translation="MSSVKDKCNNMPKQNHNESKISIIPNTAPYKFMRGLMCFLTVSLS
FT                   MLYLIFSCSFAIKYRPLVFDNILTETIKGTIKGSNGEYIQWIATIPTGLVSRTVAIICV
FT                   VMFLIFGVYTMLFSFYTACKKYKFIQPWHFMLLSAMSCVGGLISIFLSNKFAVVEEFTH
FT                   KKDCLLQSVVSNDCSVAIGNNEIYAYDICKAVESFCLDENASMSRYYTKAIIVAVVSFI
FT                   VSVLSFAYGIVLLNLKMRYSKKLALINEKNAISEKTKSDLEMSNSSSICQYDKDNSGIN
FT                   CQNNQSGTGYSTTDNTNVVNSTKTNVYYPNMSNDSCKAIQPYQNEMRSIPMGIVVTTTT
FT                   SKQCHIAAHRNANSQVNTSNMGNIIGNSAISCVNSIHHSCHSGNLNHNRNAHHGLSLQQ
FT                   QHHHHHHHHHHHGPNHGNRQHHNQFL"
FT                   /protein_id="XP_626733.1"
FT   gene            complement(<441585..>444152)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1610"
FT                   /db_xref="GeneID:3374021"
FT                   /locus_tag="cgd3_1610"
FT   mRNA            complement(<441585..>444152)
FT                   /db_xref="GI:66359111"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1610"
FT                   /db_xref="GeneID:3374021"
FT                   /locus_tag="cgd3_1610"
FT                   /transcript_id="XM_626734.1"
FT                   /product="protein containing a possible START(Steroidogenic
FT                   acute regulatory (STAR) related lipid transfer) domain"
FT   CDS_pept        complement(441585..444152)
FT                   /locus_tag="cgd3_1610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein containing a possible START(Steroidogenic
FT                   acute regulatory (STAR) related lipid transfer) domain"
FT                   /db_xref="GI:66359112"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1610"
FT                   /db_xref="GeneID:3374021"
FT                   /translation="MSSSDSLNCENVNNIEEFDAERSIHSTKSPSELDDEQNEDIIGAI
FT                   ETPNLNIELNNSLNKHDETSSKSTTLEKLSKKKRLKYKIASKFMSLIFYRRSRKGFSKI
FT                   HSRRRSQSINYNLTLPTNSSSTSTTRYFSFLRKLSKKNRFNNDKTNSKNFTNIESSIEK
FT                   FGKSISKSSIKLNFNSLNNICIAEDVDIQVMEGLETACNFNEEISTEENFNNFFEIIPT
FT                   NPKLDEKLHVKDEDKSFDISSKNKQIANPNIICNDNSNINMNSEININTINTLLKKRAS
FT                   ILSKPEKFEEYLKLKFEELEETRKILGNFLRRYEKNRNFLENRNIDPSNLNQKQLNNQR
FT                   LRMYARLANKLSEVSFECLLSKPNELMCQLVYNKDGVRVWKKEHKSGRVLLRTEFIVPV
FT                   APLDYVEYSTDSNNRRVYDNNTVDLKVVENIAPGLDVMYVATKRIATVYPRDIVNIRYL
FT                   HGYNIKNGFKFMSWNDLSASAKINQDEVMCCSCSCSTEHPDAPERPGYVRMDLSIGSYM
FT                   AIPIKTPFGIWSNVSMFNEASPKGWIPSSVTKMIAAKMVPGSVESIVSSMLTYYKFPFK
FT                   NKLNRPFSGFCYRALSTIYVDQKKLELNCNTLQDPIINGKGVSNGTMNFISSSKNSKSN
FT                   SKISFLLNRPLIMSIQDFIATYKSNSFQEFIEQFNSVQIINKYIISASSSILSSCNSDL
FT                   LSSSTDASRNISLEVDQSKSIEYSDADVKQVEHNSKISICNLSFDKLPNITEKNGNKTF
FT                   LNQIISCNGALQDFCYDSSFERPSSFEFFEAPHNINNKQDQSKAISQSCSNNIFVCCNQ
FT                   IKTNRKKVLKLLMNSCKMYQDFGASYLTDFSDIAIISRLLSLD"
FT                   /protein_id="XP_626734.1"
FT   gene            complement(<444967..>446004)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1620"
FT                   /db_xref="GeneID:3374020"
FT                   /locus_tag="cgd3_1620"
FT   mRNA            complement(<444967..>446004)
FT                   /db_xref="GI:66359113"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1620"
FT                   /db_xref="GeneID:3374020"
FT                   /locus_tag="cgd3_1620"
FT                   /transcript_id="XM_626735.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(444967..446004)
FT                   /locus_tag="cgd3_1620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to ribonuclease P"
FT                   /db_xref="GI:66359114"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1620"
FT                   /db_xref="GeneID:3374020"
FT                   /translation="MSFELCVNWPGDLNKAKELILKAYSFGYLGIAFNNTLNLVEKCNK
FT                   LRSSPNKNSVSGNILSILAKEGHVCPIQYIQLEKEELRGMRKRSLIVKSNSGPLVPKNA
FT                   YLPLSLSCHNFEINKQFGKEDDTSFDFLQLRRLSIVFDNPDCVPYINALSRGPCNESSD
FT                   SWSKAIFSSVPNQPYDLVSVRPTTQNALNSAISSVECDIISIDISSAPRLPFIIKRPQI
FT                   NLAISRGIFFELDISQCILNKGNSRRNFFSNLNTLTRHVPHKNIIITCNPSFPLDIKTP
FT                   MDLSNICHVLLSLDFDRKVKVNSFDFINNNAIKALAKGTNRRSFASVILINKKEEHPDQ
FT                   EMDIS"
FT                   /protein_id="XP_626735.1"
FT   gene            <446200..>446760
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1630"
FT                   /db_xref="GeneID:3373831"
FT                   /locus_tag="cgd3_1630"
FT   mRNA            <446200..>446760
FT                   /db_xref="GI:66359115"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1630"
FT                   /db_xref="GeneID:3373831"
FT                   /locus_tag="cgd3_1630"
FT                   /transcript_id="XM_626736.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <446200..446760
FT                   /locus_tag="cgd3_1630"
FT                   /gene_family="HOG000167115" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359116"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1630"
FT                   /db_xref="GeneID:3373831"
FT                   /translation="LLVLNPLGSNNNISLFKFQKLYIEMTVFVLYVQADFEGIEELIFP
FT                   ENYTWCFDIEQSAGSLTKERITVDPNESIEMENSRGIVNFAMKWESDKRQSTITCIKLN
FT                   NISRMKVTSEDEGKLVPVAAFDCRGINLTKWNPSFGYNVISNSGKKFENINLEELEWCD
FT                   FDENSNESVGIYNLNSEFRVHKV"
FT                   /protein_id="XP_626736.1"
FT   gene            <448055..>449425
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1640"
FT                   /db_xref="GeneID:3374018"
FT                   /locus_tag="cgd3_1640"
FT   mRNA            <448055..>449425
FT                   /db_xref="GI:66359117"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1640"
FT                   /db_xref="GeneID:3374018"
FT                   /locus_tag="cgd3_1640"
FT                   /transcript_id="XM_626737.1"
FT                   /product="hypothetical protein with 7 transmembrane
FT                   domains"
FT   CDS_pept        448055..449425
FT                   /locus_tag="cgd3_1640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 7 transmembrane
FT                   domains"
FT                   /db_xref="GI:66359118"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1640"
FT                   /db_xref="GeneID:3374018"
FT                   /translation="MENGEKYIQKVGMKEGRVSRTQYLFFQVYNNTKRCCWSISIPREC
FT                   IALSRILLEYPYSYFLPLLSCFQCIITITVCHIFSAALSHLPYYKLFLPFTYFLTIHSP
FT                   EKYIYIFGLLFSWVLFVLSIPMLYHLLFYHLPQPLEVWVTPRYSRIGELMANIENSANE
FT                   FDSEKGSHNYYMEHNQKKMLNKTTNRRNERCPAEDYCTENETFLNVDEYETNNFGSTNL
FT                   IRVKQGVFHRAIATWNLRITFFSLSLAIFFGFSALIFPFGLNLRRIIFNDIGTSSGTLY
FT                   YLANALLSISPSNLFAFFTFIHALLISIYVFIYRRPVISRLSRILKMSCSAIMVIIILI
FT                   RSISTFILSHYYMNKFRSGRLFNDNYPNLNSFLADFNIKMKANHSFYIRMALASSSQYL
FT                   FLFVTMVFISSYSLDIHQLHLSSINAFKSTEESESYSLIKRGGDFVSNNDEKDSILY"
FT                   /protein_id="XP_626737.1"
FT   gene            complement(<449885..>451309)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1650"
FT                   /db_xref="GeneID:3374004"
FT                   /locus_tag="cgd3_1650"
FT   mRNA            complement(<449885..>451309)
FT                   /db_xref="GI:66359119"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1650"
FT                   /db_xref="GeneID:3374004"
FT                   /locus_tag="cgd3_1650"
FT                   /transcript_id="XM_626738.1"
FT                   /product="eIF2G GTpase. eukaryotic translation initiation
FT                   factor 2 gamma subunit (ZnR+GTpase)"
FT   CDS_pept        complement(449885..>451309)
FT                   /locus_tag="cgd3_1650"
FT                   /gene_family="HOG000229292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eIF2G GTpase. eukaryotic translation initiation
FT                   factor 2 gamma subunit (ZnR+GTpase)"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359120"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1650"
FT                   /db_xref="GeneID:3374004"
FT                   /translation="KKLFVDIEFIKMSSDHLSKQDADNLDLTKLTPITPEVISRQATIN
FT                   LGTIGHVAHGKSTVVRAVSGVQTVRFKDEKERNITIKLGYANAKIYKCTNPNCPPPKCY
FT                   RSYGSNKEDEPMCEVPSCNHKMQLLRHVSFVDCPGHDILMSTMLNGAAVMDAALLLVAG
FT                   NETCPQPQTSEHLAAVEIMKLKHIIILQNKVELIKEAQAQEQYKQIKDFVAGTSAQDAP
FT                   IIPISAVLKFNIDVLCEYICTQIPIPIRDFTSSPRMIIIRSFDVNKPGEDAQNMRGGVA
FT                   GGSIIKGVLKIGDEIEVRPGIYNKDADGEFTCRPIRSKIVSLFAEHNDLKYAVSGGLIG
FT                   VGTKIDPTLTRANRLSGQVLGHPGFLPEIYDSINITLYRMRRLLGVRAHDGSKAQAKVS
FT                   KLREGELLMVNIGSTTTGGRVTKIRDDLATFQLSSPVCCSVGDKLAISRRVDKHWRLIG
FT                   FGDIISGDTVRIINDY"
FT                   /protein_id="XP_626738.1"
FT   gene            <452780..>453610
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1660"
FT                   /db_xref="GeneID:3374017"
FT                   /locus_tag="cgd3_1660"
FT   mRNA            <452780..>453610
FT                   /db_xref="GI:66359121"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1660"
FT                   /db_xref="GeneID:3374017"
FT                   /locus_tag="cgd3_1660"
FT                   /transcript_id="XM_626739.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        452780..453610
FT                   /locus_tag="cgd3_1660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359122"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1660"
FT                   /db_xref="GeneID:3374017"
FT                   /translation="MKYIYVISSLISYIIVINAFALRKKEGLDLGLKKNLIQSRNSYNF
FT                   ECDVAIECMNILRCYYFFVAIVYEIISTSNCVSRSSDIEFRIHLSKNLSELNYYRNYFA
FT                   EHIMDKGRSASLFEVIHEFPKRKASFLNVCSQIKFIDAKELYLIEQRVISNYLKVLMEL
FT                   KTYISADISNFFGSPFLINQGREVIKIINMAIDIILITQHKIQELERSSNKPTSIYKLS
FT                   KVPQKLLVTKIYKRNLIVRISHIVKLRKYIRADKSDLLTILEDLERNNEMPPKY"
FT                   /protein_id="XP_626739.1"
FT   gene            453820..454812
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1670"
FT                   /db_xref="GeneID:3374085"
FT                   /locus_tag="cgd3_1670"
FT   misc_RNA        453820..454812
FT                   /note="putative non-coding RNA gene since there are no long
FT                   ORFs but nine ESTs align on it; the nine ESTs are GenBank
FT                   Accession Numbers AA420940, AA397487, AA532310, AA532330,
FT                   AA555348, AA555353, AA555358, AA555334, and AA532337.
FT                   Experiment evidence is needed to validate the annotation."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1670"
FT                   /db_xref="GeneID:3374085"
FT                   /locus_tag="cgd3_1670"
FT   gene            <457025..>457654
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1680"
FT                   /db_xref="GeneID:3374015"
FT                   /locus_tag="cgd3_1680"
FT   mRNA            <457025..>457654
FT                   /db_xref="GI:66359123"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1680"
FT                   /db_xref="GeneID:3374015"
FT                   /locus_tag="cgd3_1680"
FT                   /transcript_id="XM_626740.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        457025..457654
FT                   /locus_tag="cgd3_1680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="within locus of cryptosporidium paralogs"
FT                   /db_xref="GI:66359124"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1680"
FT                   /db_xref="GeneID:3374015"
FT                   /translation="MFLFEKQKCILQLLKTKYRKRKCDSLPRIISVSLSCRRIMKQIEN
FT                   LEKSLEKLTEQIKKLERYILNCFLSAIKMLWKEGREQSFEIDEEAAKECDYKELYLIWQ
FT                   EQQLLKKYKTLLNSFTTSSFGKKASRSSNTSCFCRKTQSAKCKKYAFKRFLLTLEKVEA
FT                   KIKSLTVEFVSCASYLTLNGISNNEAEPTNENRPASLIGSLGELLS"
FT                   /protein_id="XP_626740.1"
FT   gene            <457903..>458892
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1690"
FT                   /db_xref="GeneID:3374016"
FT                   /locus_tag="cgd3_1690"
FT   mRNA            <457903..>458892
FT                   /db_xref="GI:66359125"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1690"
FT                   /db_xref="GeneID:3374016"
FT                   /locus_tag="cgd3_1690"
FT                   /transcript_id="XM_626741.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        457903..458892
FT                   /locus_tag="cgd3_1690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359126"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1690"
FT                   /db_xref="GeneID:3374016"
FT                   /translation="MCSFLYFILLSVFFVWDASNYSEEYGFSSEIISFIKIKEEHEKEF
FT                   LVTPLGANSAIIVDAGSGSNDNAVLTVFGDAFSTQFDEIGLSDEEKNEMSRIFSNDCNA
FT                   DVMSYLISVLSTLFVSLKQYECELKLLEKSYRACRGYGGLMRRIKRCNEVEEKYRQNRR
FT                   GGRETLSQIKKFGEKTIQCATAISRGLWLAGKHTNVENVDSTVECTEQQLLNEQCSLTT
FT                   YKVFYSVLLSALISVSVSSSKCKEKRKCRKVSRKCKCIFSTADQIEELINELEKKITDK
FT                   NAFIRSCTKHLINTSGSVNTNQVRAPSEEIDGGLKEITQVSQLLTGTF"
FT                   /protein_id="XP_626741.1"
FT   gene            <460684..>462792
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1700"
FT                   /db_xref="GeneID:3374014"
FT                   /locus_tag="cgd3_1700"
FT   mRNA            <460684..>462792
FT                   /db_xref="GI:66359127"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1700"
FT                   /db_xref="GeneID:3374014"
FT                   /locus_tag="cgd3_1700"
FT                   /transcript_id="XM_626742.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        460684..462792
FT                   /locus_tag="cgd3_1700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359128"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1700"
FT                   /db_xref="GeneID:3374014"
FT                   /translation="MYFNLAFFLCLPLISIYEFGSSDFYFKLSLIELKAVGGFGAGQAE
FT                   SSTEGSVERSNQEENSDQSSEESSTSQNEKKIGEASSILNSKSDSALLSHGNSYYKKKL
FT                   GESILSFSSHSELVKFLLFESSQRDLGLSVSDCLKISQAYLTSKFTPNTSENEIIVDIK
FT                   ELLLLLRKYIRTNGSCLQSFCVKNQPKTSITSTESTLNIDEENDSDADSSVKTNQSTSS
FT                   DTSSGKLYDGSSSHFQFQLTSSSDSATPISIEFLEMQPKNDLKFELFKQDQSTPTVNEL
FT                   VQPEENLRTPTPDLNNLPVSEPENLPTTEENLNTVFEEMGTEIQVNQNEIVPNLDLNTR
FT                   NAMPITEVELELDFVDPWKSLISMILYEPVRRSSLKFDEVHCDKMAKVTGRIIAFITNY
FT                   TCKLRLILKNYQRKKCNERNKVASLFVGCYKLKKQLEKNIKYYSKLRYDLVDSVVGVTQ
FT                   CSLAKNNFISQRNKTFSHLSDGNSSIRCTLKEYYLLFDFVIFLFYIINAYKSAVEKLDK
FT                   FISSSCTTICPTRCGKRPQICNCLEESYNNIFADKINMESYRHNLNNRMALCKNYLISN
FT                   YLFSSSIPESAEYVSTSGYRYKIENFEHIQTVQFPITYPSSLEKYTILKSSLFNLLLNP
FT                   INNQEQPPNPAPAAKEVPNRSRNLEKKPKHRLKSKFPIRRNKDKNTNINHNTQTHPNPT
FT                   SNPQNNWL"
FT                   /protein_id="XP_626742.1"
FT   gene            <463132..>464034
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1710"
FT                   /db_xref="GeneID:3374013"
FT                   /locus_tag="cgd3_1710"
FT   mRNA            <463132..>464034
FT                   /db_xref="GI:66359129"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1710"
FT                   /db_xref="GeneID:3374013"
FT                   /locus_tag="cgd3_1710"
FT                   /transcript_id="XM_626743.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        463132..464034
FT                   /locus_tag="cgd3_1710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359130"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1710"
FT                   /db_xref="GeneID:3374013"
FT                   /translation="MNIFSLIGIHFLLFFGISANNNRLSIKEFSLLSLKENSDVNLYRK
FT                   DARINVQECSPESMNLLLGIDQILKFEVTAYFCYLKNLRSAFESCKRRCTISRNIGRCR
FT                   GIENRLAAATEKYNELLEQQTKWGKLLSYCIKCRALTEYMLIQSRGGIAKKSRITSRNS
FT                   GDDPAYTPKNLLDSYLTRDFSSFELLYLSRMDTYLQTQKKLCGTKSRALCTCAKKTLKE
FT                   LKDNKSVLQSTVIKQDSFQRRWFTFNGGNIPSSGEPIDSIREECKHVLEKDAEIQNGID
FT                   GKLNAGFTGEELAPVTSVL"
FT                   /protein_id="XP_626743.1"
FT   gene            <464470..>465288
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1720"
FT                   /db_xref="GeneID:3374012"
FT                   /locus_tag="cgd3_1720"
FT   mRNA            <464470..>465288
FT                   /db_xref="GI:66359131"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1720"
FT                   /db_xref="GeneID:3374012"
FT                   /locus_tag="cgd3_1720"
FT                   /transcript_id="XM_626744.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        464470..465288
FT                   /locus_tag="cgd3_1720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359132"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1720"
FT                   /db_xref="GeneID:3374012"
FT                   /translation="MNMPIANSCKYAFFHYMCAYLFILTVISFLYWDGFTEILEMNQVS
FT                   LFQVGIPQYQSFSEAKPLFSGKGSKEYRDFLAEFGVLDGLEIAKVRSNKALKKLLLELK
FT                   QIFIKYYSLKGLVLSFKKKPSSVENQDLVENNNRMLQEANTELSKLLLEIFSCIVLKKA
FT                   SKYKNYTVSNNHFDCTIYSYVYYSSMKELSKRIIILLEETLSSFSKSKCSCQQFNVNVK
FT                   QSPCYYLFFSVKAIKASIATETSYYCQYKRIKKNCGPYANLSLRKALSFR"
FT                   /protein_id="XP_626744.1"
FT   gene            <467357..>468253
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1730"
FT                   /db_xref="GeneID:3374164"
FT                   /locus_tag="cgd3_1730"
FT   mRNA            <467357..>468253
FT                   /db_xref="GI:66359133"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1730"
FT                   /db_xref="GeneID:3374164"
FT                   /locus_tag="cgd3_1730"
FT                   /transcript_id="XM_626745.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        467357..468253
FT                   /locus_tag="cgd3_1730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359134"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1730"
FT                   /db_xref="GeneID:3374164"
FT                   /translation="MLMSSSIINFLLVLLFTVSSTSNNFVKNFILEVSFLNAASLETGS
FT                   EGEPVALPQQDAQKPQFGVLQGRGSTVLSDFMTSNGVGLDLSVNKKCSKGELQKLLKLL
FT                   ENTMLTLFEIHGKSVGLEKTINEQTHSSNLEISRLNDLRAKEISLNEKLEQLLAEIFSC
FT                   LLRMAAKRYSGKSIRTNEKGCTILSVTYFSALKSASEAILAVLKKVLKELTKLYNKCLT
FT                   SVHIDPNSCRCYGFSLSSAQDSFSAQKQISKNSASEKIKCKRYVRNKITTRLLGGIRAR
FT                   ASGETVFEDEQEVNTYF"
FT                   /protein_id="XP_626745.1"
FT   gene            <468667..>469809
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1740"
FT                   /db_xref="GeneID:3374162"
FT                   /locus_tag="cgd3_1740"
FT   mRNA            <468667..>469809
FT                   /db_xref="GI:66359135"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1740"
FT                   /db_xref="GeneID:3374162"
FT                   /locus_tag="cgd3_1740"
FT                   /transcript_id="XM_626746.1"
FT                   /product="hypothetical protein with signal peptide and 2
FT                   transmembrane domains"
FT   CDS_pept        468667..469809
FT                   /locus_tag="cgd3_1740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide and 2
FT                   transmembrane domains"
FT                   /db_xref="GI:66359136"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1740"
FT                   /db_xref="GeneID:3374162"
FT                   /translation="MMHFLKIYIYSILYLIYLIQPKILVPQLIRNDHIFKLSFIKSEER
FT                   QNFPIRMRIKESQDQAPGAPVESVEAQLKSNVADLSPSKPEHMPTSQFLAVFGLDEQMF
FT                   VKGTCSLEVKDVFIKKIKKIVTFYFLYRGEYKRDYGTSGNKVKDMTVNTRNQSEFAKLM
FT                   MRSGEVIMFMARYMSLLMNCIMYLLSHYYRKVSILYNEEGCTTYNIFFYLVMMEMIECI
FT                   LMVLKYSKRQLIKLIAKLAEGSYTDSESRIKAIDFALAMISETSDIEKEKFNRYKDKFE
FT                   SCKEYIKHTSSAKSSKHKGSKFDTSISEGSSSLKYSLKKLLGKKSKSNEKEEKKKDDGD
FT                   EDGDEDGDEDEDEDEDEDPFWKLALDSLNMDAMYDDDVFL"
FT                   /protein_id="XP_626746.1"
FT   gene            <470105..>470953
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1750"
FT                   /db_xref="GeneID:3374163"
FT                   /locus_tag="cgd3_1750"
FT   mRNA            <470105..>470953
FT                   /db_xref="GI:66359137"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1750"
FT                   /db_xref="GeneID:3374163"
FT                   /locus_tag="cgd3_1750"
FT                   /transcript_id="XM_626747.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        470105..470953
FT                   /locus_tag="cgd3_1750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359138"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1750"
FT                   /db_xref="GeneID:3374163"
FT                   /translation="MLFLWLLTIFFVFIGGINENKEILNHNIKLISFLHAEGGKDLRSS
FT                   SSSPLTKETSTINSDDEELSLPSSWFIKKLESNAESYLESIGIGPDLTSKESCTESQLK
FT                   KLLKELKKSLKKLILTNEQVKHYNENNSSGKYLTASFQEYLTEKKQEISMHKQNIESLL
FT                   EQILKCLMLLRLDKYSRKIFKDNSVNCNAKTYTFTAVLKTTSKRVLSTLKKLLHKFDKE
FT                   YKNSTKNITATFDHSTLSASVQTLNTLITKQKDITRKIKHKKKKCKMYMEFSSRDISTL
FT                   L"
FT                   /protein_id="XP_626747.1"
FT   gene            <471854..>472738
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1760"
FT                   /db_xref="GeneID:3374161"
FT                   /locus_tag="cgd3_1760"
FT   mRNA            <471854..>472738
FT                   /db_xref="GI:66359139"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1760"
FT                   /db_xref="GeneID:3374161"
FT                   /locus_tag="cgd3_1760"
FT                   /transcript_id="XM_626748.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        471854..472738
FT                   /locus_tag="cgd3_1760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359140"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1760"
FT                   /db_xref="GeneID:3374161"
FT                   /translation="MASFNYIFTVGFVLISIYLNASNDAIRNEKIKSNEFSFLNAQGPS
FT                   YSLSEHPSPFKTTIGPILFAGKPEGVSLEEYLSRFGYNGRKDDLQPACTKQQVKALLKE
FT                   LKKILRDYYPLVGKNNYFRKLSYTAAQNSLEDIDITRYLSSTRPLFTRTESILISLLER
FT                   LFKCILSRKIKKYSKSSGYEVSLLLYNKSMRTISKDLLKVLKSVESSLGEEYPKCLRTS
FT                   TGASLVECKALGESLDVCKEHIRHQKEAKEGKYKEEKVLKGILKSPHSDHSRSRPTSGQ
FT                   KHVKFEELASVDV"
FT                   /protein_id="XP_626748.1"
FT   gene            <473887..>475482
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1770"
FT                   /db_xref="GeneID:3374160"
FT                   /locus_tag="cgd3_1770"
FT   mRNA            <473887..>475482
FT                   /db_xref="GI:66359141"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1770"
FT                   /db_xref="GeneID:3374160"
FT                   /locus_tag="cgd3_1770"
FT                   /transcript_id="XM_626749.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        473887..475482
FT                   /locus_tag="cgd3_1770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359142"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1770"
FT                   /db_xref="GeneID:3374160"
FT                   /translation="MKLKLLSLIHLFLFFVLFSEFKYGEINHYQKTPFNSFVKLKISSN
FT                   LNGKPKDSEQPKSPQRTIRGPSYTLRDTSSSQKPPSGAHQTVGSTRRVFSWPPTETPGK
FT                   KTTKPASPKSLSRGYSWPPGGRTNPIIGQDGASSVGSQHLDTEDLFTAIKVQVTDEDSD
FT                   EEAEPVTAKLVMLSDSDTDSDSSEPGTPTSKSSSSGSESDTSVPGTPVTKRATIIKSEQ
FT                   ELSPELAEKVQRMREVSERIVKKKLSTGDVQSLIKSSKLTKRLLLIPIPLLIQLLQAIF
FT                   MFLTARNTTMLSPLMLSQIKFQSQSSASPKSGLFLTNLEIANRSISSLKQDLKEEFQKK
FT                   YGVECNFSFLKAQIQTFLKLYLEQAKLEEEFRIISNPRKGRVENRAQKIELFYKELKPR
FT                   LQKIKREVIVFLDCYLTYLDTISSKNIEPTKREDCSWSDLMVLNFFLTAFKGLAMLFRE
FT                   SLTPFESDIEKFERLKERPKKDLSESERQILKTLNPSMRKVEQLRSDSALSSLVSSVLL
FT                   TIMGKCINHLNSEN"
FT                   /protein_id="XP_626749.1"
FT   gene            <476206..>477861
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1780"
FT                   /db_xref="GeneID:3374158"
FT                   /locus_tag="cgd3_1780"
FT   mRNA            <476206..>477861
FT                   /db_xref="GI:66359143"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1780"
FT                   /db_xref="GeneID:3374158"
FT                   /locus_tag="cgd3_1780"
FT                   /transcript_id="XM_626750.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        476206..477861
FT                   /locus_tag="cgd3_1780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with a signal peptide, within locus of
FT                   cryptosporidium paralogs"
FT                   /db_xref="GI:66359144"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1780"
FT                   /db_xref="GeneID:3374158"
FT                   /translation="MRLKVATLIAIISLINPLNVLYHVEDIRQISKYGDNKLDTSFSLL
FT                   EIFKKKSKRNKKQTSSIEESDSTSDSEIENKNQDSVDKEKKKKRSKFRKRLRRIPIFFR
FT                   NLFRRNKNKTKANGKHKRNRRHKTEKSASIEEESPDQANKRVRQPETVLKPEVGLGSDS
FT                   KSGTESGSESKPELEPEPEPVPGSGSEPKAEEGIRSSQGELSIQNKLESMKNLDISKMF
FT                   SEARNKRNRDKSFVNELKHKLKPQQGGYDQIKNLISEGNPDGQKIILEMNYEGFYKYLN
FT                   QEMTSNTGGIVPIVELDELISSINFDQMLLNLEPKNGNVEKKIKSLFRTENENYKIKVN
FT                   SLFDVYRQDYGQECTFEWMNDLVTMYYNAFMEFKSVEEDYQNLLDPRKSTPSERARNLS
FT                   KTYYSMKEAKSKIREILMKYLNCFMITFFFIKIDAINVGENHEKCTIQDLVTLLYYQNI
FT                   FLALKNLFNSAFKEKEAEISEFNTMLISGIESLSEEKRNKYVILSRLSEKLFPLYKDAN
FT                   LYGTLIEIIDLKLSSCLTYIINNQESTKEHYSKF"
FT                   /protein_id="XP_626750.1"
FT   gene            complement(<478215..>481589)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1790"
FT                   /db_xref="GeneID:3374159"
FT                   /locus_tag="cgd3_1790"
FT   mRNA            complement(<478215..>481589)
FT                   /db_xref="GI:66359145"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1790"
FT                   /db_xref="GeneID:3374159"
FT                   /locus_tag="cgd3_1790"
FT                   /transcript_id="XM_626751.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(478215..481589)
FT                   /locus_tag="cgd3_1790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to CAS/CSE proteins involved in chromosome
FT                   segregation, and importins"
FT                   /db_xref="GI:66359146"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1790"
FT                   /db_xref="GeneID:3374159"
FT                   /translation="MEEIVTLLGLSTSINPADVKMAENSLNMKEGMPGFIETLLMIVTK
FT                   TDIELHIRQVGCIYMKNLVKRKWDIDWEHGGMNKHDRDIIKGNIVNIYMNTPKMIQSQI
FT                   GEMLLYISIRDFPVYWNDLLVIIVKFLPDEQTDLLSNNGMFLGSDLNALVSKLQQYEST
FT                   LSMIKLILDKYRYAESSNKVLLELKEILKVVCEPMYRMFVYSSQCLLRRLPVIQDNTSR
FT                   QLVMNICLLSCQLFYILHCCDIPEFFEDRIGPFMESFQAILELDTTPGLVDSEDQLIIC
FT                   LNIKSQIFENLRIYSDRYQEPFDIYARKSLSTVAILLTKMVSQNNNTIDTNPELSSSIS
FT                   SLIDEGLRLIGSLAATQWSDNAFMDSGVLDHLVEKILIPCTFLDINDLNIIEETPKDFV
FT                   YKYLWDINDVCDSTSKRSAALECIKNLGKFYYTKLSELLSNLIISLLNGISNDAHGSSS
FT                   IFDWEEFNEKSGNYCKYQITKSDVTREASVFLFICLSVRSFSKIGGVAHLEHGIDIVGF
FT                   YDNYIKSFTSSPLMRCCALKYLIVFKSHFNNASSLDILQQSYNWLSTQTSSIEEMMILL
FT                   AFERILTQKTASSTGNPSIQGGGIGANTSICTSNDNSNSGGALLKVQQGMGSQETVFKL
FT                   SPAETYNLCFQMIGNILHPMLKKAFQGGDKRTYLTESEFIPRCMMRLLTYLGKLGSELV
FT                   NTLAPTIAECTKLAVENPKNPSFNHYLFELLGVCIRNSSDCEKLDNFVLPILIGILEKN
FT                   LTDFIPYSLQLLALRLDTLASQNELYDKLFIHLIDAKIWHGPASAVPGIVRLCSSFFKR
FT                   HSLFEATISSHVKQVFERFQFCLSHRRFQSTLSFEFLRDIVRFLPFQWYSQYLTALANL
FT                   LLTKSQEWNRIGDHQTIIQVVGAFSIIVIKKPYGEMPETSLLNVLDTLQNGLSFIFFSK
FT                   VVFPNLLKATLSPPLRYTIFIALLKLVSELTFEQSKRNDFVLEAFKSVYLLFNAIKLSD
FT                   DPNFQRRNSISTDPSGVSDDSAQSNYLAVLPDSNLDSQNPIQDEFEINYHKLLTASCHS
FT                   SNNSYPSHKEILQILTSGPSSTGIGANSAHACNFIECIRNSEQLNLMKITFQPYLNEIS
FT                   NHFVGDQNIQSFINSLK"
FT                   /protein_id="XP_626751.1"
FT   gene            complement(<482003..>483688)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1800"
FT                   /db_xref="GeneID:3374157"
FT                   /locus_tag="cgd3_1800"
FT   mRNA            complement(<482003..>483688)
FT                   /db_xref="GI:66359147"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1800"
FT                   /db_xref="GeneID:3374157"
FT                   /locus_tag="cgd3_1800"
FT                   /transcript_id="XM_626752.1"
FT                   /product="hypothetical protein with 12 transmembrane
FT                   domains"
FT   CDS_pept        complement(482003..483688)
FT                   /locus_tag="cgd3_1800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 12 transmembrane
FT                   domains"
FT                   /db_xref="GI:66359148"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1800"
FT                   /db_xref="GeneID:3374157"
FT                   /translation="MDNTSLLRAEGGFVPPERNSKLYMMLLILISSWANSCITMIWPLL
FT                   VVGDYLRLPFQAIMFLIEGLFCFFLGMTSDLKSKKTSLKYSLKIMLGSVLAVLLIVLTN
FT                   LFIETKFLKLDILRYSGRSGGLYVFNSETLNDNILIFDETTNIMNNIHREEADLAPGSS
FT                   EMNFGNKVELDENNSNLQLKPNSVSVLVFTLILFAICCILQSSSNSMYYNLNILIVDSS
FT                   IDDYNTRYSNSYIDFAGWSEICFYNIGSYLSLLISRLTFISILELLTQKNLKFSNKTIE
FT                   IDYIHIYCFNLLVLLIMIPFGYYLVEHKLKLNFTNNSIYQINYQNIKQYSTNIQEFIGD
FT                   KSNLFWFLVIPYWIIYFIQSGNNFHKWIVIDQTAFNIEWWELYSFIYEAIISLILSIFL
FT                   AYMSNTFSPVILQVYCFAILSMVSFGLTLCTYMLHEIPVKTFTDFISAFTLCHGIFHIS
FT                   CVVPSINALYFSIKFTPSEIKSMVLAIIHTILLSAPILDQIINNYSFKLINISEKFLLI
FT                   TAINLIGIIYTGLFMAKQSIEESSFRTSLELLPVYNYHENKTIK"
FT                   /protein_id="XP_626752.1"
FT   gene            <484831..>486126
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1810"
FT                   /db_xref="GeneID:3374084"
FT                   /locus_tag="cgd3_1810"
FT   mRNA            <484831..>486126
FT                   /db_xref="GI:126644762"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1810"
FT                   /db_xref="GeneID:3374084"
FT                   /locus_tag="cgd3_1810"
FT                   /transcript_id="XM_001388066.1"
FT                   /product="casein kinase I"
FT   CDS_pept        484831..486126
FT                   /locus_tag="cgd3_1810"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="casein kinase I"
FT                   /db_xref="GI:126644763"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1810"
FT                   /db_xref="GeneID:3374084"
FT                   /translation="MEVRVGGKYRLGRKIGSGSFGDIYLGTNVTNSEEVAIKLESVKSR
FT                   HPQLLYESKLYKILAGGIGVPTVHWYGIEGDYNVMILDLLGPSLEDLFTICNRKFSLKT
FT                   VLMLADQMLNRIEFVHSKNFIHRDIKPDNFLIGRGKKLNVVYIIDFGLAKKYRDPKSQA
FT                   HIPYREGKNLTGTARYASINTHLGIEQSRRDDLEALGYVLMYFNRGTLPWQGLKATSKK
FT                   DKYDKIMERKIATPIETLCKHHPFEFITFLNYCRALRFEDRPDYAYLRRLFKDLFFREG
FT                   YQYDFIFDWSFLQPEKDRRRTGNSVGVGVGVPVGAAVANAGANGPIPTNGMGVGVTQGN
FT                   IPAGQSTNVVAAGIGTATGAILPHNASLPNQAGPSQCMMPGGPSSPAGIPVAGGATQVT
FT                   YTQTNANCVAGEGGQNVYHESQQDEQWGGVVK"
FT                   /protein_id="XP_001388103.1"
FT   gene            <487048..>489324
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1820"
FT                   /db_xref="GeneID:3373830"
FT                   /locus_tag="cgd3_1820"
FT   mRNA            <487048..>489324
FT                   /db_xref="GI:66359149"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1820"
FT                   /db_xref="GeneID:3373830"
FT                   /locus_tag="cgd3_1820"
FT                   /transcript_id="XM_626753.1"
FT                   /product="putative Sec23"
FT   CDS_pept        <487048..489324
FT                   /locus_tag="cgd3_1820"
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Sec23"
FT                   /db_xref="GI:66359150"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1820"
FT                   /db_xref="GeneID:3373830"
FT                   /translation="RMDYQEQESQTGVRFNWNIWPSTKLEATRVEIPLGCLFTPLKESS
FT                   KLQLVEYEPIRCRASGCILNPYCPVDFRSKVWTCPFSLQRNPFPPHYAEHISETVLPAE
FT                   LMYPSVEYILPGIPANNVSPPVFIFVIDTCLIEAELTELRDSIQQAVSLMPSDALVGLI
FT                   TYGTVCCVHELGFTECPKSYVFRGTKDVTSQQLQLQLGLTSRGDTRNQMAEGSSRRFLL
FT                   PVSECEYSLMNILDDLQPDSWPIPADTRPQRCTGVALAVATGLMEACCVQQSGRIMLFV
FT                   GGVCTVGPGTIVSLPLAESIRHHLDLQKNSNSARHVQKALKFYSSLAQRAVQNGHAVDI
FT                   LACSLDQVGLHEMRVLCDRSGGHMVMSDSFSMNIFRDSFKKMFEPDASGYIKQAFNGRV
FT                   EILCSKDVKINGAIGACTSTGKKGAQVGDTMIGESNTCEWAFGAMDKNTTVAFYFEVVA
FT                   QGVNQIPPGKQSFIQFQTLYNHPSGRKRLRVTTVSYRYSEPNILDLAPGFDQESAAVLM
FT                   ARLAVSKTESEDGLDVLRWLDRKLIRLVSRFADYQKDDPNSFHLSSEFSIYPQFMYHLR
FT                   RSHFLQTFNASPDETAYYRTVLLRENVMNSLVMIQPALLQYSFDEGPPQPVLLDVQSLK
FT                   PNVILLLDSFFHIVVWYGEMIHQWKEQGYHENPEYENFKNLLLAPAEDAKSILQDRFPV
FT                   PKFVLCHAGGSQARFLLAKVNPSATHNTLSGATFDSVSDGSIVITDDVSLKVFMEHLIK
FT                   LAVQS"
FT                   /protein_id="XP_626753.1"
FT   gene            complement(<489375..>492674)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1830"
FT                   /db_xref="GeneID:3374156"
FT                   /locus_tag="cgd3_1830"
FT   mRNA            complement(<489375..>492674)
FT                   /db_xref="GI:66359151"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1830"
FT                   /db_xref="GeneID:3374156"
FT                   /locus_tag="cgd3_1830"
FT                   /transcript_id="XM_626754.1"
FT                   /product="hypothetical protein having a signal peptide"
FT   CDS_pept        complement(489375..492674)
FT                   /locus_tag="cgd3_1830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein having a signal peptide"
FT                   /db_xref="GI:66359152"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1830"
FT                   /db_xref="GeneID:3374156"
FT                   /translation="MKIPRISKRGSNQLLLLFFSGLFLLNYVFCINTTKIACNACIYRP
FT                   VVSNLNTHFYGSKSNIVDFEFQIPCTFYSPIITVSVPKSYKINQLKLLPSSNIGKFEDY
FT                   ETSCLEENESYLEHKVEKGIVEKSSSIDTKNSLFAFDNIVNEQIPSCDLGKDAENELIQ
FT                   VFTSLGFQTWQVVSQNSSKCLEVPKYETKGTESLKMMGNLANGSYVLRFDLQNPIKEEF
FT                   AGNWNLSITSTKNNFPTTPFCLTYIDQTSVSRTLGPMLGPLNVKNATFNSYYTGSQKGE
FT                   FSFIINSLKWNGSNKINQQISEIGELEPIRIRLTFPACENQNDCYSINSKNSETFCQIY
FT                   GHKYECYLERKKPELVLSIGLSEAIDNNNLNSIFPLKVGIKDLVIPFKSEANYKLKIEV
FT                   LIPSVPISKPEFLNLNVSTVEEITKKNQCIGQWIKFLIKDQTVSNLMNNNNSLSYSSVS
FT                   IGTYKLPKTRDIGIQIRYRVSNSETYPILLRIGKMNDKVQGSYNIRVKPLVEGAQFVKK
FT                   ELDQRIGYSNVLLNALIYDKSRLQEELSIEFETKSDSILLRNVDPDNPLECILLVEGPK
FT                   SKRNSKYQENIFEAQKKEWEVEIFSIGDEIVQDEEENVQVITKKVLLGEILDPRETEIS
FT                   EIGGPFVFVDTKEKYSMVVYFFLIGHQYNRMMTISMLIPKSITEYINTDLNVRVIPPES
FT                   YDISKTFSGGGVKITKYAKERILAITLESNEGFREGWWGLSIDITRPVVINSMHLTEYV
FT                   EFNISSSVSTMDSPYLTSLLFLSVHENFKGPYKTPVANKLQYVKGENYIFQVISVQQSH
FT                   TSFHPFPMLKDQIVELETNSPNYLVTKLMYMEKFRFLYIISEPSLDGKEIDIVTREIGN
FT                   LGSSSCQIILVLGNGYFKGSKCDKVVKYSRLDKERNSNKSSGSKDKNFALVKRLLSKFL
FT                   SSKEKFIMSLITLVIEEDDIETYDNGIYSADDTSPNERVNYNFIIKKKSKVNTWKLRLD
FT                   PSPTYFESYYQFRKALISTHYYNLYTVPSSIQALKVCPPEVPILSQEKTSSQPLVLKYK
FT                   FFSEIISSYNYSVTPNIPGTCIKQRLITSNSIDRKIPGVLTISLVLLLILI"
FT                   /protein_id="XP_626754.1"
FT   gene            complement(<493158..>498431)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1840"
FT                   /db_xref="GeneID:3374155"
FT                   /locus_tag="cgd3_1840"
FT   mRNA            complement(<493158..>498431)
FT                   /db_xref="GI:66359153"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1840"
FT                   /db_xref="GeneID:3374155"
FT                   /locus_tag="cgd3_1840"
FT                   /transcript_id="XM_626755.1"
FT                   /product="large uncharacterized protein"
FT   CDS_pept        complement(493158..498431)
FT                   /locus_tag="cgd3_1840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large uncharacterized protein"
FT                   /db_xref="GI:66359154"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1840"
FT                   /db_xref="GeneID:3374155"
FT                   /translation="MKSRPNGSSTLSNILQQYSDSVSQGEGVGYIGIEWKGPFPLHNSI
FT                   IQHVKRVQLLIGKSPSLVYGVIPNIKYGYVGLENMLYIFPIEETIQKVLRRESSIGSST
FT                   ERRSIDRMRSVPSNFEQGFDGKPASDESILTIVFPFSIKNMTGTFPRVGIFTSDVEYLL
FT                   CVITEKSVHLLALKFDNFDLAGDYSQVSDNDKTVPRGAGLIKVPIMNIRGKDIGMLQCS
FT                   LPGSHNSKFHSLQGTLDGRFFFLEENSSSIHELVYQSSEGWITPYCYIHSHQIYSSFTK
FT                   ELFLKYTFLRFMPRSFSIKKISLSPCGFMAILDTSQNIYLAAYLNDINSKEVLSNIIPW
FT                   GRMVNSLGYWASNLDINTFFLPTDWDNYVSSEFQNSEKLFSKTENLNLENFSLGLFNKD
FT                   DSKRFSSPSSLKVVAMLRKKDIFDIFSKIPGNPLFKKNEESFSMYSIRAEYQNQFDIND
FT                   LQLFFTSDYNLSLSLFTNNGTRLQFQCSKRTNEVMPSIQSVINGFRFDPESLFESPKKK
FT                   IQTETTFNQSKLSSSSYSSNDLTFGFWLTYVLPASSSRNENSNISNSYYRNGLTIITRN
FT                   ATSYSFQNVNASTDFSKTPNKNICQVELRLFSSLPADIGITSSSNFRNRTLNSQNSPTL
FT                   NLRYNGNFSSASQCSKGEPIIIEFDEQVKAIHEFTPYSENSNNNNLNNFEDLHTSACKR
FT                   SRASPNVFLEYGGNPLGNNNRQHDLLGWVKDRCIVFVGETRYFFLVLKWNGLQQIVGAS
FT                   GLFMQLIQCPLTSSTNSSQFRRLVHPEDSFLTDDHLSLTSPWVEALSGAIAFDLKSVLE
FT                   LPPFYKYENKMQLQLTTQILEVCLSKLQSLLNILSRSQNIIGNEVFDPSSLPCIPPTMS
FT                   RPFNQILSEELNKNYDTHLKDSTTFLLKSLAYITNFLLQLFRFLTLFDSSPPELKDFTF
FT                   KTFVKHDQNLLTEMPILYLIVSNTGVSQIKKFVESFSVNILEAISYQDRSIIEISFVTQ
FT                   IKLIYKKIGWLVNSKSSKIMKRLALVADLSIEVGDCLYNNHLKESSMIERISSRNLPPI
FT                   GGFSLPPFKYWEYFQADPSQNEYFREIFSSLLLKPFNKTEETTLLLLDCISHFDHLLTE
FT                   QLKLKQNFIGSDSQEEFNTQNYNIYFLHIEQIIKAWSDSLCDAFIESFDCNASLSEISF
FT                   NSMKSLILLSFSQPLKTLFSSCFNKKVLESCVARLLRDLFPVMMSRFIATFTRAEKRNS
FT                   CCCQILLEDIIEISRYDSLQRTRCSEKSLLGIIAFSISKSFKSLNSNQHLKEYNWNDFS
FT                   SFLYGLAAESNYSPYYFILSTIYLLDDFQETHSGYIKCINMLSELSLNKNVLCGSYCKN
FT                   VRTRIETLRLIKEICISGVGKGLISVDMNVSQLLPRLLTESYFDRNQFQMDYSLEYAIS
FT                   NLEGIISLCSNLQIPLLDYIEKLAYNQGQTFNQLIQILSTQIFPCSELNSLIKSNSYIE
FT                   PFLIVSTLLESSVSIKQEDNNIEYLCSQISDYLLQSLIPPKDHVIYFHFSDPDYGSQLP
FT                   ILSKFFGFNGPDNLSESINRLLEFIQTPLLNISGTSLLGSLSVTPRTYLCVGLSNQEIF
FT                   EKYDLFQQIYSITAIFEFTNYYISALSQNIIDPCNLSQLPTSISIQLWNKSWSVPYDLL
FT                   FDVYISLLDSSLASNSSSDPFMLIFNRIKALESPIFKFEPIINHHDFFILHLRKCIIGI
FT                   LDSWIKNRKLSPLNKNHVSMANNFLISTLAYLQNAYSTDQSQKLTSTIENIQIELQNSK
FT                   L"
FT                   /protein_id="XP_626755.1"
FT   gene            <499426..>500442
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1850"
FT                   /db_xref="GeneID:3374154"
FT                   /locus_tag="cgd3_1850"
FT   mRNA            <499426..>500442
FT                   /db_xref="GI:66359155"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1850"
FT                   /db_xref="GeneID:3374154"
FT                   /locus_tag="cgd3_1850"
FT                   /transcript_id="XM_626756.1"
FT                   /product="putative casein kinase II regulatory subunit;
FT                   besthit Pf 23508244"
FT   CDS_pept        499426..500442
FT                   /locus_tag="cgd3_1850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative casein kinase II regulatory subunit;
FT                   besthit Pf 23508244"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359156"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1850"
FT                   /db_xref="GeneID:3374154"
FT                   /translation="MISLINEGDTSLPQWNNMMGLNSDSDESENGWVHWYCGLREHYFF
FT                   IVIPNEYTRDAFNLYGLRQYFPKNYDSLIELILSSNIPDEDDLADPALQDLHREAGELY
FT                   GLIHARYITTPRGLQIMKHKYDKGCFGKCPRVLCNGYKVLPVGITNELRSRRVRVYCPN
FT                   CQEAYDPRNVNLIDIDGAFFGTSFPHIFLQVYPEYISTSCPEPYYPKIFGFRVSDKLSI
FT                   IERKGINGEYGKRAQVEMFKARPSSVQHIEKPQLLNIGTGKLQNSMVDGSNVNSSSNQD
FT                   NLNSRNSEYNSTASSKTIKSSNTSNANVLAYRPEDINMNQMPYNLNSASRSCSYSRQ"
FT                   /protein_id="XP_626756.1"
FT   gene            <500706..>502412
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1860"
FT                   /db_xref="GeneID:3374153"
FT                   /locus_tag="cgd3_1860"
FT   mRNA            <500706..>502412
FT                   /db_xref="GI:66359157"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1860"
FT                   /db_xref="GeneID:3374153"
FT                   /locus_tag="cgd3_1860"
FT                   /transcript_id="XM_626757.1"
FT                   /product="extracellular protein with a signal peptide and 9
FT                   EGF domains"
FT   CDS_pept        500706..502412
FT                   /locus_tag="cgd3_1860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular protein with a signal peptide and 9
FT                   EGF domains"
FT                   /db_xref="GI:66359158"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1860"
FT                   /db_xref="GeneID:3374153"
FT                   /translation="MMLLISYIIFIYTWLILFKKVDGSFLTGNNIAAITTKQGTKSNTG
FT                   SILGNANSMDTILMTAKILSTADTIQKSIQNENKDQRVRASGAEVGQENFTNLKGQNST
FT                   REDLIGPGIQYCNIDKDGLCCLMPNYCSKEATCKSDIVGQQTYIDYLNALPRCQCLPGY
FT                   IGDGRTKGTGCQNVNECLTGEARCEQLCTDYSPGYACSCNMGYRLNTKDMRSCIDIDEC
FT                   MEGSHSCSHICVNTRGSFVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCKNLPG
FT                   GFECQCPSGYKLDKKTQKCIDIDECKEEKNLCTGFGEVCFNKKGGFECKCGIGFQYDEN
FT                   ENACKDINECVLNTHDCKKDSVCVNEDGGFSCKCLEKGFEFNKEKRACEDIDECSNGDS
FT                   KCDQLCFNTIGGYKCGCYKGFRLNLTGPEENRLDVQSRVCIDIDECLESPELTGCSHGC
FT                   INKRGGFQCTCPKGFQLGMDGKVCEDIDECRMPENPCENNRQFPCCLNTLGGFTCVEQI
FT                   ISGDLFKRHECPKADGDSIKREPKTGNVNNSSGIFKWFRSNTDTVNRLKTK"
FT                   /protein_id="XP_626757.1"
FT   gene            complement(<502484..>502987)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1870"
FT                   /db_xref="GeneID:3374152"
FT                   /locus_tag="cgd3_1870"
FT   mRNA            complement(<502484..>502987)
FT                   /db_xref="GI:66359159"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1870"
FT                   /db_xref="GeneID:3374152"
FT                   /locus_tag="cgd3_1870"
FT                   /transcript_id="XM_626758.1"
FT                   /product="DNA-directed RNA polymerase 2 subunit"
FT   CDS_pept        complement(502484..502987)
FT                   /locus_tag="cgd3_1870"
FT                   /gene_family="HOG000228134" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase 2 subunit"
FT                   /db_xref="GI:66359160"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1870"
FT                   /db_xref="GeneID:3374152"
FT                   /translation="MERDIRFCPECNNILCPKENIERRKLLYACRNCEYFSYADPTNAE
FT                   ENVVNCITYQYEGKEDILVARGLHQDPTLGRTLEWNCRGCGHNVAVFFQLPERVCSEAM
FT                   TLVFVCVSCGEWVKEGKETDDEMDYSEDHTNIFNRPYFNIDNISFEPKKEETEENNYQQ
FT                   IKEG"
FT                   /protein_id="XP_626758.1"
FT   gene            <503548..>506976
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1880"
FT                   /db_xref="GeneID:3373829"
FT                   /locus_tag="cgd3_1880"
FT   mRNA            <503548..>506976
FT                   /db_xref="GI:66359161"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1880"
FT                   /db_xref="GeneID:3373829"
FT                   /locus_tag="cgd3_1880"
FT                   /transcript_id="XM_626759.1"
FT                   /product="protein with 2x rrm domains"
FT   CDS_pept        <503548..506976
FT                   /locus_tag="cgd3_1880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 2x rrm domains"
FT                   /db_xref="GI:66359162"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1880"
FT                   /db_xref="GeneID:3373829"
FT                   /translation="YFEIIKMRNLIKDIELYPTIADNHLRFIESNIKGEAGLKEVEQLY
FT                   EGALSVCGLHPAEGPVIWSEYRRFLSHQNEENLSLRVSKVRDLFYRQMSLPLSGLPDLL
FT                   DEYRIWEEELPAENRESFDVAKEHYLRGQQEWSLRKPLEMRVQTDNVSNLQELFDAWML
FT                   YINFEKDRMLSIDYSSNAVPPQESHSGCNNCNSSIKYRFDTKDSVIMAYRRALDDLGSI
FT                   RIDLWLELANFISTTTNCPHLLSTVYASSLQHFSTNPKLWMFYLSAKAESIKDITSHFC
FT                   QLHHFYGPGCKARSSATWYPQNYQILKITSLKEMLEIVLENYISELSKFQEIFSKSKQD
FT                   ALELYFVVTNSLIDINKSLKSQLDTAKTCNITYEQTHLEGINILELEELIFKKLEKLYL
FT                   RGEELLLGSNVGLVEGNTNGTGEKFDILEESAALFYSRWFDFELLRSANLKEVIISILE
FT                   KFLDKDEEQVMNLLPIIISVIKGRLTAQDQIEIGPVLIERFSGCSEKIKAKVSSEWEST
FT                   ESFVKYKDSNKRQRLEAFEGDPNILYSPNIGKISLGVSSSSSEGVPTQEVSQCILPLPI
FT                   IHQGPTINASSRTSSLRSISKNNDIEGDFVCLSEIRLRRDKRRNRRNFTESDYDTSSEC
FT                   SSESNSISALLGSSGTNGGRQFLRNFTPPGTPSYSIQKVPGVIAHQNHNLKSPRSPTIT
FT                   SGLQQITLHSDQPGSNSFTPKGSHLIRSPGIVPQDLEARTQCTWDGREAIEPSIAPPIP
FT                   PIPTISSISSVSSNSSHSSFGARQIERSISQSVSLGEQQISISERIVDDQNMPPPTYTP
FT                   KKNKLDRSNEKGGIQRQSSITSVSMAISACEDSDLNSSPKEILKMAKDLPSDSYEEDTL
FT                   FIRFPQDQDMDEEKLRGILLEHFLIQISQIRIVRDPKGKPKGFAYVDIEPEKIDEIMKN
FT                   SEELKRLEEIGIQVKASNPPKSQAPRKSLSSRGNSKYKRQTRRKQAQDQQDSSTTILIK
FT                   NIDKSLDEKQVISHFQDSLGLKVKNISISRDQSGASKGFAFMDFFESGDALAAHMLNES
FT                   KLGSSSITVSSSTRPLTFPKSTNSDVGLTDSLNARFVPRTKSKQKLPSGRIGMRGRENK
FT                   VNTSTFHEDLELGNQHETVNKAPSLTNDDFRKLFL"
FT                   /protein_id="XP_626759.1"
FT   gene            complement(<507106..>509310)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1890"
FT                   /db_xref="GeneID:3374151"
FT                   /locus_tag="cgd3_1890"
FT   mRNA            complement(<507106..>509310)
FT                   /db_xref="GI:66359163"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1890"
FT                   /db_xref="GeneID:3374151"
FT                   /locus_tag="cgd3_1890"
FT                   /transcript_id="XM_626760.1"
FT                   /product="membrane bound phosphatase with 3 transmembrane
FT                   domains and a dual specificity phosphatase"
FT   CDS_pept        complement(507106..509310)
FT                   /locus_tag="cgd3_1890"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane bound phosphatase with 3 transmembrane
FT                   domains and a dual specificity phosphatase"
FT                   /db_xref="GI:66359164"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1890"
FT                   /db_xref="GeneID:3374151"
FT                   /translation="MRNSVDLLCILEQNKVNDHGTSSRVGTFLNRASRAASSPIVHWII
FT                   IFLCILHMAIFLAIFMNKTQNSALNRFCQEIYFPIGIIISVYCIYDSLVILVYICKLLR
FT                   AKYGVSGKLKDETIIMRNSVELFLNLVIGMLSITGLSTDIVGFGKILGYAANWKRLSVF
FT                   LRKQVGQNKRFYTNEEYCLDLVYITDRVIAMGLPAINIEAIYRNPIEEVSTFFMTKYPR
FT                   NHMIINLCNEREHYSLSYFHSIVSCPFPDHQVPTLGSLFIICFLVLNYLVSDRKNVVAI
FT                   HCKGGKGRTGIVVVAWLLYSRLCSSLEEALEYYSNRRTDLSLPGCVKTIKNPSQIRFVH
FT                   YFNFLLKHTFPESVIKRGSNFFWEDLQRGFRSGYYWNICNSELRRVNQKCEKRHWKISE
FT                   LLRDQCIYLPQCLIHPINVFPVSIVVNNKEREISDIFEWKICLHSEYNRDAEYLYSGLT
FT                   TNFDWNPRHAGTHLSQSLYSKGEGYQFFLLESESNKQALSYFGQDQSQLIYSARSKIEQ
FT                   LVSSLKTKPFSPDIVTRTAQDRPKPWIEREFVIKIFGYESPQRHLQKHSLSPKSMHQRS
FT                   EVDSETTEMSCLLYDPIESLKPIEEEEENAHMLRSISLIDFSNPERKKEFSNHVITAVN
FT                   SPYKDIVEFPIKKINEWGSSRRSFSNSSVALAHFWLHPALIHTSSHSNLWTFFLEWDTS
FT                   SKTWLIRDCFLSISLKRKKEIDVRSSNFKNVCIDVTFQYK"
FT                   /protein_id="XP_626760.1"
FT   gene            <510205..>511080
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1900"
FT                   /db_xref="GeneID:3374150"
FT                   /locus_tag="cgd3_1900"
FT   mRNA            <510205..>511080
FT                   /db_xref="GI:66359165"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1900"
FT                   /db_xref="GeneID:3374150"
FT                   /locus_tag="cgd3_1900"
FT                   /transcript_id="XM_626761.1"
FT                   /product="protein with 2 transmembrane domains near
FT                   N-terminus, possible ArgA, N-acetylglutamate synthase and
FT                   related acetyltransferase, camello or GNAT"
FT   CDS_pept        510205..511080
FT                   /locus_tag="cgd3_1900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 2 transmembrane domains near
FT                   N-terminus, possible ArgA, N-acetylglutamate synthase and
FT                   related acetyltransferase, camello or GNAT"
FT                   /db_xref="GI:66359166"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1900"
FT                   /db_xref="GeneID:3374150"
FT                   /translation="MTGNNPYGGYDLVIREFDPSDSDGVRRVCFKHFRSLTFPSVFFYL
FT                   SQHLADMIALLVIGKVFMDFKQLISMLVLFCVYLTGRSIWEVETYIRNCCTDLRNVHEL
FT                   YMISPGYHFWVAELVKRRNSIRKRRSMVLGSGGGSNSRAEGLEQNDHASKSIECEDTPS
FT                   NRMEGGESILVGCVGLAPYRDDPKIGRLVRLVVGVESRRMRIGTRLLAQMENFAKDYGY
FT                   KEIHLYTNNLSTSPIKFISQHGYQLVQVISRGLMRGDLLLWRKSFEKSSSDNSYLNNER
FT                   NSIGERVILD"
FT                   /protein_id="XP_626761.1"
FT   gene            complement(<511114..>512487)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1910"
FT                   /db_xref="GeneID:3374149"
FT                   /locus_tag="cgd3_1910"
FT   mRNA            complement(<511114..>512487)
FT                   /db_xref="GI:66359167"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1910"
FT                   /db_xref="GeneID:3374149"
FT                   /locus_tag="cgd3_1910"
FT                   /transcript_id="XM_626762.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(511114..512487)
FT                   /locus_tag="cgd3_1910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="within N-terminal region, similar to snurportin,
FT                   m3G-cap-specific nuclear import receptor"
FT                   /db_xref="GI:66359168"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1910"
FT                   /db_xref="GeneID:3374149"
FT                   /translation="MNSSYNSYYKLNHGFIKEKHSDMSSIDKKLRGMLEKLRTERRQKF
FT                   LKFQRTEDKEYFKPKGKSEKVHSKFIKDWKLSKVWSKELIEYTWLSKLSEGYKSIQENP
FT                   QDWLLLPICTGSRSMLIQGNGYCELRNQDGWRIFTVKNVPFAHTGLTIIDGIYNQDQNT
FT                   FYCNDLIVWNNLNICISTTECRLHFLSSRIEESGVTNRTAESMDVSMVLDSNLKLIPNI
FT                   RIQLGKYFPLSKDSLLHIYGVNDRMHGPLSDFDCLVFVRKDSVYDVEQDYEDAYPECKE
FT                   YCTASQKNWFIWRDKQNKSFKDCRDKEMDDNTTFKLNINEKNELYTKDKVLIGKVRCSG
FT                   TLTENLSLDNDQKILLNEFGIVFVKVKFETENILNLLNIISSRCLNSICGNNYSKSENI
FT                   FELSNVSIQDKFSCKLDSSDYIFFKCIEFITETKYSSCMIPNESNLNLNVESLLNSIS"
FT                   /protein_id="XP_626762.1"
FT   gene            complement(<512817..>513602)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1920"
FT                   /db_xref="GeneID:3374148"
FT                   /locus_tag="cgd3_1920"
FT   mRNA            complement(<512817..>513602)
FT                   /db_xref="GI:66359169"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1920"
FT                   /db_xref="GeneID:3374148"
FT                   /locus_tag="cgd3_1920"
FT                   /transcript_id="XM_626763.1"
FT                   /product="possible PRP38 pre-mRNA splicing factor family
FT                   member"
FT   CDS_pept        complement(512817..513602)
FT                   /locus_tag="cgd3_1920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible PRP38 pre-mRNA splicing factor family
FT                   member"
FT                   /db_xref="GI:66359170"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1920"
FT                   /db_xref="GeneID:3374148"
FT                   /translation="MRNEQNSHHKLFSVSSILRDRVFSSIYWKGECFALDSETILDKAV
FT                   LLDYIGTTYGGDRKATPFLCLLVKLLQIRPSTEIVLEYINNPRFKYLTALGIVYLRLTE
FT                   SSIVIHKSIEHLYQDYRRIRIRNLDGSFDIIHLDELVEICLCEKKFLDLDFPYIHKRAV
FT                   LVKQGHLKFPRKSMLEYVPSNSGGSSPISKTENESNIKRRKSFSRSPSVSSIEGNNTQN
FT                   PGKEKARKTSIYSSKNELSLSVEQWNVYRKKLGLKPLQE"
FT                   /protein_id="XP_626763.1"
FT   gene            <514040..>515026
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1930"
FT                   /db_xref="GeneID:3374147"
FT                   /locus_tag="cgd3_1930"
FT   mRNA            <514040..>515026
FT                   /db_xref="GI:66359171"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1930"
FT                   /db_xref="GeneID:3374147"
FT                   /locus_tag="cgd3_1930"
FT                   /transcript_id="XM_626764.1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains"
FT   CDS_pept        514040..515026
FT                   /locus_tag="cgd3_1930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains"
FT                   /db_xref="GI:66359172"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1930"
FT                   /db_xref="GeneID:3374147"
FT                   /translation="MMASRKQEEVLVIYIKSVIQLICSLCVIIIIFNKDWISGQNTISE
FT                   SFVVGFLDELCIRSSVLPLSRQSWKESDVGKSFNLNESEKSPFQARKSNSDIIKNKLGK
FT                   TLDSEIVNSSILRHKKLSHRHKLKLDVEEVNNLFQQKLLGENGNITSLKGNESKLNNGE
FT                   SKKSGLYFSSFDQVQYCISHKSNKLVKDWYIHPNYLSYLVLFIVIVSVIFSLNLIKMKN
FT                   KWSSYELLIPILDFLVFSISLLNLAQILHVLTPLLTYLQKHNFMAFFSTNFFMLSGSIG
FT                   GFFIVFSLSIGIIHYRYEAFTNLKRFEDQIENIQSFSSFIHLISNSN"
FT                   /protein_id="XP_626764.1"
FT   gene            complement(<515198..>515716)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1940"
FT                   /db_xref="GeneID:3374146"
FT                   /locus_tag="cgd3_1940"
FT   mRNA            complement(<515198..>515716)
FT                   /db_xref="GI:66359173"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1940"
FT                   /db_xref="GeneID:3374146"
FT                   /locus_tag="cgd3_1940"
FT                   /transcript_id="XM_626765.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(515198..515716)
FT                   /locus_tag="cgd3_1940"
FT                   /gene_family="HOG000203361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to translationally controlled tumor protein;
FT                   transcripts identified by EST"
FT                   /db_xref="GI:66359174"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1940"
FT                   /db_xref="GeneID:3374146"
FT                   /translation="MKVYKCIFTGDEVMSDSYKQTSPFGKAEFDDIAFEVQSKRVQKSA
FT                   EDFGIAHNTEEGEAEVVDADVETVNDIIDAFKLESTPFTKKEYMTYIKAYLARIKEAME
FT                   KSNPDRVETFMKNAQTFVKYLLERFDDLEFYLGPSLDCEGIIIYGYYEDGDLAPRFIYF
FT                   KDALNEERY"
FT                   /protein_id="XP_626765.1"
FT   gene            <516445..>516783
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1950"
FT                   /db_xref="GeneID:3374083"
FT                   /locus_tag="cgd3_1950"
FT   mRNA            join(<516445..516522,516574..>516783)
FT                   /db_xref="GI:126644764"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1950"
FT                   /db_xref="GeneID:3374083"
FT                   /locus_tag="cgd3_1950"
FT                   /transcript_id="XM_001388067.1"
FT                   /product="BIS(5'-nucleosyl)-tetraphosphatase (diadenosine
FT                   tetraphosphatase), putative"
FT   CDS_pept        join(<516445..516522,516574..516783)
FT                   /locus_tag="cgd3_1950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="BIS(5'-nucleosyl)-tetraphosphatase (diadenosine
FT                   tetraphosphatase), putative"
FT                   /db_xref="GI:126644765"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1950"
FT                   /db_xref="GeneID:3374083"
FT                   /translation="KTLFRETLEETGIGPQQIKLYNNFVKEIQYEAWNKKKTVFYYLGE
FT                   CMNDTKIVISHEHSEYKWANISQVRQLVEFESLIQIFNDAFERIVMEKKL"
FT                   /protein_id="XP_001388104.1"
FT   gene            complement(<516836..>517690)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1960"
FT                   /db_xref="GeneID:3374051"
FT                   /locus_tag="cgd3_1960"
FT   mRNA            complement(<516836..>517690)
FT                   /db_xref="GI:66359175"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1960"
FT                   /db_xref="GeneID:3374051"
FT                   /locus_tag="cgd3_1960"
FT                   /transcript_id="XM_626766.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(516836..517690)
FT                   /locus_tag="cgd3_1960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359176"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1960"
FT                   /db_xref="GeneID:3374051"
FT                   /translation="MEGEGLGMANTTDLACPMNLEEEVKMHENSNQEEAMVKGQVVGKE
FT                   NGTITVETDLMEKLKSQHIVEEESNKSVGKTLEEAVCTENSNNSNSNVESTLKGEKQDE
FT                   NKENIEMKDVTSPENKGKSKHLSKIDFSVFEEGFYRRYKSFFHDRQADEIDLTQDKATI
FT                   SKKINEHFSNFEINPVDVIRTFLVLRKNSEHSHGHFVMSPAQSPEPNIHPSSEGNTRGR
FT                   RCANKDMGGVSNDANNAETNANGVNYKGEYKSENSSIVDNHTEIGVSTRNSRKGRVSNR
FT                   GRR"
FT                   /protein_id="XP_626766.1"
FT   gene            <517963..>518319
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1970"
FT                   /db_xref="GeneID:3374050"
FT                   /locus_tag="cgd3_1970"
FT   mRNA            <517963..>518319
FT                   /db_xref="GI:66359177"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1970"
FT                   /db_xref="GeneID:3374050"
FT                   /locus_tag="cgd3_1970"
FT                   /transcript_id="XM_626767.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        517963..518319
FT                   /locus_tag="cgd3_1970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359178"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1970"
FT                   /db_xref="GeneID:3374050"
FT                   /translation="MRSITIEELSEIDDDNIRQLAEIIIKGNLNEPSESRYINEILNST
FT                   GEQLNQKAQNLSQSIKEKNKKLQEMTDELQFMNISLQQLNSPKALKKMTLKELKQHCSS
FT                   LRSIMTSYLDSFNQ"
FT                   /protein_id="XP_626767.1"
FT   gene            <519808..>522639
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1980"
FT                   /db_xref="GeneID:3374049"
FT                   /locus_tag="cgd3_1980"
FT   mRNA            <519808..>522639
FT                   /db_xref="GI:66359179"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1980"
FT                   /db_xref="GeneID:3374049"
FT                   /locus_tag="cgd3_1980"
FT                   /transcript_id="XM_626768.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        519808..522639
FT                   /locus_tag="cgd3_1980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359180"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1980"
FT                   /db_xref="GeneID:3374049"
FT                   /translation="MTSCSEKIKASESGTKVSAASHESLAKDEVFQAQIKSIDQAKSSL
FT                   LELDPEIVENSTNQTENGSGSVVITPTGVSKTNSIDDITTCTTSSDISTPIELSLTAKR
FT                   PRAETSFSDKLDSDTLEPTIKVQSLDPSIGIVSKSEAEIRSSFIQDHGPASTVVSSPTP
FT                   CNSIVFKCIDTSESGVDINNRTESNSTEVIPTSEASKSTTASASPLNQSQSCKDELNSG
FT                   ICMGAKQPAFLSSKQLFDELVQLAAVSPTTGASGIALLNPQQLASLDNGVLQQSLQNFG
FT                   LLMGTGLGMPSLGATGNTTPIKVQSPSISASQLMVGSMGPSSAEDLQQSTSASTTASAS
FT                   TATSSAASPLTSPINLSSASATHGSAGQIPGMVAQNQFISQLMANPLFQSQAIASQSSQ
FT                   NLNRMVSAAFGAGSPQTTPASNTFGWPSGGSTTPQGFCPTGTQPGMANFAALLAAANSQ
FT                   LHGHNAFPVSFPTPVNRSISNGSNPILMPMQSATPSDGSAFEGAQTSTTASTASPSEAS
FT                   TYPSIGQQNDPLLRLGAGLPHNSSGTPCIPPFWNTNPALLASAASLIGSGDISQTMALL
FT                   NVNPLGLQPFVQAQTPQQANTHNSNSEEEGANRAQQNCLSLLASLQQPSFDFSSLSTSS
FT                   PATLAALASAATAATNAQLSSAAQTQPDAENHASKPVAKASGSGRASHGSGSRALNASS
FT                   SVTAAAAALDHLDVDWDSVGLREAELAAMEICKTASTLFDTTDGTTPVPSSPAAVGEAV
FT                   LTAAQLTISARAMLKFVKGLTPTQLGINWHACTQRFCVTYTTRDEQNPRSWTLGAYSNG
FT                   KLHYKYFGPRSWTVMGLKEALRKAFKARTSLLLGQGIIEEPEDTGLSKEELTYHARQLL
FT                   QQLRDSLGVKKGNVHKGLYISWHPKTRRFVVALKSCESGKTIYKYFSPKERSIKGIKTA
FT                   LLDAHQMVVAACQ"
FT                   /protein_id="XP_626768.1"
FT   gene            complement(<523094..>526189)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1990"
FT                   /db_xref="GeneID:3374048"
FT                   /locus_tag="cgd3_1990"
FT   mRNA            complement(<523094..>526189)
FT                   /db_xref="GI:66359181"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1990"
FT                   /db_xref="GeneID:3374048"
FT                   /locus_tag="cgd3_1990"
FT                   /transcript_id="XM_626769.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(523094..526189)
FT                   /locus_tag="cgd3_1990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359182"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_1990"
FT                   /db_xref="GeneID:3374048"
FT                   /translation="MTPTNPKASDVTESHETQCVQESKKDQEVPKQEIPQEDDTSVAEE
FT                   DDDDSSEYESLIDSFRFERGLSLFLEIPKETIKYIYSDKLEKHIQLPSIVSFRDLCMEA
FT                   FGEENVVEKRESDTGRRKWDNILKEKSFTQDSKENDDIGEEENKDIEEKENEESERTYE
FT                   DITSFLDTIKSNSKQDSQNVNENVLRKRVHEMSTRLSKQGLLCDPREYYFNPMTMTGAS
FT                   GANRSREDYYDVFDDFIDDSELVDDLGLSLDELYSRNADRGNHTADQGDDNVTTTSIQT
FT                   SELINADYSNPNVFFCDDDPQNDFIDLYYESELGDEYGEISDGDGYSDGEQDDLDMKSG
FT                   GSDVLNEKKSQTLRDILNNPVIKLLVQLRTDCWVYYSPKNAQQNKEQNIEQNSQGSLNA
FT                   QTSSTPMIDFPIGVPSSQATVDLTTPTAKTSEAVSGTYYFPQRTPRVVSDWFRTLNQKI
FT                   KEIIEAYNHCKGYYNEKGNIKYEKNHQDPEIMNYIGVLSSNIEKDPILLRIPSLFSDIY
FT                   SNPADVAPFDSKLIRLIWEGLNICVPINNKKKQFNLSQNSSDSSSIIQLLTRFESFRTK
FT                   WARLILNHNQEALYQFDLNAFEAITNYPPIKNKSPEYVQRVLGSINEYNLQINSSGSKD
FT                   KEEKFDSKVGEPTEGGSTPVLAIDTSNLDEISIEGIKLENLEVSQTQNDTSSEINFERS
FT                   DSFTNTYLMGTMEHSDSQDSPKGDIFDKTRTEKAGDSNSQGIKAVNCDLVFDFGISLLE
FT                   YIHGINRLRIVYKDMISSNVMTKSVQKEQENIPVNGSRGLELMIKGHILKRFSSVNFEG
FT                   QKIKDIPHRFFLNQVKLLQIKYSYKNLTSISARRTKAEPESKAAKKRQRKDTIKVGSEH
FT                   SPNKNFNSVENPVKPKKPRKSNSSSSGEKQIGCVNMAHDSLPREEESSILSNEELLNSN
FT                   LPATTEKLKQKPRKSKKAVKIEGNSPAVPPNEFTECLQPCPLETPKLDFHEQNIQASSF
FT                   GVPPIQSCNQLTYQGIVTRELCDPEKMISHTAQEDLPVYNSE"
FT                   /protein_id="XP_626769.1"
FT   gene            complement(<526658..>529039)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2000"
FT                   /db_xref="GeneID:3374047"
FT                   /locus_tag="cgd3_2000"
FT   mRNA            complement(<526658..>529039)
FT                   /db_xref="GI:66359183"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2000"
FT                   /db_xref="GeneID:3374047"
FT                   /locus_tag="cgd3_2000"
FT                   /transcript_id="XM_626770.1"
FT                   /product="WD repeat protein"
FT   CDS_pept        complement(526658..529039)
FT                   /locus_tag="cgd3_2000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD repeat protein"
FT                   /db_xref="GI:66359184"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2000"
FT                   /db_xref="GeneID:3374047"
FT                   /translation="MERNKLTNQFSITDIYHGLGIPISMVYSRNLLGGAGLCVGDSEGH
FT                   ISLYSTEDKFIERFTEPGIVIRKDERIFSRKLHSGTVTDTKFQNVGFYSEKVERYIYSS
FT                   STDSFLVKFDMEHEKESCKLRAHKEWVKRFAISAESSSLIATVGNDGSLRIYDDRSIHS
FT                   KCFYLGQGNVGRSRTASNKLIPGQISISPSTQVPEGGQNLNESYYESIEKIHLAPKFEL
FT                   NRIHEHSVRKSIGREKMISDKSISVSGVAFLSEKNYLATGGCTDGHIKVWDIRKASCGS
FT                   AERACAFKFSPQKDEDAQRGITWMEADELYNKLALQTRKGTIYIYSVSGILSFSKDLSA
FT                   IAIDSNKVFYEKENAGLLDPSQRPSISSNGEWLITASNSGSRFYLFNTSMGLESSIHYY
FT                   TYENLEESSIPIFQCFAWERGKFSMGGTLKLPPKDGNVNFRVDKCVGREYRLNFSVGTK
FT                   LKKLSFYNNKDFQLDNINSVMPNFSGVSAGDATNSRTAVGKNEEGDLKPRWVSGETLSY
FT                   SNSFDGDMDVANQLSLSSSLSVPFPKPSRSSKANSVDLTLKSMDEKNEEKNEESQELKG
FT                   TREERKTGFLTIGGIGFSEKDSQTLSEGGAFGRPTPTPESVEKTPFRRSIPFMGSSQDS
FT                   VGYPAPQRGQSSYMVQSQENLLTPISPQKDTTDCKGALEMEHESGNTSSNRSHDFNSRR
FT                   IIHIPLSQSNEEVFASPGIDGAESFEADYTIYSEPVPHASVSTPGSPDINSDTMLQDGK
FT                   YEEGNKGFKQRRLDSWVRVRKNTEGGSTANCSTAELSPVS"
FT                   /protein_id="XP_626770.1"
FT   gene            complement(<530028..>532622)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2010"
FT                   /db_xref="GeneID:3374082"
FT                   /locus_tag="cgd3_2010"
FT   mRNA            complement(<530028..>532622)
FT                   /db_xref="GI:126644766"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2010"
FT                   /db_xref="GeneID:3374082"
FT                   /locus_tag="cgd3_2010"
FT                   /transcript_id="XM_001388068.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(530028..532622)
FT                   /locus_tag="cgd3_2010"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644767"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2010"
FT                   /db_xref="GeneID:3374082"
FT                   /translation="MSLFLRKKFRLLSLLVILSLVFLLGLTEIEGKDVAISLRRGTDFG
FT                   VDESSQDFQQKKSESIASHHYVTDKVKNRYSSTAIYFILSGILVIITILSTYIIRECVV
FT                   DRIRRKNDSFLQTVMDTVFRQAACIFVSLAISYCMLTSRLIDHIRNFCENLMADYSNQS
FT                   IINNLATQLDKAIVNNSKVWTAENLGREFNNILAIVILSFAWYCLFVLYFTGCVKFLEK
FT                   WIRYADETDVGVLIKSIFNLQNLFSLKLKKYSDSNFGKEEIRKNKLYLSESKDKFFGEN
FT                   EAVQHNNVPITILNENESTSSYKRSSGLSIDNRTDQTHEGSGKSNYEARRTSIGNNSDN
FT                   ITEESFEDPLDSSNSGGSSEEGSENEGIRSDTDVEEELGLSQLNESIELDINKSLPFKG
FT                   KQHRESSILKRKKNDVEVENLTWKEKLKLKLENFWTKFWLWPNQLFLTYTKAHFISLRY
FT                   DFMDEVAAYDSYGSSFSTNHSGDSGYSEDGLSTSWLISLTDPTTSLVAGVYFTEYLRAK
FT                   LLIMAVTLIRIPITTLTFILGLNVLGWFLIYDYYQNLILFNNVKHYFSEPMICIYISVL
FT                   LLCFSLTIWLRAWLIKRQLQPRNILEYLKMKYSLDVGMPLQEIEYDKIMPRYKISSAKI
FT                   ISNSEYSQISSQSNQSLDQEREVMQNKSCFGRLSKYLRLKLCGTNSPSLHDDLFLFKRN
FT                   GPAILLRWFQASYFLQLILISIVIHLSYLQKRLWYEEFPLATFTIWVIFGIQHLCLPFI
FT                   IYPILLCTSVGQMADKIVLEQVLNIQKTQNIQRLSQISEALRFYSFLHLFNSGSEENKE
FT                   LQRRKFSIVAKTAPWELQIRCRNTMNFLINNAPIRTRVSYSIFLIYKFNNDF"
FT                   /protein_id="XP_001388105.1"
FT   gene            complement(<533780..>535726)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2020"
FT                   /db_xref="GeneID:3373828"
FT                   /locus_tag="cgd3_2020"
FT   mRNA            complement(<533780..>535726)
FT                   /db_xref="GI:66359185"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2020"
FT                   /db_xref="GeneID:3373828"
FT                   /locus_tag="cgd3_2020"
FT                   /transcript_id="XM_626771.1"
FT                   /product="PP2C like protein phosphatase"
FT   CDS_pept        complement(533780..>535726)
FT                   /locus_tag="cgd3_2020"
FT                   /gene_family="HOG000134817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PP2C like protein phosphatase"
FT                   /db_xref="GI:66359186"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2020"
FT                   /db_xref="GeneID:3373828"
FT                   /translation="VVKRKQIKMGMFLTKPSTTKHSDQGGDFDKYGVRFGVSGMQGWRV
FT                   SMEDAHIALPRLDKHPELSLFGVFDGHGGSVISEWVSRHIESIFEQELDTVLKELSSNE
FT                   INLSPDKSKLPNRVVAISEALQRTYIKLDEQMASPTSRPEQRAIYDKKKTNSDTNPPKT
FT                   FLQELLGGIDGQRRVLRMVEQNGNRCLQIVSYNGDEESNSSENGNADGDKVEEVDEIKE
FT                   SSAKNEDSSYGRQPAENIPSTDLDENQNYSDEITPFESDIKRDDATYDDPNAGFIDDDG
FT                   LAEDDGYLEDISDSGACGPEHCGTTAVVAVILPDETGDTPYLIVANAGDSRAVLSRSGQ
FT                   AIALSHDHKPELPLENERILKAHGTVENGRVDGNLNMSRTLGDLQYKSDSSLTPEEQKI
FT                   TAFPDVRIIPLTNEDEFIVLACDGIWDVVDNQLCVDIVRRKILKQIEALESGNDSKKRE
FT                   SNMDGQNDREFGSIESKEQLSISTKLDGSSPIPALTSIQLSKICEEICDECLAPNPVES
FT                   EGIGCDNMTFMIVQLGPNIRKKSSDCMVSAQIGSAVAKRLNAAASAIETQISQAQQGNK
FT                   TDSSPGNFSDDDGTLRNEQSSRMETQARKAPDAVLNAPLPSVSWIPKKEFNVTLYGHGV
FT                   DDGRFDNIPEGRL"
FT                   /protein_id="XP_626771.1"
FT   gene            complement(<536198..>537415)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2030"
FT                   /db_xref="GeneID:3373788"
FT                   /locus_tag="cgd3_2030"
FT   mRNA            complement(<536198..>537415)
FT                   /db_xref="GI:66359187"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2030"
FT                   /db_xref="GeneID:3373788"
FT                   /locus_tag="cgd3_2030"
FT                   /transcript_id="XM_626772.1"
FT                   /product="putative choline kinase"
FT   CDS_pept        complement(536198..>537415)
FT                   /locus_tag="cgd3_2030"
FT                   /gene_family="HOG000281401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative choline kinase"
FT                   /db_xref="GI:66359188"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2030"
FT                   /db_xref="GeneID:3373788"
FT                   /translation="KKKKEMPFPNKKIELGDKLSESIRSFSTITDTEIIIGICRKNIPG
FT                   WKEINESYIEVKQIFSGLTNQLFVVSIVNESMSLSLKHPRILFRIYGKHVGKFYDSKVE
FT                   LDVFRYLSNINIAPNIIADFPEGRIEEFIDGEPLTTKQLQLTHICVEVAKNMGSLHIIN
FT                   SKRADFPSRFDKEPILFKRIYLWREEAKIQVSKNNFQIDKELYSKILEEIDQLEELIMG
FT                   GEKFSMERALELKLYSPAFSLVFAHNDLQENNLLQTQNNIRMIDYEYSAINFAGADIAN
FT                   YFCEYIYDYCSEKQPYFKFKYEDYPCEELRKLFISVYLSQTLQEQVMPSQQIVHIMTKA
FT                   VEVFTLISHITWGLWSIARTPGYQPNSVEFDFTEYANTRFTHYLQKKKELIDQGILPLN
FT                   SWLFNL"
FT                   /protein_id="XP_626772.1"
FT   gene            <537965..>539986
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2040"
FT                   /db_xref="GeneID:3374041"
FT                   /locus_tag="cgd3_2040"
FT   mRNA            <537965..>539986
FT                   /db_xref="GI:66359189"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2040"
FT                   /db_xref="GeneID:3374041"
FT                   /locus_tag="cgd3_2040"
FT                   /transcript_id="XM_626773.1"
FT                   /product="Cca1p, tRNA adenylyltransferase"
FT   CDS_pept        537965..539986
FT                   /locus_tag="cgd3_2040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cca1p, tRNA adenylyltransferase"
FT                   /db_xref="GI:66359190"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2040"
FT                   /db_xref="GeneID:3374041"
FT                   /translation="MSTLSKRKLYITSGDYEDFILEKKIKREIDYSKIFVELNEAENEL
FT                   FKLLIEYTKSSNLKTIVRVAGGWVRDKILRFIYLNSAKNKDSCADNDEEQASTFKKDID
FT                   IALDNISGKDFAIGFNRWLQSHHNYPAHNVGIINRDPDKSKHLETATLAWNEISIDFVG
FT                   LRSETYTLESRIPIITLGTAEEDAFRRDFTINSMFYNLNERKIEDLTCKGIEDLYNGII
FT                   RTPLDPMKTFIDDPLRALRAFRFTSRLHFRVDEELLSACKDKSIHDALQAKISRERVGT
FT                   EVHEMISNKYTGNPAIGLRLIINSNLVDSVFKFPDNEVIYSFINDSEYHCFSNFGDWYS
FT                   PGPYLVELTHRIIEILTSNNLSGCLNNSFDYKKLDIIRKLLYIDQESNWGVSTYFSFLL
FT                   PLFHHYFKNEKNKEIPLVKYIISNSLKLSNKIANSVMQLFDSLLKIIHRVVKLDSLNEL
FT                   ANSTLAENSNRDKLKVDVYSKDFLKSIGDSFFPEIWNFYCNYFKCCLEKWSLTNIHASS
FT                   EYKRDQQSCKFLQRRVELGIFVYFTGNLWLEMLIALFSLDIICNKRSSTHNIGCWSDSE
FT                   LLESLNFHPYMELIKEILEIKMATFYNFRNPVDGKMIQKHFPELQKGPKYKFIINLSLL
FT                   WFLAFSQEPETPNTTEVAKCMEFITENFKEVILDSKPI"
FT                   /protein_id="XP_626773.1"
FT   gene            complement(<539987..>540928)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2050"
FT                   /db_xref="GeneID:3374046"
FT                   /locus_tag="cgd3_2050"
FT   mRNA            complement(<539987..>540928)
FT                   /db_xref="GI:66359191"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2050"
FT                   /db_xref="GeneID:3374046"
FT                   /locus_tag="cgd3_2050"
FT                   /transcript_id="XM_626774.1"
FT                   /product="putative prolyl 4-hydroxylase alpha subunit
FT                   homolog, 2-oxoglutarate-dependent dioxygenase"
FT   CDS_pept        complement(539987..540928)
FT                   /locus_tag="cgd3_2050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative prolyl 4-hydroxylase alpha subunit
FT                   homolog, 2-oxoglutarate-dependent dioxygenase"
FT                   /db_xref="GI:66359192"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2050"
FT                   /db_xref="GeneID:3374046"
FT                   /translation="MGNYSKYLSIVKEKDMVDEEKVIASFVHEKDPSVDTKNITRQKVP
FT                   GFPYAEIWDNVFSEDECKEMIASLEKSGEFSFWNPGHSSKKSYRNVDTIEGNMYLLSKF
FT                   IWERIKNIFNYHEFEINENDSYSEEDNIGKWKSIGIYEKMFFGRYRDGGHFGPHTDCSV
FT                   CIDTNTRTLWTVLVYLNTIPEEGGGATSFVDESQKTQKRFIDESGRERTNPNNVITRVQ
FT                   PRAGRIVTFFIADMHEGEPLCAGYTKYILRTDILYRRVNPILTSEADQRAYILWLKGKD
FT                   LTYRGKMDEANEIFKQVSEISPELATKFNCLC"
FT                   /protein_id="XP_626774.1"
FT   gene            <541327..>542808
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2060"
FT                   /db_xref="GeneID:3373787"
FT                   /locus_tag="cgd3_2060"
FT   mRNA            <541327..>542808
FT                   /db_xref="GI:66359193"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2060"
FT                   /db_xref="GeneID:3373787"
FT                   /locus_tag="cgd3_2060"
FT                   /transcript_id="XM_626775.1"
FT                   /product="ring domain protein"
FT   CDS_pept        <541327..542808
FT                   /locus_tag="cgd3_2060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ring domain protein"
FT                   /db_xref="GI:66359194"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2060"
FT                   /db_xref="GeneID:3373787"
FT                   /translation="TKIHNIESNGALGHVSGSNSNSNRYFCHACQNNVTICENQSDNTD
FT                   LTCPQCGNNGFVELISFGSQQSQGVSLLGITEPINPQEASTNLPRSSWIDISSFPQSGT
FT                   EIGPENILSRLISEVSNSLRNSSNNPTSFDPLLPNYNTRIHQEQHNSHHAHAVSFSSEL
FT                   PTGNPGATTFMVGLSGEFREFPLGDVLTGSTLSNLVESMENALAVALSTEDPNNRFGSP
FT                   PASTQVVEQLPRETVTEDNIVRIKMCGPCVVCQDEYSIGDEVMGLSRDEEVCHHIFHAN
FT                   CLLPWLNQHNSCPVCRFELPTDDEFYESRRRSSAQNISSTLESTNQAGTQVEARNGIQD
FT                   HLDSATVSNNNIQSTNSESQEPLIEAELGSSQINSQERDQDHARNEGNSNNAASSNFRT
FT                   INFSNPIGEVTTLTSQLPVITSTISTTETFHTTSNQDPISTDDIINDFHNSTHRRIHQL
FT                   HHSGIDLTSRDLDPDSISDFTPIDTIRHSNSCRMI"
FT                   /protein_id="XP_626775.1"
FT   gene            complement(<543151..>543630)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2070"
FT                   /db_xref="GeneID:3374044"
FT                   /locus_tag="cgd3_2070"
FT   mRNA            complement(<543151..>543630)
FT                   /db_xref="GI:66359195"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2070"
FT                   /db_xref="GeneID:3374044"
FT                   /locus_tag="cgd3_2070"
FT                   /transcript_id="XM_626776.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(543151..543630)
FT                   /locus_tag="cgd3_2070"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359196"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2070"
FT                   /db_xref="GeneID:3374044"
FT                   /translation="MNFEDKVDAKKVEHIKVLPEGESQNSVQSSNGFENVDPKSEPLSE
FT                   IEAKNEEGGIKRRFQPNKFLKFSNLVLVPGKPRKWKRVQRRFGRSEGAWLYRWEYIPES
FT                   IDNLFMENLELMARGVVGPRRTGRTTRAVSFHMRENPVGPNHPNLYELEGNYEQS"
FT                   /protein_id="XP_626776.1"
FT   gene            complement(<545515..>550854)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2080"
FT                   /db_xref="GeneID:3374045"
FT                   /locus_tag="cgd3_2080"
FT   mRNA            complement(<545515..>550854)
FT                   /db_xref="GI:66359197"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2080"
FT                   /db_xref="GeneID:3374045"
FT                   /locus_tag="cgd3_2080"
FT                   /transcript_id="XM_626777.1"
FT                   /product="large protein with 8 or more transmembrane
FT                   domains within NH2 region"
FT   CDS_pept        complement(545515..550854)
FT                   /locus_tag="cgd3_2080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large protein with 8 or more transmembrane
FT                   domains within NH2 region"
FT                   /db_xref="GI:66359198"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2080"
FT                   /db_xref="GeneID:3374045"
FT                   /translation="MISPLSWILTLLLVSYGFMLMVCHWLLFDSIQCIITLLIGVGIFI
FT                   STVVFVIICRFLFFPVSTLRRIKMQINVFRRRLARKKAFKERNIQEFEMQRIIIDERED
FT                   KQELSERKEIPWKSESKILIPGNNTFLNTEDVLGVNEMRTSKETLGSKSSCSEYTRKHK
FT                   ANGELIYADPSISILADATSLVSSGINQHEETTEDDTNAGGFTSKPKKNKKIKSSEISG
FT                   HGSRFFSFIGDYSSFGENRLNFDEEGTIFSKKLNTIRSRVILMYDKYFLRGLTAFFSKD
FT                   FVQISLFLINIIWAFLWALDSNYLTRESINDPWKVKKGAETLLLFEEAFLWIADISFLY
FT                   KILGEISLLSRGINGIITLKYLITSATFIPLLEMLTTSPILLVMKYSIGSGSVTTLFML
FT                   GFLRYFRVLNPVPILTIILSWSSEVMRICIVIIWTIACVVLGFSGAMMIIESPKPNFTT
FT                   LFDYFYFTIITISTVGYGDYTPSNFVSRLICIILIIFTIIYVPNQISKLVQLAQTPPET
FT                   MGVCNIGVYDESIFERDHIHTTLVLVIGSPSVKHLSYLLMELNQLNANIDYIKQFNGKS
FT                   GKIIRYQPIVMLLTNSDPRDYSTLVKNSQQALHTQLFVKKIKNIESLKVDIESIKGFIY
FT                   AIYFWSDAINAKVYSPINAFHEDGVNFQENNLTEFLNCNSEQYGSTKLFAADRVLDLER
FT                   NTMMIWYAVRKFLDLKEYEFLYRSKETGILYNSSSSILGKKNRKNSDSKTDNYPDPLRI
FT                   NSVIVFNGENADFKLDNALRDDHFYDLHGIQDINTARRNVITNNPNLQAPKTPEEISSY
FT                   LFYLSKVSGSDHQINMNRIANIVRDQLSSDLNEKYNSTIKNSKYTIHEQKSSYTPVYIA
FT                   EIRSRLLAKTALCPGFSTLLTNLFNTIKIEDLELGESLHNSINGIINECGGNKFNQEYE
FT                   SLVSENIRRRSRALSEDTDQLEFDRTNIFDADFSELEKGTLNRMATIDETLLYSSLDTA
FT                   SQSGILTRDYIRGTHCELMEIPLPNYLIGMQFLQIVSYIFENHSMICIGIAVDVCEETG
FT                   INKGNTNQFEDYNANMELNIELDESVNENCCEDDEHYNFIITSEDEDDQNSNNRNSEKN
FT                   ELDSPSKSFVINEKDSEKSNYKKLKLFPNKLKLAKIDENVSNKFKFKNSVRSNSEKKEP
FT                   SKVFGICKKKRILNPSDFIAGKRWRYGDMVIEENTEIDLLIISNSRRKAFSLIHEKENL
FT                   DIKTEKYKEPIVPRAKQTLNYIRLCLQGKTKLINNKLIIPSWRVETPVTPRIRKMDTSS
FT                   GKSDQLRGQPPSPIHRELKYSKVSKIEKIDILCPSKIQGYIHGTTFILLVCEWPECLEE
FT                   FLNGIVLNRSIPVGWDSFRHINKNFKTSVPTSTQSLILSTIIVFLSNDHNEKYLQRSIV
FT                   PPSCVGVYIKGNSSNDEDLIRSGLFYAHSIVVCSSNSINSDSKVITTCWRIHSLINMKI
FT                   QAEIVLLKSKSSKFSKNICPLYKSHKKELESTERNGFGSKVKDLRSFDAKWNMWQWKVT
FT                   ANLAQITKKWLFEGGHLPPCFFPAIIADIRFEESLPLLDSTSWISLNEWDFSTCPTVIS
FT                   GRVLTTDMIIPIIYRNVKINPLLATSDSMKPLLGYNEKYNFFNSPLTYDNQIINLDCPS
FT                   SGIKRFYTAVSKIMPETEYFPDYTEWGSLELISIPEQFHGSCFSTVFKEMLRISGIITV
FT                   GVVRTIGNNVDAPEVVIKQITADENNTQENYSTSKKSYNNYLNRVAPKFSINNRVLLLS
FT                   PHPKHIISKNDLIYVVTPISKIF"
FT                   /protein_id="XP_626777.1"
FT   gene            complement(<551358..>552140)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2090"
FT                   /db_xref="GeneID:3373786"
FT                   /locus_tag="cgd3_2090"
FT   mRNA            complement(<551358..>552140)
FT                   /db_xref="GI:66359199"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2090"
FT                   /db_xref="GeneID:3373786"
FT                   /locus_tag="cgd3_2090"
FT                   /transcript_id="XM_626778.1"
FT                   /product="40S ribosomal protein SAe"
FT   CDS_pept        complement(551358..>552140)
FT                   /locus_tag="cgd3_2090"
FT                   /gene_family="HOG000232073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein SAe"
FT                   /db_xref="GI:66359200"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2090"
FT                   /db_xref="GeneID:3373786"
FT                   /translation="LYSNMPPAETRKLDDIAKMIVCKTHIGTKNVEDKMLSYVYKRTHE
FT                   GIFLINLAKTWEKIQIAARIIATIDNLADVVVVSQRPYGSRPALKFAQHTGAHAMVGRF
FT                   TPGTLTNQITQKFMEPRLLIVTDPRVDSQAVIESSYANIPVIALCDTDSPLQYVDVAIP
FT                   CNNKGKESIALMYYLLAREVNFLRGKTDKWDVMVDVFFWRDPEEYENSAIGADMELNDG
FT                   MGVDIEGAAVDSAAAANEWGGVSGNWGGSAADEWRNAP"
FT                   /protein_id="XP_626778.1"
FT   gene            <553404..>554348
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2100"
FT                   /db_xref="GeneID:3374081"
FT                   /locus_tag="cgd3_2100"
FT   mRNA            <553404..>554348
FT                   /db_xref="GI:126644768"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2100"
FT                   /db_xref="GeneID:3374081"
FT                   /locus_tag="cgd3_2100"
FT                   /transcript_id="XM_001388069.1"
FT                   /product="phosphatidylserine decarboxylase, putative"
FT   CDS_pept        <553404..554348
FT                   /locus_tag="cgd3_2100"
FT                   /gene_family="HOG000282997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylserine decarboxylase, putative"
FT                   /db_xref="GI:126644769"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2100"
FT                   /db_xref="GeneID:3374081"
FT                   /translation="IFFYRSLFGRTRSRFLGKLLNINLPVSIRRRIYGFLINNYLYKDS
FT                   SFSAYSKDEKIKKFEEKHANSLDSYRSIGELFTRSIRPSEIVFQCLEDPNSISSPCEGR
FT                   TIEFGEINSDKCIQVKSSTFKVSELLQENFASLTNSSNLYYMIIYLSPKDYHRFHSPTN
FT                   IEIKSVRHISGECFPVFKGIASKLNNLFSINERVVIKSEWEHGKMYIVAVAAHGVSDIK
FT                   LFCVPNLKTNQRGSNLNYLRKGKTGQFIEYSDFKNCKNQGKYLKGDELGLFNLGSTIVL
FT                   IFQAPENFKFDVDRGIKLKLGQIIGKVLDSQSS"
FT                   /protein_id="XP_001388106.1"
FT   gene            complement(<554464..>555867)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2110"
FT                   /db_xref="GeneID:3373785"
FT                   /locus_tag="cgd3_2110"
FT   mRNA            complement(<554464..>555867)
FT                   /db_xref="GI:66359201"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2110"
FT                   /db_xref="GeneID:3373785"
FT                   /locus_tag="cgd3_2110"
FT                   /transcript_id="XM_626779.1"
FT                   /product="nucleolar protein NOP5/NOP58-like pre-mRNA
FT                   splicinig factor prp31"
FT   CDS_pept        complement(554464..>555867)
FT                   /locus_tag="cgd3_2110"
FT                   /gene_family="HOG000196310" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar protein NOP5/NOP58-like pre-mRNA
FT                   splicinig factor prp31"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359202"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2110"
FT                   /db_xref="GeneID:3373785"
FT                   /translation="KMLVLLETPAGYGLFRVTNSKLLSMDTDEIAEYFQNPDKVQKSVS
FT                   LEAFLRFKDTKSALVEATALVESKLSKGLSKFIKKNIPNPASESLAVADKVLGGLIKQK
FT                   YEIDVVYNPKMQEVMRGIRNQLTDLLTGLTEKDMKTMALSLSHSLGRFKLKFSPEKIDT
FT                   MIIQAVALLDDLDRELNNYAMRLKEWYGWHFPELGKIISDRDVYANCIKVIGFRHCTRD
FT                   ANLQSPPCNIPSEMEAEIKQAAEISMGTEITEEDLKNIIELCDRVLELSEYRESLSTYL
FT                   KTRMSTIAPNLTYMVGELIGARLISHAGSLMNLAKHPSSTVQILGAEKALFRALKTKKS
FT                   TPKYGLIYHAAVVGQSAPKLKGKISRILAAKLSLCIRVDALNDQNEPTVAIENKQYVER
FT                   RLEELSNQLTSGRLSSTGGNKKPSTPSYSPVKSKALGSYDSSMDIVGSKRKPSGDSREE
FT                   GSPDKRSKH"
FT                   /protein_id="XP_626779.1"
FT   gene            complement(<556690..>562941)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2120"
FT                   /db_xref="GeneID:3374043"
FT                   /locus_tag="cgd3_2120"
FT   mRNA            complement(<556690..>562941)
FT                   /db_xref="GI:66359203"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2120"
FT                   /db_xref="GeneID:3374043"
FT                   /locus_tag="cgd3_2120"
FT                   /transcript_id="XM_626780.1"
FT                   /product="myosin fused to 3 IQ motifs (that interact with
FT                   calmodulin) and Rcc1 domain"
FT   CDS_pept        complement(556690..562941)
FT                   /locus_tag="cgd3_2120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="myosin fused to 3 IQ motifs (that interact with
FT                   calmodulin) and Rcc1 domain"
FT                   /db_xref="GI:66359204"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2120"
FT                   /db_xref="GeneID:3374043"
FT                   /translation="MYSQKGDEFEVEKNKLINIQIKKKLGERNDSNDQKESIIPFGIPV
FT                   WVKNRDDDIEVVKRGFLRDANLGENAMVEFSSINSKSIFAIKSYPKHKIGLIIDNPIKS
FT                   PDLSLLDVCTPHGISHMLGERCAAGFCYTFSGNLLIFILPRVEKIPRLMEAYSSLEIQR
FT                   FWTEMKTKFEPHIFSLARRALVSWAENHQDQTIIIMGAQNTGKCFNMHMLIRFLAKNLS
FT                   LYKYIKSSYAISEKIASIVHIARSFIQTPGEGNNGDNKFYHYGQSYCGQVWRIFVASDG
FT                   CLMGSHLHLWSFNTSPVSYWSRTGPFFSIFYQLAHGLILDSNNPLIKSLKLSNDETMLY
FT                   LTQVSPDMNTNYIDQLRGFKMTVGSLNSLGLNDTQKIDFFKVVFAIVVIDSYVSILCNS
FT                   TINEINDSKIVFFPLLARLLGIEIEDLRTNIVTCYEFVQLQVTLYCRLLDWVVFICNEN
FT                   LRPAVTNLLGLESFTIIHGPGFIKEGFSFSNAMQNYCEEKLKKNYIHEIFDSEKKILES
FT                   EGLNMIKLNYSDIDSITDLFEDPEKGFMNLLKITSKRQRRVEEFISEIQKDPTESSLLH
FT                   KPTPCDEFGRIDLDPSKSIYSKFVRSFTGNELLKANDEFITKGESKFQEEPYNELLKRK
FT                   KQICKDYHDSNSEKIRKYRKIRTKRGNRADSMGNDLFSGVVNDFEVDYAANSLHSSVLV
FT                   EDEQAGELPDYLPPEVTINHSFGNCNYSMIAMAEEDNLNQVPEKVDELFRKSNNKIIRA
FT                   CWTTILETDEKYMQEKNIYKGTAQKKKARLSIDEDPEIIKFENFWKKTEDFMDLTWIRL
FT                   SAIPGSPSMSQIALKATKMVDSMLRRGKLFFSVCASSYQLGKKTEEEISETKITNDLEM
FT                   YDISSQVLFQQYGFTVKIPLRVFLLKFSEIYIPRIHKKGILERLKSQQNLRDSIRTLLH
FT                   GLEVPEVEYLIGTQNLFLRNKMVLVLERRREEYLKKALPASIILQNAWRTLKPRLFISK
FT                   LRLMSVRIQSLIRMRFVCILWRKILPYRQFICGLALLIHLAIPWVKTSTIFDKLEELAQ
FT                   QREDERKFFRNSAATSIQAWWRGEMVRRRLTLYRYNEFREFSIQVIQSAWRTLKAQALL
FT                   VEKLAFTKTPNFKAVKIQAVFRGWLVRKKFCKLFMLKRCILALKRKSLIRLGIAKHIEY
FT                   RGTLRRSHVFREQIRAHREVVNKAIIIQRVFRMALCRRQYVKLRFSAQVVQCRAYTCLE
FT                   VYRYFKAIKSITLLQQWWRVTFTLRKHIDSGNSLIKTLSKFKIQKKIPKDPVKKSVEMN
FT                   NLISRELKQFNMMRYPLLSMQGLFQPLAKIVESNTVFLNPVELSIVKDVGDYYPSTWGR
FT                   GFVTLCRRLCGAIFETAPTKQFPPLKILQFSVGQRHTLVLIAERILAGQGDDNIEIDSF
FT                   DNEDLSNHKFSKSGNSGALLGQTSGKLLNFEYRNHVYSWGVNDQGQLGVPVMDLVSSNI
FT                   REPVRFIDSEYRYTKNEKTGKTVRYLIRQIDYTRRIRWVGCGSDHSMAITADGKLFTWG
FT                   ENIFGQCGHGHNYSYIPSPKMIEPLKEEQVYMASAGARHCGVVTQNGAVFMWGAGTHVC
FT                   LEDYRFKTLYGHLAEYDTVSSNANFYEPFRVELPNFDNSSSTNKNYDKKNGKIGKDEYN
FT                   NKNEGNKNGGVRQILCGNGFNIICTQNLFIWGRNDKGQLGMSKKGHLLVPTLLPLPTTD
FT                   LLKLEYSEELKKEVRRRSLLTLISGNKITISSISAGPDFVCATVEDGFNIMYLWGNFTV
FT                   HEQTGGSNSSHSAMKNFGISKINLKSQNSSTISNKAIQCPTIVRHSIWEKKILTQVACT
FT                   VNSIAVITDDSELYGFELVSLKKTEAGKSEKISLSTDELDTGHKLDNWGGIISAKKKQK
FT                   NVMDKKKTLLPEFCKDLDILRIPEKYKGNLNDLFYFEPSLYQYRCVPNTKKAGLLTEEV
FT                   ISSISSTMSILWVKHRRKTYISQIKGKSDTNNSKIDTDNMDENEKLVEIDRENVSTDSQ
FT                   MKMDEGNILQKVKERRNIVMNRNMILHRIQPKSYIPSYLFHDPQRVLGNGCNDSVFVEL
FT                   LRRIKNKNKKSIAESDEHILDLNEAENPKLSG"
FT                   /protein_id="XP_626780.1"
FT   gene            <563197..>564171
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2130"
FT                   /db_xref="GeneID:3374042"
FT                   /locus_tag="cgd3_2130"
FT   mRNA            <563197..>564171
FT                   /db_xref="GI:66359205"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2130"
FT                   /db_xref="GeneID:3374042"
FT                   /locus_tag="cgd3_2130"
FT                   /transcript_id="XM_626781.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        563197..564171
FT                   /locus_tag="cgd3_2130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66359206"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2130"
FT                   /db_xref="GeneID:3374042"
FT                   /translation="MNVRLNFLLYTAVLVFICLTSSCQSYESFDPRSPNGGVTLNGYIQ
FT                   KPGIFYFLNEELRWRDRDFPFYNMLMSTVATTFINLINQIEKNEEGLMLYYSREVARLA
FT                   KKGEVINSIYKSFLTVKGSKHELKIYEEQFKPLCKSYRIEIAKSPIISIVSHSTSRLNA
FT                   YDYLIPFIPSEVLDPVMKKFSIEVTKFLWPQSFAEMSNVFITMIEKLEKLCKKINFNLL
FT                   ESCNEYMQQSRSYLIDLIKNHEKFLKYSKTKNANYLEFSNILRKLRGEILSFKPYQIVL
FT                   RKLDPVKADALGVPMFSGFNHSILDETMKEYYEILRDRRLKNK"
FT                   /protein_id="XP_626781.1"
FT   gene            complement(<564188..>565519)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2140"
FT                   /db_xref="GeneID:3374040"
FT                   /locus_tag="cgd3_2140"
FT   mRNA            complement(<564188..>565519)
FT                   /db_xref="GI:66359207"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2140"
FT                   /db_xref="GeneID:3374040"
FT                   /locus_tag="cgd3_2140"
FT                   /transcript_id="XM_626782.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(564188..565519)
FT                   /locus_tag="cgd3_2140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359208"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2140"
FT                   /db_xref="GeneID:3374040"
FT                   /translation="MHERTDLFFPVSTNVDLTISRCKKKLASLRRYIKSVSYLKSQTDT
FT                   GHSRDKYDFNIRNNMRQLELNKNEKCMDLRRNDEKKWNYKYYGQNEKKYNAEMNTCSGI
FT                   DSESSISYNSSFVNKLIERYYSTSKSKLPDLNNVEKIISFQTTSNLSTPQLRRNNERKD
FT                   ESQINQNIPKNNIELNNFESNYGSNCNPKLDSDYKNNNRKENFEKQESPHATLLKQYDL
FT                   ETREIVDNLDKKIRNLERRLKKDKRKIKLHNKNEFQEPIYERLERSNSMESKLLSISVM
FT                   PPNGISCFESSFLPYYCTQQEIKIVEDLISIKGEIYGSSQTSIKVVGIGKIFCCHARTR
FT                   FIDSIKRLYQGSINFIKLKLLIYIEEPEILLANTCGPQTFENKYDMNFYEFEELYETKK
FT                   ISRFLICLVITDRPMECFKKRCYTISNAKQVLPIYIININSISS"
FT                   /protein_id="XP_626782.1"
FT   gene            complement(<565930..>566673)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2150"
FT                   /db_xref="GeneID:3374037"
FT                   /locus_tag="cgd3_2150"
FT   mRNA            complement(<565930..>566673)
FT                   /db_xref="GI:66359209"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2150"
FT                   /db_xref="GeneID:3374037"
FT                   /locus_tag="cgd3_2150"
FT                   /transcript_id="XM_626783.1"
FT                   /product="protein phosphatase, signal peptide, 2-6
FT                   transmembrane domain protein"
FT   CDS_pept        complement(565930..566673)
FT                   /locus_tag="cgd3_2150"
FT                   /gene_family="HOG000190538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein phosphatase, signal peptide, 2-6
FT                   transmembrane domain protein"
FT                   /db_xref="GI:66359210"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2150"
FT                   /db_xref="GeneID:3374037"
FT                   /translation="MHSSKLKSIYLIIYGIVSTLFWATTLYFTINEIIGIKSTYEQLGK
FT                   HMIALRISQSLAVLDIMNSSLGIVKSQFLPTIIQVSSRLHIVWIVFYLSPENSRQISTV
FT                   FSNIMIITWSLSELIRYPYYVILQCSFNFPSIRMPLFLKWLRYSAFAVLYPIGIFSEVI
FT                   ICSNFISDIYNNSSSSDPVYQRLLHFPTKMPNALNFEVNLACLYIVILCIYIPGSIFMY
FT                   SYMIRQRKKSLINLWKSEGDNTKVE"
FT                   /protein_id="XP_626783.1"
FT   gene            <566812..>567513
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2160"
FT                   /db_xref="GeneID:3373784"
FT                   /locus_tag="cgd3_2160"
FT   mRNA            <566812..>567513
FT                   /db_xref="GI:66359211"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2160"
FT                   /db_xref="GeneID:3373784"
FT                   /locus_tag="cgd3_2160"
FT                   /transcript_id="XM_626784.1"
FT                   /product="SprT like metalloprotease"
FT   CDS_pept        <566812..567513
FT                   /locus_tag="cgd3_2160"
FT                   /gene_family="HOG000031496" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SprT like metalloprotease"
FT                   /db_xref="GI:66359212"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2160"
FT                   /db_xref="GeneID:3373784"
FT                   /translation="LLNKVLQKKIINQFNSRDEDLASGFPDIHELLLEYNDLYFFGSLG
FT                   SVIIRWSNRMTLCAGKCTYETGGRCIVSLSEPLLKYRSVKELRETILHELIHAYLFVTS
FT                   NDRDRNFHGKEFCFHMNRINKMSGLNITIYHNFHDELNYYRRYIWRCDGVCRNHPPYYG
FT                   YVRRSINRKPGPADSWWNFHRKTCGGCFVKEAKTLPQINNLESLGTRPNGQTSSPNMHQ
FT                   DDILEIIEISD"
FT                   /protein_id="XP_626784.1"
FT   gene            <567762..>568581
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2170"
FT                   /db_xref="GeneID:3374064"
FT                   /locus_tag="cgd3_2170"
FT   mRNA            join(<567762..568057,568119..>568581)
FT                   /db_xref="GI:66359213"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2170"
FT                   /db_xref="GeneID:3374064"
FT                   /locus_tag="cgd3_2170"
FT                   /transcript_id="XM_626785.1"
FT                   /product="proteasome subunit alpha1"
FT   CDS_pept        join(567762..568057,568119..568581)
FT                   /locus_tag="cgd3_2170"
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome subunit alpha1"
FT                   /db_xref="GI:66359214"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2170"
FT                   /db_xref="GeneID:3374064"
FT                   /translation="MSRLSQSLHDRHITIFSPEGKLYQIEYTFRAVKNSNITAIAIKGK
FT                   DTVCIVCEKKVPNQQGQQDKLLDPAYVTSLYKVRKHIGAVMLGLAPDCRSIISKCREIA
FT                   GKFAFEKGVEIPVSYLSHKIADVNQLYTQHASMRLLGASGMFISIDDEDGPSLYKIDPA
FT                   GYFASYRACAVGTKEREGNNALEKIIKNEPLNSCEEVISASIDCLKTLLGVDFKAEDIE
FT                   VGVVTKDMPEFRLLSVEEIDNYLTNIAERD"
FT                   /protein_id="XP_626785.1"
FT   gene            <569407..>594138
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2180"
FT                   /db_xref="GeneID:3374038"
FT                   /locus_tag="cgd3_2180"
FT   mRNA            <569407..>594138
FT                   /db_xref="GI:66359215"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2180"
FT                   /db_xref="GeneID:3374038"
FT                   /locus_tag="cgd3_2180"
FT                   /transcript_id="XM_626786.1"
FT                   /product="type I fatty acid synthase"
FT   CDS_pept        569407..594138
FT                   /locus_tag="cgd3_2180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type I fatty acid synthase"
FT                   /db_xref="GI:66359216"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2180"
FT                   /db_xref="GeneID:3374038"
FT                   /translation="MLNKEEYGPCINSTFSESNSKMNPKNNESNFQDQVSLKDLFSLYG
FT                   KNPFFYTLKENARINGFRECYSWIGSNGDIKKKFTYREFFEKVVELSWYLSKKLGIKAG
FT                   DKVILCYTPGYDFVIAFTTCLVSGIVAVPVYPPDPMRGQSEIQRFCDIKQASETNISLT
FT                   CTSYMRSIEIAKTMSTDKRFKSIRFEATDNLKIRKEEYINEVQKAINDIILNDSNHFDF
FT                   LGFDFNINTVAFLQFTSGSTSQPKGVMVTHGNLLYNIHICISSYSFPSVLEEHYKNELD
FT                   SIPAGITVLKKNELTEDELSFIHNEFGEEKNIMSLNDIKYDKLYLYMSIINKVLYKNTM
FT                   SSASVFSWLPVYHDMGLIGFFCTPLFFGCNIFQMSPIDFIKKPYLWMQCMDKYNCSVSG
FT                   APNFAFEVVVRKTPKEILNQLNLKHVFAILSGAEPIRKTTIDRFTEAFKSVGIKHNVIK
FT                   PAYGLAEHTLIVAGSNSFQQEVNHITVNTKKLREKNIVEIKEAKEKSSTETTSFVSSGI
FT                   VYKGIDLRIVNPESLKEVTPGNVGEIWISSESVTLGYYNNKEETEKTFNANFTMLDGKT
FT                   SKSTYMRTGDSGFIINDMLYISGRIKDMIIIRGRNFYPQDIEEVIDGVSGVRQGSVAVF
FT                   SVTQADGEEAIGVAVEIRMETSILGRVRRFFEKPAYDNIVRAISKAVFIGHGLPVHYIW
FT                   LLSPRTILKTSSGKIRRSQTRDAIFSKKLVPLFEWVCEQSPMSDILVERSSQFISPTSM
FT                   IISKSGVQNKSKFYEKTHSGQQKISEQANDEKNEFDIDQVKIKIIEFAAQVLGITQKDL
FT                   DLNAPLHEYGIDSLGSIRLSEMMNEEFGVELDSTLLFNYPTVIEIVDFVAAQISGKELH
FT                   RKNLLNRSGIDSYSDIVVVGMSCSFPGGSSTPGEFWSLLQSGVDAIGEIPKSRWNIDEY
FT                   YSTDLDLENKMYTKEGGFIENIDQFGASFFKISHAEARSMDPQQRIFLEKSFEALKDVG
FT                   YTIDTLKKRNISVFAGCCSNDWTHVCKSEANSNIGTYAATSHAASIIANRVSYTLGLTG
FT                   SSVTVDSACSASIVALHVSLQEISTGQCEAAVVGGINLMLSPQITVALCKARMLSMDCR
FT                   CKSFDAAANGYVRGEGVGVLVLKTMENANNGEKIYSVIKGSSVNHNGRSASLTAPNGIS
FT                   QQNVINSALEYAGIRPNDIGYIEAHGTGTSLGDPIEVSALKSIFSRTRDSGKPLIIGAV
FT                   KTNIGHLEGAAGMAGIFKVILSLINDTVPPNLHFKNINPHINLKGFPVIIPTSNIALQT
FT                   YDGSKTCAGVSAFGFGGTNAHAIFEKPNLSIDLPIKTVKIETNKARNNPVLFVFGFQGF
FT                   QHVNMGKYYFEREIVYREWFLKCCKIIDPFLKISLKSLVYPETKNMEKLRELNKILEQE
FT                   EYAQCALFAVQYSLAKLLESKGIYPGAVIGLSDGELVASVYCGSINLEDGLKLCMLRAS
FT                   LLSEFSAGEGKMALFNVSKEDAEMALADVGPQHNNRVSIFASISSNQVLLSGDEEKLET
FT                   VVFILKEYYPRANAHSIDAKFLRTKYSFGTNGMNGLIEPISNLMENIALETPMIPMISG
FT                   TSGYFVYEELTSPKYWGWQLNNKLSISKALNTAILNGASTILDLMPISRSEFEISEIFN
FT                   FENIDKDTIYYSLFEDTNLESYEPNKFNKMIKVVSEILLKNPYNVEDACDQIINSNGST
FT                   YSRESFPWNSFKHSILGEQKSIDRSVKIVSTLNNKSIKLFSDHKVYETIVIPGAGLIDL
FT                   AAASIITVSMDDDSILQGSNALFGESIAVKLNNVLFEKPVVVNRTSLFSSECTEVINQL
FT                   KSYNNLANDQKTNLICNIESDGSISIQYCNIDNQEDFDYEADNSMIDCFSCKAKISEGE
FT                   FVLSEDLAQLKNNTNIKEDPKIMYEEYEEIGLKYGKKFRVVKEIYRNETCSIALGKIYL
FT                   PETCKFGTFESGFYFHPAILDGALHVAGSLLKYKDSFKSKQAMVPVSIEEIEIKYVNAN
FT                   QMIWAAAYLSEATQNYSIFDLVLFDSEGSCIGKLEKVSLRQFNSKNISRPTVSHNEILW
FT                   ITEWEKSDVLKFSKNISKESDFDLKIALIHSGICNISEKDDIQLPKANISFVNLDKIKE
FT                   SNIEELERLIDITSLDSLVFLSPVELALSAKIDCEKISIDILEYVMKICKLYLKILKQA
FT                   KPTKQEQKINIPNFWIITTNSQNLINYNINENICIPNNSGLWGLAKSANLEISSLLTNF
FT                   SQPIKSVDLEITDFSDNQYLRKTIGSLVRWIGNFEYSSLKEKENLIFKFEREFSITSKN
FT                   IYVNRINKFHKQIVGPVELFMQNRGSISNLSLIESEPIQLEKLNDYEVVMRVKSIGLNF
FT                   RDVLNVMGLYPGDPGPPGGDCSGTVVAVGEGVKHIKVGDNVFGIAPGCLKTYVTTDSNL
FT                   LCKIPKGFTFEQAAALPVVATTVEYSLKDIANIKKGDIVLVHAVTGGVGLMVVQYCKAI
FT                   GAKVYGTAGSESKVEYALSNGVERVSSSRNADKFKEDMKDLEGKVDIVINSLIEDFIPN
FT                   SLNLLKKGGCFVELGKRGIWTEEEMKEKRPDIKYKCVAVDVMMEEDPSWFGGMLTRIKN
FT                   LAEEGIIESLPLKVFDMRGSDENGIDAFRYMQRAQHIGKVIIKIPYLAGIGDNSIPEEC
FT                   LITGGSGSLGLVLTETLLNEGITNISIISRSGIESQSDSIKAKWEKLFKRILNNKNGNS
FT                   GIRFFNIDIGNKDSVYKLINTEFKNLKHIFHLAGVLSDSNIETQTRESIEEVFKPKAIG
FT                   AWNLHNICEELGLNKELKTFVMYSSIASGLGNFGQTNYSAANSCLDSLSQYRVSKGLSS
FT                   RSIQWGAWDEDGMAMNIRQHLGLVGMSPISKTTGQQVIFDLITTQIYEENRKSATIMCL
FT                   PIKWKTYINTIYSGENIPQFSLVNTNLRTKRQQNTILLKMSKEERETYIEKQIISLSKS
FT                   ILGVEIKSLDQPLQDIGIDSLAALEFRNALSKKFNIKLSATTLFDYPTIRGIKDHISEK
FT                   LSVKESIYETNKTQISNLILSQDNLSDDNVGVIAGLACRFPGGCNTPDTLWKSLIRGYS
FT                   INPLSGKMFNSVGGAFCASREIPIQRWNHNLVYNADPDKTGKCYSYKACFIDSIDMFDN
FT                   SKFGITNIEAKHMDPQQRIVLETCYEALVAAKIKEETLIGFQMGVFIGCCSNDWSFLQS
FT                   RKGMAPFTGTGAANTTISNRVSYVFGMRGPSMTVDTACASSLTAACIAMDSFRNKECNG
FT                   AIVGGVNALLSPNLFIAFCKARMLSVDGKCKTFDASADGYVRGEGCGAIVILKQSEQKK
FT                   QNTPILGRIKGWGCNHVGRSASLTAPNGPAQTCVIKMALNQSKLNSSDIDYIETHGTGT
FT                   ALGDPIELGALKSVFGRNADYKRSTPLVLGALKSNIGHLEGAAGIAGLIKLVLVLKHET
FT                   AIRIAHLTKINPHLDLEDFNVIIPQKTVSLKCNKNKLIGGVSGFGFGGCNTHVIVESTE
FT                   KNKSEDIEAADFSKNHILFVFTGQGSQYINMCKGIYETEPIFRENMNLCNEIVSKILNI
FT                   SLLDIIYPIDGNKDAEFKAMNMLNDTRYAQPAIFAVEYSLAQLWISKGIKPDSVLGHSL
FT                   GEFIAATISQVMTIEDALTLVTHRASIMASTPALDGIMVACRLTESQVVDTIKRFGLEE
FT                   SASLAAVNGQKSVTISGKKESVYKILEYNNVGSRFRRLDVSHAFHSPLVSEASDKFSKL
FT                   LENIELKKPTVEFISTVTGKKEIESISTAKYWSKHILNTVRLSDAVYHAIESVNSRMTF
FT                   IEITSKPILSQLLKALIPVNSSHISVKCTCKLVNSEIDFIQPLEEMQEFGSENSSFTNH
FT                   ANNLDDDSWRFKLLKRRQISWSDISHPIIAPLHDFNDIEWVKENISISKSNARELVEKL
FT                   EFTCMISPELLDLFDNHKVLGQSILPGAAFVDFMATVALNYTKSQFTLGVIGAMPDWIQ
FT                   LKGIFFRNPFIMSSAKQYKYLNTQFDSQDYSDEDNSSRSSDFNIIMSKGNNCQISIESS
FT                   LKMDEETVVYATCDEVEYVSSIEAQTKSLCIISEWPSSELISNSKKVSQEDIYEKMSIA
FT                   GLQYGSRFKTLKEMWKVTSNSAVGIIQSELFTKNCAESPDNLAVYESIMNERGFTIHPT
FT                   LLDGVLHMCASILGDQSDKETFNELHKRATMVPISINKCLITSKIDTSKYIKGEKYWAF
FT                   VQLKSSDKDSAIVNVALKSMSGVPIAVLLGVSLRSVKNGVISTHTIKHVIPNELLWRID
FT                   WDEVIESITNSEIVSLPTKVNCDNTENESYQGINANLVEKRKVLLLTNSCNISKKELYS
FT                   EYFTADIVCEASKLSLAEIEATIYGRDDQELPPSPSNEAKYDLICLHIPNSDKNKAIVS
FT                   LLPVLYLCKILRSMFENKERLIPRVRIITENIFNVDGMNLEFRTNSGVAPFIKSARQEL
FT                   ELFSDQSVSLGLIDIETAEDLNKAIILSFVKDILCFKKREDITSNGTLTESQRLFLNTE
FT                   YEPELVLKKKIKGKEDNCEAHYRIITPKLVSLRGEAAIIGSCKLNLSSRGAINNLELLP
FT                   LSNEERKCPSANTVEIRVRSIGLNFRDVLNVMGLYPGDPGPPGGDCSGTVVAVGEGVKH
FT                   IKVGDNVFGIAPGCLKTYVTTDSNLLCKIPKGFTFEQAAALPVVATTVEYSLKDIANIK
FT                   KGDIVLVHAVTGGVGLMVVQYCKAIGAKVYGTAGSESKVEYALSNGVERVSSSRNADKF
FT                   KEDMKDLEGKVDIVINSLIEDFIPNSLNLLKKGGCFVELGKRGIWTEEEMKEKRPDIKY
FT                   KCVAVDVMMEEDPSWFGGMLTRIKNLVEEGIIESLPLKVFDMRGSDENGIDAFRYMQRA
FT                   QHIGKVIIKIPTPFKYLELDTENHKLNNVGSEKEDRHNNEYGIHVITGGLGGIGRIIIK
FT                   WMLEEGVRKIAILSRSANNDSLRDIPEIKDYLNTDIIQIECIKCDVSILSQVESAFREI
FT                   LVKFGETNQIHGIFHAAGILMDGAIASQTMEMMESVYAPKVYGAWNLHECCEKFDLNKN
FT                   LKHFVMFSSVASLLGNFGQTNYSAANSCLDSLVEYRRNKGMCGTSIQWGPWIEQGMAMN
FT                   IKQHLEKVGMHGISNEMGIRVINDVILYQNTDLDKNSLGKYPVITCQSFNWNVYMRQLY
FT                   YNSKYPSFFKDVVASMSTGEVKNIGMDFRGMSKEEVYSYVKDSVHNIVEQIIGIQSSTL
FT                   DLDTPFSELGMDSLSAIELRNALISRFGIKISSTALFDYPTLRSIIQHLTDSLYVSETR
FT                   DAFSDLGMSISEREYSVAIIGVSCRLPGRVKSFNDLYEIVLLKSKDCITEIPLDRWPFD
FT                   LYYDPDPDNRSKSYVNQGAFITDIDLFDNTFFGLSSTEATNVDPQQKYMLEVAYEAMYN
FT                   SGITKRSLTSIKKTAKTGDDPVLMGVFIGCCNTDWHFLQAKFGFENFTSYTGSGGASSL
FT                   VSNRVSYSFGFRGPSQTIDTACSSSLVAMDAALKSLKEGSCHTALVGGVNLMLSPHLFV
FT                   AFCRARMLSPDCRCKTFDASANGYVRGEGCGAILLTKRSEIGGKKIRPIAYVLGSATNH
FT                   NGRSASLTAPNGPSQTEVIQNALRNARLTPNDIDYLESHGTGTPLGDPIEFGALKTVFG
FT                   NKKDIKRSQPLILGALKTNIGHLEGAAGVSGLLKLILVLKNRIAPKILHFQKLNPHIDT
FT                   ENFDVEFPTELKPIISNKSKLVGGVSSFGFGGCNSHVILESASANELNTESSQNKNYPY
FT                   LIFAYTGQGCQYINMCKQLYDTEEVFRNEMDKCNELLYPILGRSLISTIYCEKTMESEK
FT                   LINHTSISQPAIFSIEYSLTKLWESKGIVPSAVMGHSLGEFAAAVTSGILCLKDAITLV
FT                   ARRAEIMASLPQNDGIMVACRVSEDQVLDSINKLNLKDSAAVAAINGPKSVTISGSRSS
FT                   VMQVLNNLGMEDRYKQLDVSHAFHSPLVSSAEEKFEKVIENIQFFEPKLTFFSSVTGNI
FT                   ESKLLIENKYWAQHIIHSVRYYDALETAISTDEENIAIIEIGPKSVLTSMGKQAVGGIQ
FT                   LVQSSNENISNNELTWIPTIDNSKSNTIDFNDALKAAREYIKYISESVCVHKWNHSRFH
FT                   WADLTSVHPLLGKFYSSISDENYLAYSTDMLKSKVFKNIVEDHVIFDTNIIPAAALIEA
FT                   SACAAFKLQRSEKFPSKYVEMDSMDIEKPLVSNQDETTSEMEVFVAKSGAIQIRKKCIS
FT                   EAFEYEEEFSGPQIIANDTVFSNSRIYHHASISNSRILSKDEVDKQCFPNLVDYLEKYS
FT                   SKDTMEVPIDNIYKMMNEIGLQYQKNYQCLKTVKVKIDNSNDEKKIKSSGSNQINEVFC
FT                   YVKRPISDFDLTELRIHPGMLDSVFQASSVLFASDELLEGKDTTKNKRGHVAMAPIGFT
FT                   KCFYGRIQHNSDVWGLVKLNRFEKKGNIAFIDVTLWDSKTNILAAHFQDLILKGFSNAA
FT                   SLLSQEVRIPNQFLWRTYNKKIVDRTNYIENSSTFEQENKEDQDKEFNSEDSDHDNQIQ
FT                   KILIFGIPTVIKELICSKMDNKYKKISTTFICLEEDLTIDLIDQKIQEENWSAMFYLGG
FT                   LMDNLSSKQVMGDILKISQVISTISVSITTAPFVCLTSFNDCKEDGNIPRHSGIKGFVK
FT                   TARVELENVIGKSINISHIECNSSLVNDPETLMRTISYIASIYEGKIEEEITLERDLTI
FT                   SESGIYAPRLESINFPVFGAIKLTMSSRGAIGNLKFKPQPQSERVNPPANTVEIRVRSI
FT                   GLNFRDVLNVMGLYPGDPGPPGGDCSGTVVAVGEGVKHIKVGDNVFGIAPGCLKTYVIT
FT                   DSNLLCKIPKGFTFEQAAALPVVATTVEYSLRDIANIKKGDIVLVHAVTGGVGLMVVQY
FT                   CKAIGAKVYGTAGSESKVEYALSNGVERVSSSRNADKFKEDMKDLEGKVDIVINSLIED
FT                   FIPNSLNLLKKGGCFVELGKRGIWTEEEMKEKRPDIKYKCVAVDVMMEEDPSWFGGMLT
FT                   RIKNLVEEGIIESLPLKVYDMRGSDENGIDAFRYMQRAQHIGKVIIKIPTPFKYLELDT
FT                   ENHKLNNVGSEKEDRHNNEYGIHVITGGLGGIGRIIIKWMLEEGVRKIAILSRSANNDS
FT                   LRDIPEIKDYLNTDIIQIECIKCDVSILSQVESAFREILVKFGETNQIHGIFHAAGILM
FT                   DGAIASQTMEMMESVYAPKVYGAWNLHECCEKFELNKNLKHFVMFSSVASLLGNFGQTN
FT                   YSAANSCLDSLVEYRRNKGMCGTSIQWGPWIEQGMAANLKQHLEKVGMYGISNELGIRV
FT                   LNDILCFVSKSSSVIGCQSLKWDTFMRRYNTIPTFLSEVDYSSQGRSQGRVDISKLSDE
FT                   ELVVVIAQVAQQCASSPTLPSPDTVLLDLGLDSLGAVEFRNSVLEMTGVKLPQTLVFEN
FT                   PTIYAISMYVRDQNSGNSTKSDSKKHSQTSNEQAKMTIEQWLLSSLKQSERYILYAEAF
FT                   EKKYQTISNLITETDIISALEELGVENNQDYDLLYVSWNELISSEEENSKKQNDSNSKK
FT                   LEQELIFDPIADVEEIKNSMKLDLDGISTTTDPSEFKTALLTGVTGFVGRILLVKLIEE
FT                   FKNMQIVCLVRASSSEKGLERIINVCEEAEVWNPTYASRIIVECGNFEEEYLGLSEERY
FT                   YELCKEIDVVYHIGGDVNLLSNYKRLRKTNTLSLVGIINFCTTIKLKHLHFSSTLGQFP
FT                   AFFAVFTREFENAVVKETEGPSTREMSRLFPPTRQGYPWSKWAAEQILETAHQQGLPLS
FT                   IYRLPNTYIASDTGYTNKTDYATALLIASILEGMFPIGSSTAPLTPVNTICEIIISASK
FT                   KKERKHWRYNLLDTRILGKKHVEAWASQLGLGNYKGVAIDEFFSAIKSRGPESPIFKFV
FT                   PLMQYWRHYWFDNTERTQPFPVDTSNVSEDMPEISWPPLEITFQNSFLYCAKRGYFPSN
FT                   SSSISFTPIKCYSDALNEIKAELSLRNVNFNQNKYDFICRKMQKNADSIYDSLKKVSLN
FT                   FCAKYSYYILLKQSIVNQYIVQESLNDSILEKFKMMDCYFITGTSFEEILELRRVIRKL
FT                   LNNYNELKFVDIACPYLPTKNSRRLILEQLKIATSILPLKRFEAVDLDEILTDDSILLE
FT                   MFMFAPFTLPLIYGKEYFEEYKNKITGCSEVMEAYSSFKNYIIQTLIKNNYNTEYPIIF
FT                   SSPFHLPFVKEILQIFENSKIIVVDNKPDNSTIQGKLSMVKSLKSKYTNLDVSEEENSE
FT                   VYLLDILEEMKHRFVINEPSIDKNRLIYLKDFGEIHNEKISVQLQDFCSTSIDSRF"
FT                   /protein_id="XP_626786.1"
FT   gene            complement(<594185..>595339)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2190"
FT                   /db_xref="GeneID:3374039"
FT                   /locus_tag="cgd3_2190"
FT   mRNA            complement(<594185..>595339)
FT                   /db_xref="GI:66359217"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2190"
FT                   /db_xref="GeneID:3374039"
FT                   /locus_tag="cgd3_2190"
FT                   /transcript_id="XM_626787.1"
FT                   /product="ubiquitin domain containing protein with a UBA
FT                   domain at the C-terminus"
FT   CDS_pept        complement(594185..595339)
FT                   /locus_tag="cgd3_2190"
FT                   /gene_family="HOG000234736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin domain containing protein with a UBA
FT                   domain at the C-terminus"
FT                   /db_xref="GI:66359218"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2190"
FT                   /db_xref="GeneID:3374039"
FT                   /translation="MKVNIFYSVTGELISVEIHEETTVEVLKSLIEIELNLDSFKNYEL
FT                   SIEGKILKNDGFVLSDIVNEGSIFVLSEKTNKNTFENSNFSLNDRENLIQLLSKELFTK
FT                   IKEDQSLKSVYYSKSSKYRDSIDKDDIKSFTELIKNDYFSGNLNSISSSSNSSSNLYNL
FT                   DPLSPEYQRLIEEQVRKQNVEENLILAQDHLPESFTQVHMLYINAEVNGISIKAFVDSG
FT                   AQTTIMSKKCAEKCNLVRLIDYRFSGIAQGVGTSKIVGKIHVAQMKIGNSFFPFSITVL
FT                   EESHVDFLFGLDLLKRYQCCIDLHQNALIIGDEKVQFLSESEINSEISQINSNNEYDQC
FT                   FEQGKKLQLLSLGFSESQVINALRATNGNTELAASLLFSNETFE"
FT                   /protein_id="XP_626787.1"
FT   gene            complement(<595554..>596309)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2200"
FT                   /db_xref="GeneID:3374036"
FT                   /locus_tag="cgd3_2200"
FT   mRNA            complement(<595554..>596309)
FT                   /db_xref="GI:66359219"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2200"
FT                   /db_xref="GeneID:3374036"
FT                   /locus_tag="cgd3_2200"
FT                   /transcript_id="XM_626788.1"
FT                   /product="proteasome subunit alpha type 3, NTN hydrolase
FT                   fold"
FT   CDS_pept        complement(595554..596309)
FT                   /locus_tag="cgd3_2200"
FT                   /gene_family="HOG000091086" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome subunit alpha type 3, NTN hydrolase
FT                   fold"
FT                   /db_xref="GI:66359220"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2200"
FT                   /db_xref="GeneID:3374036"
FT                   /translation="MTSVGSGYDSSVSTFSPDGRVFQVEYANKAVDNSGTTIAMIYNSG
FT                   IVFAVDKYVASKMMVAGTNRRVFAIDNQIGCCVAGFVTDSNKIVSIARSESLNYQKIYG
FT                   NPIPIRVLAERIAMYMHNFTLYGSVRPFGCSILLGGLDQDRGVELYCIHPSGSCYKYCA
FT                   MAVGKGRQFARTDLEKLMEKNLSEEDALYEAARVIIQSREEGASKNLELEMAFIGPGSD
FT                   FQFSIVPEKQINLLNERVEKYIDDLASAE"
FT                   /protein_id="XP_626788.1"
FT   gene            <596935..>598389
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2210"
FT                   /db_xref="GeneID:3373783"
FT                   /locus_tag="cgd3_2210"
FT   mRNA            <596935..>598389
FT                   /db_xref="GI:66359221"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2210"
FT                   /db_xref="GeneID:3373783"
FT                   /locus_tag="cgd3_2210"
FT                   /transcript_id="XM_626789.1"
FT                   /product="replication protein A1 large subunit"
FT   CDS_pept        <596935..598389
FT                   /locus_tag="cgd3_2210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein A1 large subunit"
FT                   /db_xref="GI:66359222"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2210"
FT                   /db_xref="GeneID:3373783"
FT                   /translation="FHLFKLSISCFMPIREVNVNRQTISIKGRIIQKSSLQILKSGLRF
FT                   FHLDIIDKDNDVIRVKFWRQKAEEYHNILQHGSVYILKCTGNDVVVSNTKFNDTSNPYE
FT                   INFSDRCFVRKVENDDDSIGKAPKYVFTTVKDIREIPVPSIVDLIGIVRHFSPSTKVIS
FT                   RKNNDEVSRRTISVVDKTGFLINITLWGELAEVSDEKFLGNPVVALKSIQIREYQGRQG
FT                   STLNGRSNMEFSIDDGKMEELRDWYDSIGSSIKFESISNISSNESPNNFRVNDKLYSGR
FT                   TLKDIRNRMEDNEFSSTPSFQVIARISKIGSINVNQQVSGDKGGSLTYDACPICKKKVL
FT                   FSTSYCEKCDESVVPETKFLFPVTIEDHTCSLTVQCFHEIGSTFIKELSASACKEMEQN
FT                   NDKKLNFILNLQCMWRHYNLKIQLKAEEYNNQKKTRAIIQSAEPIDLNQISYLMLESIS
FT                   QSILGKTNKRSLFEDNINTNKRISVG"
FT                   /protein_id="XP_626789.1"
FT   gene            <598598..>599050
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2220"
FT                   /db_xref="GeneID:3374080"
FT                   /locus_tag="cgd3_2220"
FT   mRNA            <598598..>599050
FT                   /db_xref="GI:126644770"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2220"
FT                   /db_xref="GeneID:3374080"
FT                   /locus_tag="cgd3_2220"
FT                   /transcript_id="XM_001388070.1"
FT                   /product="ubiquitin-conjugating enzyme"
FT   CDS_pept        598598..599050
FT                   /locus_tag="cgd3_2220"
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme"
FT                   /db_xref="GI:126644771"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2220"
FT                   /db_xref="GeneID:3374080"
FT                   /translation="MSISKRIQKETMNLANDPSPGINAEPDEDNYRYFKIMMMGPEGTP
FT                   YEGGSYKLELFLPEHYPMEPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVL
FT                   LSIQALLSSPEPNDPLDTVVADHFKNNLLDAESTAREWNRLYAKGS"
FT                   /protein_id="XP_001388107.1"
FT   gene            complement(<599324..>599962)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2230"
FT                   /db_xref="GeneID:3374035"
FT                   /locus_tag="cgd3_2230"
FT   mRNA            complement(<599324..>599962)
FT                   /db_xref="GI:66359223"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2230"
FT                   /db_xref="GeneID:3374035"
FT                   /locus_tag="cgd3_2230"
FT                   /transcript_id="XM_626790.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(599324..599962)
FT                   /locus_tag="cgd3_2230"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="100 aa region highly conserved similar to
FT                   uncharacterized expressed protein"
FT                   /db_xref="GI:66359224"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2230"
FT                   /db_xref="GeneID:3374035"
FT                   /translation="MEKLISWLHERTKRRRDMRKKIKNLWNEEVSLNGEQDKDISSVEN
FT                   IIGYFKDKRRPSFERDLSLSEDTASMSPNSDIGCDNEEKIEDDHLFGPSPSDIKKTAIN
FT                   QNLNYGAALLYGEGEAMAQFVQAGKRIPRRGEVGLTGEQIESFEKVGYVMSGSMHKRMT
FT                   AVRIRKENQVYTVEERRNIALQNEKQRMLKESQLLGELRELIKREEKKL"
FT                   /protein_id="XP_626790.1"
FT   gene            <600333..>600605
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2240"
FT                   /db_xref="GeneID:3373782"
FT                   /locus_tag="cgd3_2240"
FT   mRNA            <600333..>600605
FT                   /db_xref="GI:66359225"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2240"
FT                   /db_xref="GeneID:3373782"
FT                   /locus_tag="cgd3_2240"
FT                   /transcript_id="XM_626791.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        <600333..600605
FT                   /locus_tag="cgd3_2240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="domain similar to UMP1, proteasome maturation factor
FT                   UMP1"
FT                   /db_xref="GI:66359226"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2240"
FT                   /db_xref="GeneID:3373782"
FT                   /translation="GFIRTLENELNMLSAIQGYHSAAKSRMEQDLVSKVQRHPGIPSSH
FT                   LSLDLLMNMDDKIEISDILGTEKPINPLGKKTISDTLESIFNINS"
FT                   /protein_id="XP_626791.1"
FT   gene            complement(<600709..>600972)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2250"
FT                   /db_xref="GeneID:3373781"
FT                   /locus_tag="cgd3_2250"
FT   mRNA            complement(<600709..>600972)
FT                   /db_xref="GI:66359227"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2250"
FT                   /db_xref="GeneID:3373781"
FT                   /locus_tag="cgd3_2250"
FT                   /transcript_id="XM_626792.1"
FT                   /product="60S ribosomal protein L37A"
FT   CDS_pept        complement(600709..>600972)
FT                   /locus_tag="cgd3_2250"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L37A"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359228"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2250"
FT                   /db_xref="GeneID:3373781"
FT                   /translation="VGIVGKFGTRYGASLRKQVKKTEILQRETYVCPFCGKTATKRTAC
FT                   GIWECKGCRKVLAGGAWQLSTAAAVTARSTIARLRKQREEAE"
FT                   /protein_id="XP_626792.1"
FT   gene            <601692..>602114
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2260"
FT                   /db_xref="GeneID:3374032"
FT                   /locus_tag="cgd3_2260"
FT   mRNA            <601692..>602114
FT                   /db_xref="GI:66359229"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2260"
FT                   /db_xref="GeneID:3374032"
FT                   /locus_tag="cgd3_2260"
FT                   /transcript_id="XM_626793.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        601692..602114
FT                   /locus_tag="cgd3_2260"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359230"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2260"
FT                   /db_xref="GeneID:3374032"
FT                   /translation="MSELEALSNQSTERGVVQENSTEKMDAAENPNEISVDNNAAIELL
FT                   NVNLQDMFANSFIGANVVNATRMQETIGESWPFDQYQATGLLPVDYAYWLTPYNTSIGP
FT                   TAFVMMQATATFPDGTQMDAQQARARRRRHVFGVCC"
FT                   /protein_id="XP_626793.1"
FT   gene            complement(<602236..>603885)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2270"
FT                   /db_xref="GeneID:3374034"
FT                   /locus_tag="cgd3_2270"
FT   mRNA            complement(<602236..>603885)
FT                   /db_xref="GI:66359231"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2270"
FT                   /db_xref="GeneID:3374034"
FT                   /locus_tag="cgd3_2270"
FT                   /transcript_id="XM_626794.1"
FT                   /product="WD repeat protein"
FT   CDS_pept        complement(602236..603885)
FT                   /locus_tag="cgd3_2270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD repeat protein"
FT                   /db_xref="GI:66359232"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2270"
FT                   /db_xref="GeneID:3374034"
FT                   /translation="MGDYIPIEIEPKRKALYSEILSNNRYLYSNSGNENETIKNLEFRI
FT                   FNGEISLLITTGNKLKTVSPIKVNEENSSKLTSFNSKNLITATTLRNDGRLCGISMENN
FT                   ECIALDTETMTVVRRFEKSSEQLSSIAFSCDKSKIISGTLTGKVSILEVSSGEIVFTAP
FT                   AHNDVIRCILPLENKLFNYPNHDSSTTDTLNIYFATCSYDFNIKIWCYSELKQAENYAA
FT                   SNALPNKYQLKVMKILKHNFPVECIDIINGNKLISCGGTCIKIWDLEKTEFECIHSIAN
FT                   FARTITTISSNENIFAVGCLDHNVCIYDSKTFEFIRSFNYNKGIVKVATSNCSSYIAIA
FT                   LEDGNWSIRKKVFSEIKESTRDVANEDINNLRKGYRTGTIRYYKRGRAASANAMDIEIK
FT                   NCKKRQTKLDRLLRSYSYKKALEIALKMSWPHFISLLKLLSSRGALHLIARENEYEKTI
FT                   KLLKYISKNMGKCGPHQFILISELIEHILHESNIVRLLNQNKSIENKNEIFECIKKISQ
FT                   KVSLETKQHVLLKEFKIAVEIIIQNCKKCLVN"
FT                   /protein_id="XP_626794.1"
FT   gene            <604128..>605783
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2280"
FT                   /db_xref="GeneID:3373921"
FT                   /locus_tag="cgd3_2280"
FT   mRNA            <604128..>605783
FT                   /db_xref="GI:66359233"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2280"
FT                   /db_xref="GeneID:3373921"
FT                   /locus_tag="cgd3_2280"
FT                   /transcript_id="XM_626795.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        604128..605783
FT                   /locus_tag="cgd3_2280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359234"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2280"
FT                   /db_xref="GeneID:3373921"
FT                   /translation="MEFTKLVSKPSFKLDLDKINYKFEAGDKNSNSCKANGNRGKHSLE
FT                   CGNSCGTVYLEDGDSQILEQLKRIEEENIRLREINEQLSRSLCISTRSISINNSNNSFQ
FT                   IDDFSRQSSFLSSRALTTRSISMNPQIVKNLKMTVSDIIGDRTEIALRVMLLENEYFLG
FT                   LEPILDRQSARVVLSKTPSYWSIKKIPHFWEGFSNIMSSVIKKGFLNTISYWSFLRAPP
FT                   SPKKNVKKWEGITIKYKGPLKEFRGYSLAGNDDGLFVYLESEEDAYDNIFYCNFRKKKE
FT                   KCTEDFRDCTNDLRTNVLNLLHANTRSFICIEPNIKSKGGNIMIKLSESKRNKLMFEEI
FT                   SASELLARQLLISAEQISQDFDLTNRNIHQVTSFPSFSNYEQNFQKTSSNRYSPEESFT
FT                   SRTVELCSSAETQNKDKRGSLADELSSELLTQRNQSLSNFFGEANHSKYTLSDNIGFKE
FT                   EIPNKNSLKIIDTSLGENSKICSPRIRASNIINDQLSGLEYHEVPLTRRLNVVYIPSTT
FT                   AVLVHDLVDSDEELNNNIDSGKISDVEQEYFKVE"
FT                   /protein_id="XP_626795.1"
FT   gene            complement(<606940..>607332)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2290"
FT                   /db_xref="GeneID:3374033"
FT                   /locus_tag="cgd3_2290"
FT   mRNA            complement(<606940..>607332)
FT                   /db_xref="GI:66359235"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2290"
FT                   /db_xref="GeneID:3374033"
FT                   /locus_tag="cgd3_2290"
FT                   /transcript_id="XM_626796.1"
FT                   /product="possible domain AAA, ATpase family"
FT   CDS_pept        complement(606940..607332)
FT                   /locus_tag="cgd3_2290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible domain AAA, ATpase family"
FT                   /db_xref="GI:66359236"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2290"
FT                   /db_xref="GeneID:3374033"
FT                   /translation="MPVFNLTNIYHRLGKSFLVSSIADSLNYSIKYVHTADIFNATIGF
FT                   FERYLKEIIDVCTRKRKYILVIEDIDQYLLEENNTLLSLMFFFDIISRSNKWMHSEIMI
FT                   FGTSTSKNIVCTRMFQVCCFLRGFIW"
FT                   /protein_id="XP_626796.1"
FT   gene            complement(<607377..>608759)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2300"
FT                   /db_xref="GeneID:3373922"
FT                   /locus_tag="cgd3_2300"
FT   mRNA            complement(<607377..>608759)
FT                   /db_xref="GI:66359237"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2300"
FT                   /db_xref="GeneID:3373922"
FT                   /locus_tag="cgd3_2300"
FT                   /transcript_id="XM_626797.1"
FT                   /product="hypothetical protein with transmembrane domain
FT                   within C- terminus"
FT   CDS_pept        complement(607377..608759)
FT                   /locus_tag="cgd3_2300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with transmembrane domain
FT                   within C- terminus"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359238"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2300"
FT                   /db_xref="GeneID:3373922"
FT                   /translation="MYWDKYDEIPLRWISFFLFKWRLELDESFVGGPLLDDFFEKIGSI
FT                   FYLLLLKRYETNFCDIDTTEVGINLFIDRLPKVLILIGNSGSGKRYFARELLSSFSKIC
FT                   YFENSKSFNPVTFNISIDEYFIDTRTTDCFDKKIYYLNNKLTSISKVGVRLRDSLCSGP
FT                   FSPPAILVCFRSANPNKYYTGPNSNYYGDVSKQIVILNLISKFIRIWDNKNIPIVSFFI
FT                   SDIDPDDYGTSNKILQSKTMDIRYIFKYGYGEFFEIDFRNFSLQIDKISLLRFLIYKRY
FT                   DINEISLNCLMEKISSIHSKYIMALSNEELKFIVNEIDLVRIADVLNEELHDIPYTVSC
FT                   GRFVAIVLNGVIPDFFNVFLYYFNFVIRRLNKSVSNSNCTICDSSCDRESGSCKNGLIQ
FT                   MTGFGQVIHKIKNLLLPCISYSEISNFRLPIVFNEASGIIVFGDKGCGKFYFSQANEKI
FT                   TI"
FT                   /protein_id="XP_626797.1"
FT   gene            complement(<609053..>609353)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2310"
FT                   /db_xref="GeneID:3374077"
FT                   /locus_tag="cgd3_2310"
FT   mRNA            complement(join(<609053..609170,609214..>609353))
FT                   /db_xref="GI:126644772"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2310"
FT                   /db_xref="GeneID:3374077"
FT                   /locus_tag="cgd3_2310"
FT                   /transcript_id="XM_001388071.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(<609053..609170,609214..>609353))
FT                   /locus_tag="cgd3_2310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644773"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2310"
FT                   /db_xref="GeneID:3374077"
FT                   /translation="SICKVRNVKCIVLNSSIIYLRQLPYDISSTDLYDIFGRHGTIRQI
FT                   RRGVGEDTKGTAFVVYDEIEDAKSALKQLSGFQVSGRYVNL"
FT                   /protein_id="XP_001388108.1"
FT   gene            <609632..>612625
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2320"
FT                   /db_xref="GeneID:3374079"
FT                   /locus_tag="cgd3_2320"
FT   mRNA            <609632..>612625
FT                   /db_xref="GI:126644774"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2320"
FT                   /db_xref="GeneID:3374079"
FT                   /locus_tag="cgd3_2320"
FT                   /transcript_id="XM_001388072.1"
FT                   /product="cGMP phosphodiesterase A4"
FT   CDS_pept        609632..612625
FT                   /locus_tag="cgd3_2320"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cGMP phosphodiesterase A4"
FT                   /db_xref="GI:126644775"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2320"
FT                   /db_xref="GeneID:3374079"
FT                   /translation="MSGLASSPSIGKTILFEKNNDWGLNFDLGELEIYENQDLKTRLKE
FT                   LISPFENTFSSVSTLEYLHPFTLKFRSEILEKKFEKKFRKRTEIGIFWIGLLTLFLIIL
FT                   DILLEVYNQKVNEVSNSSVTAYFIICGVVATCSLFLIISFFVNFLNKHLEVIFTSTTII
FT                   TTILNITAGNLLLDVSLSPNNNYDPAVQNSRSLIVITICSILHFMLPISFMSILIYSIT
FT                   SISFYIILVPSMLMPIPNETQYVSTTIYLFVFCFVCILAKRVNVSSSRRDFFNINLVKA
FT                   EMQILENSMNQTPKSTMIEGTLANINKVQLFLRYLNTSCTKGINRKMLHDAMVDLTSAQ
FT                   VTLCRSDDIYAVDPVAIFLPQSLQSNVPQTPRQSKVRIIGSGDVTPKENCSPTASQKIK
FT                   QELGISYDVRIPISPNSPKSMGQFLSPKSHENKSSYISVDSISARRNTESRATVTSIPG
FT                   PSRRRLSMMIATAGENSSTLIDPSVEKVREYITAEFTKSSASRREVLYASKVFDGPAAN
FT                   PSNTNEKIKTTSQNLDTNHIVESMISRQGPLDEPAVGGDIEDNYRHLLKNKRKIAHFAT
FT                   HLASKLISIKDPSGTISLLSQSYFNETNPHNFTLPELPKGVGTELHSDLDRALQLMNNQ
FT                   YSSNWDLDMWRLNELTKGNCLSVAGLYMLHLIALEEKNQESGFDSSNLPRGITTAYSSS
FT                   ITAPSKLIGNISKFNIFFRELNIRYLNNKYHNELHGTNVCHLAICLSRATGLWSHLDTV
FT                   ERLASVIASLGHDVGHIGRTSNFLVNSRHMLAINYNDRSVLEMFHASLTFRIIYYYGGG
FT                   AADFLQSWDAELHKEFRRIVIELILETDMHRHFECVSRFRVRRQAVDWDPYGDAQDRLM
FT                   LARTCLKAADIGHGALKWNQHYKWCRSVVEEFFLQGDEEKALSLPISPICDRESTDVPK
FT                   SQVGFLNFVCLPLFQELCYVDVEGDVRRCIDRILENINNWEDIAEAGIQWDSEDALTFV
FT                   SDEKADLQ"
FT                   /protein_id="XP_001388109.1"
FT   gene            <615236..>617824
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2330"
FT                   /db_xref="GeneID:3374078"
FT                   /locus_tag="cgd3_2330"
FT   mRNA            <615236..>617824
FT                   /db_xref="GI:126644776"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2330"
FT                   /db_xref="GeneID:3374078"
FT                   /locus_tag="cgd3_2330"
FT                   /transcript_id="XM_001388073.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        615236..617824
FT                   /locus_tag="cgd3_2330"
FT                   /gene_family="HOG000246455" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644777"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2330"
FT                   /db_xref="GeneID:3374078"
FT                   /translation="MAKGTFQCFGFSPKLLESIKIIGYSLPTPIQRKCFPSILAGRDVV
FT                   AMARTGSGKTAGFVLPMIERLGCSHSQIVGIRGVILSPTRELALQTYRVVRKLACKTNL
FT                   VVCALTGGSSLDRQFESLSGNPDIVVATPGRLFHHIIEAGLSLIAVKIIVLDEADRLFE
FT                   MGLASQIEKILESIPKNRQCVLVSATMPTALASFSKVMLNEPEVIQIDSDYILSETLKL
FT                   TFLFVREDEKLASLLYLLRNTIPSHERAIIFCATKHHVDYIVKILESNNIIVSYIYGNM
FT                   DQEARTMHLNTFRKNKSRALIVTDIAARGVDIPMIKYVINFDFPLSPKLFVHRTGRTAR
FT                   AGQHGRAFSLITSRDLPYTIDLCLFLGLKMTTLTSKQTTDSSNYSLNTENRVEAGIRDD
FT                   DIHEEGISFIKPASLNDFHGESRLILAGFPDLTLEIESIERVLTENSEIERCRRSMESA
FT                   YLLYLKTRTPSSKESLKRSRELLEKCGGVSKILMSIHPDLNIDTNETNLNIVTFQNLGV
FT                   ISDPLLDHLKSFRPTENKTHNKYGCLNQATGKMVLKSSIKMKKIKDMGNVVKSILSEDK
FT                   FAIGTSISESQNGISDEISSNNNISQNFVNKKRKPKKQCNRVKESEHFFIPYKNSEGEV
FT                   SRSTGLQLESSSFDINPDEEGEMKRQKCVRKWNSKRKRYELIDISKKNSIKKFNESGIK
FT                   VKGELKCTGQYKKWKANTNLKIQNVGEIEDTELNKTIRNNGFKDKYNTSDINSSFDYSN
FT                   VHDKHKGIIEAISKGIKLTHKQKRIARRIGIIKEKIVNKSKSLQNEIRTPQQILKKRAN
FT                   DVKQRMKNDLEFRRKQLAKKNKEFAEKNFKKVIQKGRPNRSKVVLVERRR"
FT                   /protein_id="XP_001388110.1"
FT   gene            complement(<617860..>618168)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2340"
FT                   /db_xref="GeneID:3373780"
FT                   /locus_tag="cgd3_2340"
FT   mRNA            complement(<617860..>618168)
FT                   /db_xref="GI:66359239"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2340"
FT                   /db_xref="GeneID:3373780"
FT                   /locus_tag="cgd3_2340"
FT                   /transcript_id="XM_626798.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(617860..>618168)
FT                   /locus_tag="cgd3_2340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359240"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2340"
FT                   /db_xref="GeneID:3373780"
FT                   /translation="IKQFRFALIANSNLSMNDKNGFIWKVIYIDELEWLDIYSGTLSYN
FT                   CSCGDIFWTTLPYLEEIVNSEAKGNDSSVVLQCESCSLKIKVIFNKESLNEIKKRIN"
FT                   /protein_id="XP_626798.1"
FT   gene            complement(<618155..>619342)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2350"
FT                   /db_xref="GeneID:3373920"
FT                   /locus_tag="cgd3_2350"
FT   mRNA            complement(<618155..>619342)
FT                   /db_xref="GI:66359241"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2350"
FT                   /db_xref="GeneID:3373920"
FT                   /locus_tag="cgd3_2350"
FT                   /transcript_id="XM_626799.1"
FT                   /product="possible RAB geranylgeranyl transferase, b
FT                   subunit1, pernyltransferase"
FT   CDS_pept        complement(618155..619342)
FT                   /locus_tag="cgd3_2350"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible RAB geranylgeranyl transferase, b
FT                   subunit1, pernyltransferase"
FT                   /db_xref="GI:66359242"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2350"
FT                   /db_xref="GeneID:3373920"
FT                   /translation="MYNAARKFDLELHKKYLIFVTNDAINSYDSSKIQLSSVFIHGIYW
FT                   VLCCSDLIQFNICDQLHNARNKFLHLLKKCERELLIDNFKLKFYSLNPFDFVRPSILSI
FT                   LSGIQIKTILNNKITEDNKYELTAFIKSLIALRGEKIYINNSKNCLRQFDVRFIYSTLL
FT                   VYYLSNYPDLKQDSVFRISELTKLLVNMQNKDGGFGKRYKDESHAGYTFCAVSSIAIIK
FT                   EITKNNSIDLLFNFNRLNRWLLKRIIASESHENTKYQSYCFNGRIGKKCDVCYSWWVFA
FT                   SLKIVKNITINRNIDCSSIINSKILKILINGILCHQNNIYGGFQKSPFNTDNKGHSDPL
FT                   HTFLSISALSLIFNSDSKKSSLEFYEPTEPFEVFESLIKIDPISVISEKYLNKTI"
FT                   /protein_id="XP_626799.1"
FT   gene            complement(<619937..>625354)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2360"
FT                   /db_xref="GeneID:3373919"
FT                   /locus_tag="cgd3_2360"
FT   mRNA            complement(<619937..>625354)
FT                   /db_xref="GI:66359243"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2360"
FT                   /db_xref="GeneID:3373919"
FT                   /locus_tag="cgd3_2360"
FT                   /transcript_id="XM_626800.1"
FT                   /product="putative nucleoporin, FG-rich motifs within
FT                   N-terminal region"
FT   CDS_pept        complement(619937..625354)
FT                   /locus_tag="cgd3_2360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative nucleoporin, FG-rich motifs within
FT                   N-terminal region"
FT                   /db_xref="GI:66359244"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2360"
FT                   /db_xref="GeneID:3373919"
FT                   /translation="MLGGGGFGSNQNQQSSGGLFGTSNSFGVGIGQQGVSQNINTVQPA
FT                   STGLFNSSTSLFGGNASPGLFGSTGSSNSGFGNTGQSSVFGQSSNGLFGQSMSTFGGNQ
FT                   QISSTQPTMFGSSSSSTIGSSSGFFNSSSANNSGGFGSFQNSFGTSGGFGSQSSQSNPS
FT                   SFFGQQNNSGLFGSMPIQTFGNTSASPFGGTMGTNSNIFGAKKGTNGITFQPVVDRDSD
FT                   ARIMSIVYQKDIDQKKSVEELRWEDYQEKRGPANSLSSINTNFTTSTNSFGNSSFSNAG
FT                   GFASNSQGPSISNSIFGQPQSSFISSTTPQNSLFGSSGSSSGLGQTSILGQGLQNSQSN
FT                   IGNTQFVSNNGLFGASNNTNSFPLQSSTSGSNSGLFSTPSLFSSNSNNGIINNSNNSNN
FT                   LGTSISSLNGGNLFGQPSNLGSLDSSLKTSGSLFGGSSTTSNSASLTLFNSNSNTQPQI
FT                   SLSNSSLSMKPLFGSNQTLSGSNLGAGSGSTSGANLSTSLFGSTLPSSSGLFSNSPNSL
FT                   FSSTQPQNTLNNNNANASSSSLFGQSTSLSQSFGFSSVNPPNQSWSSLTSGVSNSAIGQ
FT                   TNLPGNSQLNNSSIQLQNILGGGQSGKPSNQNSSIVLGNGLSSNKLINSVLPKPIVQNS
FT                   KYSDSNERGKSLWLWKPLPQFISRSNRYQLDNLSHVSHERITNSSELALPAVATESARH
FT                   NTALLTSVRRIEKTMDPQTPAAFLNLLERQQQFFDAVQSPEQNGNSPTNSKTRSLVFTT
FT                   SHTTKFVPLDETFEDAIDDSSSATFSPRASKIENKSSSDSSKPLINLDSISRISQDVQI
FT                   SKSDDCRTSIGRVVNESNNAARTPYLNQHRNSVNSISAVSNERQARSSIGLTTPRPITR
FT                   RPDQLIDSIPSDLVKSYIRKQKEFVIESLTPILTKHDYFCIPSIELLKTFSEERLAVVE
FT                   DFKIVREGVGEIVWPGVTDLRGINLDSVVSIEPLCVSVYGDGDSSIPIGEGLNKKAIIT
FT                   LKNCKPKRAIPSKDPQEIDEFNSNRVKQIKSYTEQMGARFISLDTITWEWKFEVTHFSK
FT                   YGFLSEDNSLSHFKEPCSALATKETNFNVSDQENHFLRSSKQEQYKGHFFVMKSQYNFS
FT                   LYSEIKSIVEKDNSLKKSAYNGICFRSGMYIGSNSFVVVPHRSFRKDIQGVSDYNTSIT
FT                   LLRINNLTGSVTKDSINNLGYSRRLISAWFRLYFEIIGNKTSNNCSGVSIESIIKLIFL
FT                   LWSITKNEVEIYSHLSGFKFNSLNFERLKYFEQTFGLVGGIMELIIKNLNNPSEKRFES
FT                   NLRELISWWMKIVINDIPVIRFGDDKQNSQCLHEERISLLLNNIVNGNLLDLVRNGPSL
FT                   SYLTIPRTASLFLSIGNNKTSILQMMENMQWWSKIGLVSDLTSYSNRIYKTISNIDASA
FT                   DGFLYEWQNNVFLSANYSTNSKLGERLLKMKNASLIDNTQKLGKLIDSDDPINISPSEV
FT                   GKKQVFEQIQFQIIKFFFGDENSRQVELFRLNNFGSIKFSSFNWLIARALTFYHNSICN
FT                   SNEITPTNKLNLILIEELEILGLWEWAVFIIMHTNMNSDFYYLLNCVIMRNIQENPDYS
FT                   NPEDYLNDEKWKFLVDKLGIPLNWLLEAIIYKLESSGNILQSLKCTMYLINRLQENKYK
FT                   AGDLLFHRSDHVSAINSLAISAAKKLFYAPLLPNTLIEISALTKCVIIGKKPLYKIRNY
FT                   FDAYLLNTNENLQLIFSAYEEQIVTDIWHALKSIITISSQYMKFATRLIESETYYIDQD
FT                   ELKIIFTNLEKFTALREDTVRYSFEQCINNIIDNYCWDIVLDAIGIAKH"
FT                   /protein_id="XP_626800.1"
FT   gene            complement(<625724..>626519)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2370"
FT                   /db_xref="GeneID:3374076"
FT                   /locus_tag="cgd3_2370"
FT   mRNA            complement(join(<625724..625955,626004..626269,
FT                   626313..>626519))
FT                   /db_xref="GI:126644778"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2370"
FT                   /db_xref="GeneID:3374076"
FT                   /locus_tag="cgd3_2370"
FT                   /transcript_id="XM_001388074.1"
FT                   /product="steroid dehydrogenase kik-i, putative"
FT   CDS_pept        complement(join(625724..625955,626004..626269,
FT                   626313..626519))
FT                   /locus_tag="cgd3_2370"
FT                   /gene_family="HOG000039237" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="steroid dehydrogenase kik-i, putative"
FT                   /db_xref="GI:126644779"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2370"
FT                   /db_xref="GeneID:3374076"
FT                   /translation="MNYLSMAINKLFLLLNRPEKKLTSFGSWAIITGASDGIGKAMAKE
FT                   LFKEDLNLILIGRNREKLQNVVNELLSLKKPDSNQEIRYYLMDFTDPTCYSNFCGYLNS
FT                   IDDVGILINNVGISYPYAQYFEETSLDLINELIEVNVRSVLMMTRIVYSYMKKRDRGAI
FT                   LCIGSGSSQLQTDPLYSAYAATKSVAESLCRSLRAECESENITIQCHTPLLVTTKLSKA
FT                   KRETLFTISTKR"
FT                   /protein_id="XP_001388111.1"
FT   gene            complement(<626669..>627034)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2380"
FT                   /db_xref="GeneID:3373918"
FT                   /locus_tag="cgd3_2380"
FT   mRNA            complement(<626669..>627034)
FT                   /db_xref="GI:66359245"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2380"
FT                   /db_xref="GeneID:3373918"
FT                   /locus_tag="cgd3_2380"
FT                   /transcript_id="XM_626801.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(626669..627034)
FT                   /locus_tag="cgd3_2380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359246"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2380"
FT                   /db_xref="GeneID:3373918"
FT                   /translation="MSSSILVNRTSAFGRNELTEVDIFNICRSIKSCGECQLSKFCSPC
FT                   KVSSSSEFFCTSKVDSITSCRQNTMSNICASAWPWWIYLCLVLLSLVILGMTLIILYKC
FT                   CTCLFVKVQETELEDLK"
FT                   /protein_id="XP_626801.1"
FT   gene            complement(<627134..>628279)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2390"
FT                   /db_xref="GeneID:3373912"
FT                   /locus_tag="cgd3_2390"
FT   mRNA            complement(<627134..>628279)
FT                   /db_xref="GI:66359247"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2390"
FT                   /db_xref="GeneID:3373912"
FT                   /locus_tag="cgd3_2390"
FT                   /transcript_id="XM_626802.1"
FT                   /product="proliferation-associated protein 2G4
FT                   metalloprotease, creatinase/aminopeptidase fold"
FT   CDS_pept        complement(627134..628279)
FT                   /locus_tag="cgd3_2390"
FT                   /gene_family="HOG000168207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proliferation-associated protein 2G4
FT                   metalloprotease, creatinase/aminopeptidase fold"
FT                   /db_xref="GI:66359248"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2390"
FT                   /db_xref="GeneID:3373912"
FT                   /translation="MSKQEGLENVDDFCISESISNSEVVTKYYTAAEIVNSTLQYVITL
FT                   CLDGADISEICRKSDSMIEEKSSSVYNKKEGGRKLDKGIAFPTCISVNEICGNFSPLPA
FT                   ESLKLKNGDLIKIDLGAHIDGFISICSHSIVIGTERISGKQADVLKAANTAMEVAIRTV
FT                   KPGNTNTYVTSMLNKTVKEFNCNMVQGVLSHQLKRHVIDGNRVIISKETLDEKVDEFTF
FT                   EENEVYGLDILVSSGEGVPRESDYRSTVFKRAIETNYNLKSPIPRQFLSEVNKRFPTLP
FT                   FSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGEYVASFKCTLLLLPNGSKRISGL
FT                   QFTQENICDSEFKVTDEEINSILSTPLSVKKKKKNKPIVSS"
FT                   /protein_id="XP_626802.1"
FT   gene            complement(<628558..>631099)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2400"
FT                   /db_xref="GeneID:3374063"
FT                   /locus_tag="cgd3_2400"
FT   mRNA            complement(join(<628558..630951,630995..>631099))
FT                   /db_xref="GI:66359249"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2400"
FT                   /db_xref="GeneID:3374063"
FT                   /locus_tag="cgd3_2400"
FT                   /transcript_id="XM_626803.1"
FT                   /product="Yn1201cp-family protein"
FT   CDS_pept        complement(join(628558..630951,630995..>631099))
FT                   /locus_tag="cgd3_2400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Yn1201cp-family protein"
FT                   /db_xref="GI:66359250"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2400"
FT                   /db_xref="GeneID:3374063"
FT                   /translation="RRVKLYEVNPENGNWIDCGTGFLKLNKDNDKFNILVLSDEDPNFE
FT                   KELHSQRKNIEDLLEIENYNIVKLVNTPIDLNREYCHQKESIITWQDGLNSDLYRALSF
FT                   QHSESCNSIWNMITSLVPHLCVDLLEAELPEESTGYSLLERPTSSNIDQIIDDLELDSN
FT                   INSENIVMDLLSREFFDSLFNLMEEFEQNSDLIGLHKIFQVLRRIIVFYSSFNEVFEIL
FT                   LSDEYYLKFFKACEYDETLENYKIKFSHKKFLENVKFHSVVPLPEVRTIHLNYRLMYLR
FT                   DVVMPRHLDEQSLQRIATIINNNFSSIISMIVTTSDIWKYLKENIQKNFLVAKFIHAVL
FT                   TVLKQNPMLSIYERHQIFINLKVNNILCEFCGYLNENCIGARQMLELSTSNDDHKNFSN
FT                   TNDLSFINYSNIRPIDLAVEIYSMVCEINPGLLRHAIHESTSQYFKVHKETNIYGSNVD
FT                   ILYADDALQNSPKESIKEMENLSDKSNLFHSLWGTLCEIFINSRSESIQMQICAIFKRI
FT                   LDPKTMDVPERDDSLSLFYDMGILDRLIDSLLNDSLIFTEFNPLYSARVLFCDILATCV
FT                   QEHNYRIKYKILQNQLPRKLLRIATRPFHKIFSISVIKFLRTCLGTRDDFYYRLFTKHD
FT                   IFKYIFLIMDQLKVPRNRGEGSILESVVIEMLDFICRNNIQLILKYLLENYIVVICNLN
FT                   LKASRGSKCRVFSRMLESFKLLSKSTQSLNNCRKNGSNILSSNTHSGLTADHDLKSYFT
FT                   CEKRKFHSHKFQCLDKGVDIVDNFEDNTIKETADPDSKNNANIDEIPKEISELFEYNDF
FT                   DNLSKQHKEHQKRPIRKKKN"
FT                   /protein_id="XP_626803.1"
FT   gene            complement(<631649..>634774)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2410"
FT                   /db_xref="GeneID:3373917"
FT                   /locus_tag="cgd3_2410"
FT   mRNA            complement(<631649..>634774)
FT                   /db_xref="GI:66359251"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2410"
FT                   /db_xref="GeneID:3373917"
FT                   /locus_tag="cgd3_2410"
FT                   /transcript_id="XM_626804.1"
FT                   /product="ubiquitin-fusion degadation-2 (UFD2) family
FT                   protein with a UBOX at the C-terminus"
FT   CDS_pept        complement(631649..634774)
FT                   /locus_tag="cgd3_2410"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-fusion degadation-2 (UFD2) family
FT                   protein with a UBOX at the C-terminus"
FT                   /db_xref="GI:66359252"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2410"
FT                   /db_xref="GeneID:3373917"
FT                   /translation="MLTNQEEIENSLIGALLGVSLICTDNPVENPSTKRIFLSDYKNEL
FT                   LIQEKKVALLFDDLENIIFHRLKIFFSTTDNKPRIKAFQFLIDSYNKFINESSIPKKIE
FT                   INERISNLAQFFPKYCALIIQCPELFEIVCNSECAISDLFEISVPNSFFLTLIQEMESN
FT                   DPKLFVSTFTDYIERQMDIIRQRKFTDLKLHSIKNIIFLSQFKQTTFILTQTPSFIKSS
FT                   NTNQGTKVSSGLVQQQNSLLGCIISPNPIDKDFKTNVNPTIMKYFSGLLSKTHSYINQS
FT                   KMLIKQDLSLVYEHSALVIKNMLKASTECRRMVIKWMGIICTSNEDKSKIYNSIPDLSM
FT                   FGNIQNSREIQHNLRSLIMRTSGLSTSGFSINYLHIVLRLLQPVKIEKVSELDCFFHMY
FT                   GRFNQLNDICNEVHNLLGDLVNDATLGEKDQVEIALNLTKKKLSDLNQINLKYQDFIKF
FT                   PTQIFWISCKSIKCFMQPVLLEYESILNDLNDYRSGLTSGHKYKNDHHLEQLSCEALSF
FT                   ECAVFHQNTISAFWHFLSLFIQFIFRTIYSFDENGVENCDRNTLLASKQGRIAVALKST
FT                   APSSKPSPQFSSLPSCLIEDVLSVTELLLRIKGNDEILIGFDFDSYISFVIFIINYGNY
FT                   FKNPHIRCQRGVIGIHYLLQIPQFRHRIEASDFTAEYILPALISLFNDVQKSPYFDRFS
FT                   LRLPIIMLFESLLKVDLHRERLHKFIKQRDESFTKFIHLLVSDLNYLLEEGLSMLAEIK
FT                   KRESKRNQVPNSISINNNEFGNSNNESRSSNHEEIESTIEEMPIERLEHACKGYMQLSH
FT                   ASASLLQKITEYYTFEILDSPLILPQIVTCLNCTLDRLVGPKCLELKVSNFDAYNFNPR
FT                   QLLANVCMTYVTLAFNSKVECKPMETDFSKILILEIINEQRYFKIHTFVKAHHIARREG
FT                   LMNKSKSDCFNQLVKYLQKELEENEVGQSMTNIDETDIPEEFLDPIMQDIMQDPVLLPT
FT                   SSKIMDRKVIERILISDGVDPFNRLPLTKDELIPQTCLKDQIKLFLENKNHS"
FT                   /protein_id="XP_626804.1"
FT   gene            <635278..>636222
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2420"
FT                   /db_xref="GeneID:3373916"
FT                   /locus_tag="cgd3_2420"
FT   mRNA            <635278..>636222
FT                   /db_xref="GI:66359253"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2420"
FT                   /db_xref="GeneID:3373916"
FT                   /locus_tag="cgd3_2420"
FT                   /transcript_id="XM_626805.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        635278..636222
FT                   /locus_tag="cgd3_2420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359254"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2420"
FT                   /db_xref="GeneID:3373916"
FT                   /translation="MSVNKNILFPCMKKAECNIFCPNEVLRENINSYGSIEIMDKISIF
FT                   HIPSPQNNQKPKKIFVTRKECCKLLDISIDEYLFINQNLCGLKPIIKCTGKIIIKMSVT
FT                   SVIIACKDVWILNPENSKTLEIIERLLECTGYNISVDNNTPSTKVSFADGISKEFISPL
FT                   VENYNYNSSLECTRNNFEETEHALSSSILSTFTDINTLDNSHEYKRQESIECSISSATQ
FT                   EKNIDIYNYRFIPTINKDYYSHSFAAVCIEIGLEVLNKELIESINCTKNEVLKSCNILI
FT                   KSSKWYKYPWRFTFSDFTNKKMISKSVNVSFFS"
FT                   /protein_id="XP_626805.1"
FT   gene            <636251..>636640
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2430"
FT                   /db_xref="GeneID:3374075"
FT                   /locus_tag="cgd3_2430"
FT   mRNA            <636251..>636640
FT                   /db_xref="GI:126644780"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2430"
FT                   /db_xref="GeneID:3374075"
FT                   /locus_tag="cgd3_2430"
FT                   /transcript_id="XM_001388075.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <636251..636640
FT                   /locus_tag="cgd3_2430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644781"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2430"
FT                   /db_xref="GeneID:3374075"
FT                   /translation="TLEITTSILIDCLKEILEEIKQIRQKDGDELVICIEEWEDILHRY
FT                   IPAIYLASKELTEVKSSITFSDELSKVYLDFQRNEYMYTNLKISLLTLSCSITSVITGK
FT                   SDFANINKKLISLTRNIRNESSQWN"
FT                   /protein_id="XP_001388112.1"
FT   gene            complement(<636891..>637352)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2440"
FT                   /db_xref="GeneID:3373915"
FT                   /locus_tag="cgd3_2440"
FT   mRNA            complement(<636891..>637352)
FT                   /db_xref="GI:66359255"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2440"
FT                   /db_xref="GeneID:3373915"
FT                   /locus_tag="cgd3_2440"
FT                   /transcript_id="XM_626806.1"
FT                   /product="ribosomal protein S18A, rps18ap, HhH domain"
FT   CDS_pept        complement(636891..637352)
FT                   /locus_tag="cgd3_2440"
FT                   /gene_family="HOG000039877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S18A, rps18ap, HhH domain"
FT                   /db_xref="GI:66359256"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2440"
FT                   /db_xref="GeneID:3373915"
FT                   /translation="MSLQIMDQDFQHILRIMNTNVDGRQKIMYALTAIKGIGRRFSNIV
FT                   CKKADVNLSKRAGQLSQEEINRIVAIVANPLQFNIPSYMLNRQKDVKDGKYKHITSNNL
FT                   EASLREDLERLKKIRSHRGLRHHWGVRVRGQHTKTTGRGSRAAAAAKKR"
FT                   /protein_id="XP_626806.1"
FT   gene            <637684..>639213
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2450"
FT                   /db_xref="GeneID:3373914"
FT                   /locus_tag="cgd3_2450"
FT   mRNA            <637684..>639213
FT                   /db_xref="GI:66359257"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2450"
FT                   /db_xref="GeneID:3373914"
FT                   /locus_tag="cgd3_2450"
FT                   /transcript_id="XM_626807.1"
FT                   /product="protein with gyf domain"
FT   CDS_pept        637684..639213
FT                   /locus_tag="cgd3_2450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with gyf domain"
FT                   /db_xref="GI:66359258"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2450"
FT                   /db_xref="GeneID:3373914"
FT                   /translation="MDQELGLSSGTNTHHIELSIYLGSISVTISDDNQVNCRFFSLTVD
FT                   IEPSFNLENSLQEINTQTQNIFDYNDSEIDDCEKTQFCTSWYEITDAPLHATYGIFSSE
FT                   INGIIKECNINQDIYLNLKLPIWVSNMAKQFYNAYNQIGFENFLLTVLQLRITIWATKN
FT                   STIESAEIFEVGETIIKVSEDHILSKNSFYFIHRIPEHDAFAIKEYSGNDKEYTIGILK
FT                   CFFNSRPVIIKNINNNLIDICKNNATPCDFSKENFELIQKLRISQENVRMQLHDIVPLK
FT                   WEYLDDNNVIRGPYNSIVMMSWIVKGYFGENSKLRLFDFGQECKIESTTPRCLQKFQPL
FT                   SNYLSLIKSDVSRIFRCSPNDLINIGLIVKEPNHENMNLHTVEMTNKSSAREENARFIH
FT                   KSQESKRIEIENAVNMLKTQFSHIEKEFQNKFRRKVQNKSMDNNFSLEATNISKDEFIK
FT                   FATKNVFRQKNNALFKKWCAEYGPELVLEACAIRIQTAFRKYIKRRYLNVK"
FT                   /protein_id="XP_626807.1"
FT   gene            <639250..>639606
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2460"
FT                   /db_xref="GeneID:3374074"
FT                   /locus_tag="cgd3_2460"
FT   mRNA            <639250..>639606
FT                   /db_xref="GI:126644782"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2460"
FT                   /db_xref="GeneID:3374074"
FT                   /locus_tag="cgd3_2460"
FT                   /transcript_id="XM_001388076.1"
FT                   /product="UbiA prenyltransferase family member (3I27) ,
FT                   putative"
FT   CDS_pept        639250..639606
FT                   /locus_tag="cgd3_2460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UbiA prenyltransferase family member (3I27) ,
FT                   putative"
FT                   /db_xref="GI:126644783"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2460"
FT                   /db_xref="GeneID:3374074"
FT                   /translation="MNTIRPNYGFINSSFSKTCIQSVFRTSRGICKMNFKHYIKLYRIN
FT                   NPTGFWLLFIPTFGSLTLASNSLLPKANITALFALGSVASRSAGCVINDLADRQFDSKV
FT                   VFHTFFIHYHLLSG"
FT                   /protein_id="XP_001388113.1"
FT   gene            <640637..>641281
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2470"
FT                   /db_xref="GeneID:3373913"
FT                   /locus_tag="cgd3_2470"
FT   mRNA            <640637..>641281
FT                   /db_xref="GI:66359259"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2470"
FT                   /db_xref="GeneID:3373913"
FT                   /locus_tag="cgd3_2470"
FT                   /transcript_id="XM_626808.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        640637..641281
FT                   /locus_tag="cgd3_2470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359260"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2470"
FT                   /db_xref="GeneID:3373913"
FT                   /translation="MTLTNNVPVVDNWEDLLNSDNEDSFNNNSEFQTNSNNITSTSISN
FT                   KCFNDYEEQRRCQELVEEMDGNVMDDLFDGFVSQRKSTSKLPGNNSTHAISNLSNQQDA
FT                   FSNLNLNSYGKVETTAFKIAECIKPALAKSPAWLRFIDICLNEIFQKLDLKDLKTLKKK
FT                   VDLQLSIREKEEREKSQQKKKPNDFSTLSKNFREELDIFDGIDSLDESDDY"
FT                   /protein_id="XP_626808.1"
FT   gene            <641392..>642816
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2480"
FT                   /db_xref="GeneID:3373911"
FT                   /locus_tag="cgd3_2480"
FT   mRNA            <641392..>642816
FT                   /db_xref="GI:66359261"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2480"
FT                   /db_xref="GeneID:3373911"
FT                   /locus_tag="cgd3_2480"
FT                   /transcript_id="XM_626809.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        641392..642816
FT                   /locus_tag="cgd3_2480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359262"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2480"
FT                   /db_xref="GeneID:3373911"
FT                   /translation="MSQDLICRKIAHLKVDAEASIRNSSSRIERILNDGLPIFSDEVGS
FT                   FSSNAEKFYISTSNREMENTTIGAKNYLNNAKWDLVNKYYINVLKNLDSLTNIIFCIQK
FT                   NYFDNIQYINISQSYNMASSIDNITTRSLRINEASKGELLISLYRRLYILRPFIEKINN
FT                   EILRIPDHIITHKCALSTLNELLPIWKISINSQAKNESQCLYNRENKLSSVICLQLPLE
FT                   NVFFKQGSFVSRPMAQIDNNCLFNDVLVTLTFSKNKFNPYGGKYNLRASLKLPEFTSYL
FT                   INNNYQLYVKTKPSDSESKNVTSSTLPQVDFPSCIKSALAKQIHSTLHRVHWALIDRLI
FT                   FHTIVQQVVNAQKDSPEAIYINELSSERVIFSINEANPSISSHDNSSLEVKNISVSYKP
FT                   ISVENFFLSNDELNALKLLRESFLEIWRNSIKLSTDNLLENQMCVIKLSKYSNKLLERW
FT                   IHKLAKKCINISATSL"
FT                   /protein_id="XP_626809.1"
FT   gene            <642934..>644100
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2490"
FT                   /db_xref="GeneID:3373909"
FT                   /locus_tag="cgd3_2490"
FT   mRNA            <642934..>644100
FT                   /db_xref="GI:66359263"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2490"
FT                   /db_xref="GeneID:3373909"
FT                   /locus_tag="cgd3_2490"
FT                   /transcript_id="XM_626810.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        642934..644100
FT                   /locus_tag="cgd3_2490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359264"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2490"
FT                   /db_xref="GeneID:3373909"
FT                   /translation="MKSFFRKSLNPIHNTKSEASQQIKSSLVAINYLSINIDLSSIIFS
FT                   SGYTPSRLDILNKGFLLLYYTDPYTATMAAWFFEIQGIPAATISGWSLIRICGPITLDE
FT                   VTEIISFKPFAITFFNYKVKYSWIAVHGIHTKQLLLKYIKNQNWNIVEALHNRNFQDVV
FT                   EVLEIFNNEEVPNCYNKLEYMFVSLLEKKSYNIDNPDQYRLHQKLVLLSRCSRLTNEIY
FT                   LNGVYMKNTHESYQSPIKRDLLLAIRKYLYSIPIFTEACISKSSLKSLKTEEWCLGLDE
FT                   KHIYRRENGCFNDCIETNSNYKAQSNHSVSRNKLLERMLRVILIELITHFRVKYNNSKY
FT                   PNITEVSELWKIRFGIEVDIIQLFKMAGLYEEIKNIVEATKEIKITRD"
FT                   /protein_id="XP_626810.1"
FT   gene            <644295..>645629
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2500"
FT                   /db_xref="GeneID:3373910"
FT                   /locus_tag="cgd3_2500"
FT   mRNA            <644295..>645629
FT                   /db_xref="GI:66359265"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2500"
FT                   /db_xref="GeneID:3373910"
FT                   /locus_tag="cgd3_2500"
FT                   /transcript_id="XM_626811.1"
FT                   /product="hypothetical protein with transmembrane region
FT                   near N-terminus"
FT   CDS_pept        644295..645629
FT                   /locus_tag="cgd3_2500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with transmembrane region
FT                   near N-terminus"
FT                   /db_xref="GI:66359266"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2500"
FT                   /db_xref="GeneID:3373910"
FT                   /translation="MFFDKRILALLMNPFRRNIKRNSFNINTFNRKCFDLFRNKDSFRF
FT                   NYTIFSISISFAFLAKYYFQNTRKQLNMKAISSDEIEILSSKSKNMIVLNLIKGMEINK
FT                   SNFIKELSKQIKSKELNRLNIQIYYTENNCSESAPNVTLFKGYGSRISNIDLNFKNNNI
FT                   EQIKSFFDPKSEKIINGNPSTIKNISHDTFESDVINKSDENNPLLLMYYDDYCLMCFLI
FT                   RPLINSLAARLRNTKNIQFGRYNIGRNDLHEFSPPVKATPSFVLFRGRQEPERLDEYKP
FT                   KDIINKIIEIKCRVENNDCGKKELAELSTLEQKVLIRFHLFTVLNIWNLYLKELQAKLI
FT                   NTPKSQFDQLNFMHLEELLSISCLFLQDQNVSSKNSKSFDEINFEKISYDKIAENINFQ
FT                   EIFLENIKKDMKRSDTIEENINHLLNEIEGCCNDYIAMKKLIKNS"
FT                   /protein_id="XP_626811.1"
FT   gene            <646339..>646411
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2505"
FT                   /db_xref="GeneID:3373951"
FT                   /locus_tag="cgd3_2505"
FT   tRNA            646339..646411
FT                   /note="codon recognized: CGA"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2505"
FT                   /db_xref="GeneID:3373951"
FT                   /locus_tag="cgd3_2505"
FT                   /product="tRNA-Arg"
FT   gene            complement(<646437..>647762)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2510"
FT                   /db_xref="GeneID:3373779"
FT                   /locus_tag="cgd3_2510"
FT   mRNA            complement(<646437..>647762)
FT                   /db_xref="GI:66359267"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2510"
FT                   /db_xref="GeneID:3373779"
FT                   /locus_tag="cgd3_2510"
FT                   /transcript_id="XM_626812.1"
FT                   /product="myb domain-containing protein"
FT   CDS_pept        complement(646437..>647762)
FT                   /locus_tag="cgd3_2510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="myb domain-containing protein"
FT                   /db_xref="GI:66359268"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2510"
FT                   /db_xref="GeneID:3373779"
FT                   /translation="QKISVKTNMASNIFQTRSWNDHLNNRNILKGKFSSSERDIINNSV
FT                   KDYIKSQQWNWDEGLDNLFSTRGGKKDRHWPIIGESLPNRSLQSIYYCAKRMLMRGKKG
FT                   KWTKEEEQELIKLVNEHGKKWSMFVEFIGRSAASIRDKWRDLHTKIVENDSNDSGYILN
FT                   LNSQIEKPLKSKMPFVIDVFVLYCIERYTGKFLPFKGISWKTIIESLCSPNFPTEFIYF
FT                   WKKCCRKINEKLGINLQPIDGTDLSNFYGKISQGQIRLRYVSSLYPKLKYIQDEQALSL
FT                   ISNTFSQAVNYLYETRYNYSHIDEIKYNDWPKLLSAHIPLTTLWSRIRLALTRITKKNM
FT                   HISDRISILYERLKNKLLKCQVLDSIDSTESRFLFEDDEDYANENMDGCPYFHVDTKRL
FT                   RKTVVELLKTQSKREKKSKNAARLQKEYSSLQQVFQSGNYIT"
FT                   /protein_id="XP_626812.1"
FT   gene            <647837..>649558
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2520"
FT                   /db_xref="GeneID:3373908"
FT                   /locus_tag="cgd3_2520"
FT   mRNA            <647837..>649558
FT                   /db_xref="GI:66359269"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2520"
FT                   /db_xref="GeneID:3373908"
FT                   /locus_tag="cgd3_2520"
FT                   /transcript_id="XM_626813.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        647837..649558
FT                   /locus_tag="cgd3_2520"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with 4 TPR domains, similar to cdc proteins"
FT                   /db_xref="GI:66359270"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2520"
FT                   /db_xref="GeneID:3373908"
FT                   /translation="MNKVLRSDNLIETSSQNSSKHSFSLQLSDYFRLLIDRSIEIRNWR
FT                   RGEKYCTVLQLIKPLEICDTLRWCECLFNLADYSAVIRISQNTLIENVNGYCPDKIKIF
FT                   IFRSKSEFFMGKYSNSIETSNLILETIKHGLNIEPDVKKKLLLKQLRVRVLLIKARIFE
FT                   LNNMFDECDKIYTGILLEDDPMNIVSLEMVFCSHKFTLNEKIEIFKKWKDFIPKSYYWI
FT                   LIIVWYRIMHDYSRMIDCYNGDLEEDLISFSLDSKISLNKLLMNIPVYSKKMVFLKDKI
FT                   FSLANLSNNNSLKTQIFDVSSHLDCETHIIMQMISAIYDSGYILTISNILDEKIPSSPL
FT                   SIFTMGCYYYKQSAYSKSAHLFRKVIEIEPGFYEAHLLLAHSLSLNNNSKQAIIVYSHI
FT                   QDQWRGSCYGTLYKGVEYLKSNNYDMAALNLRSSLTQFSDNPIILNEFGVLQFYQKKFY
FT                   ESEETFRKALHKLHINKSNHLKYVLEINMSCSIIWSILYCEEIVCKSRVVEAISILERC
FT                   SKINNSANKVYLVSFLLAVAYQISGEKNKANLKYLECVSLGIFHPITLKSLHTICS"
FT                   /protein_id="XP_626813.1"
FT   gene            <649635..>650474
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2530"
FT                   /db_xref="GeneID:3373907"
FT                   /locus_tag="cgd3_2530"
FT   mRNA            <649635..>650474
FT                   /db_xref="GI:66359271"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2530"
FT                   /db_xref="GeneID:3373907"
FT                   /locus_tag="cgd3_2530"
FT                   /transcript_id="XM_626814.1"
FT                   /product="PUP1/proteasome subunit beta type 7, NTN
FT                   hydrolase fold"
FT   CDS_pept        649635..650474
FT                   /locus_tag="cgd3_2530"
FT                   /gene_family="HOG000182856" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PUP1/proteasome subunit beta type 7, NTN
FT                   hydrolase fold"
FT                   /db_xref="GI:66359272"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2530"
FT                   /db_xref="GeneID:3373907"
FT                   /translation="MNAYLNAYFSEKSTNGFLFENNIATAPCLSDSTELKTVKTGTTIV
FT                   GVACNDCVVLGADTRATNGPIVADKDCEKIHRLSDNIFAAGAGTAADLDHVTSLIEGNL
FT                   ELQKLQMNRKPRVAHAVSMLSDHLYKYQGYIGAHLIVAGSDSTGNFVFQVSANGCIMQL
FT                   PFTSMGSGSLCARSILEARYRDGLTESECVELVSDAIRAGIYNDLYSGSNVNILIIKNN
FT                   YVKHFRHFDTKASERIYRQPKPISFPVGTTPIIAEKTEDLSSFVVEVSEVQIDENMD"
FT                   /protein_id="XP_626814.1"
FT   gene            complement(<650605..>651012)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2540"
FT                   /db_xref="GeneID:3373906"
FT                   /locus_tag="cgd3_2540"
FT   mRNA            complement(<650605..>651012)
FT                   /db_xref="GI:66359273"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2540"
FT                   /db_xref="GeneID:3373906"
FT                   /locus_tag="cgd3_2540"
FT                   /transcript_id="XM_626815.1"
FT                   /product="histone H3"
FT   CDS_pept        complement(650605..651012)
FT                   /locus_tag="cgd3_2540"
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H3"
FT                   /db_xref="GI:66359274"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2540"
FT                   /db_xref="GeneID:3373906"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKGARKSAPVTGGVKKPRRYRPG
FT                   TVALREIRRFQRSTELLIRKLPFQRLVREIAQDFKTDLRFQSQAVMALQEAAEAYLVGL
FT                   FEDTNLCAIHAHRVTIMPKDIQLARRIRGER"
FT                   /protein_id="XP_626815.1"
FT   gene            <651620..>652231
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2550"
FT                   /db_xref="GeneID:3373778"
FT                   /locus_tag="cgd3_2550"
FT   mRNA            <651620..>652231
FT                   /db_xref="GI:66359275"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2550"
FT                   /db_xref="GeneID:3373778"
FT                   /locus_tag="cgd3_2550"
FT                   /transcript_id="XM_626816.1"
FT                   /product="hypothetical protein with carboxy terminus motif
FT                   shared with DNA-directed RNA polymerase subunit and TFIIS"
FT   CDS_pept        <651620..652231
FT                   /locus_tag="cgd3_2550"
FT                   /gene_family="HOG000135494" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with carboxy terminus motif
FT                   shared with DNA-directed RNA polymerase subunit and TFIIS"
FT                   /db_xref="GI:66359276"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2550"
FT                   /db_xref="GeneID:3373778"
FT                   /translation="IDVDINTTKQRNSNFPKFQFSFSKGDNFNSQLYGGCPSCGNSYDF
FT                   LFLLDAFENEYTSSSHNLIENHYLRCKICNYRFLKLHNHNSSDSTINTNSNSFEKKRIY
FT                   ITGIRKSLCFGTNNKWWAKSISVGKRIEKESDNKSGKSNSVIRVLDAMHKKKAPKIQEI
FT                   CPECSHNEAFFTQFQARSADEGTTVMYECCKCQHRRVINN"
FT                   /protein_id="XP_626816.1"
FT   gene            <652326..>653435
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2560"
FT                   /db_xref="GeneID:3373905"
FT                   /locus_tag="cgd3_2560"
FT   mRNA            <652326..>653435
FT                   /db_xref="GI:66359277"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2560"
FT                   /db_xref="GeneID:3373905"
FT                   /locus_tag="cgd3_2560"
FT                   /transcript_id="XM_626817.1"
FT                   /product="TBC1 domain containing protein"
FT   CDS_pept        652326..653435
FT                   /locus_tag="cgd3_2560"
FT                   /gene_family="HOG000162526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TBC1 domain containing protein"
FT                   /db_xref="GI:66359278"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2560"
FT                   /db_xref="GeneID:3373905"
FT                   /translation="MSLDVLINSTEPTKEGRFLSVLEQECIDIKLLQDLLWSGVPRGSP
FT                   PELRRDAWQIMLGYLPPRKDRKNSYKLKKINEYRLLLKEHIEHDNYSEQEKKILRQIRV
FT                   DLPRTSIEYESLKNRIILDLMERVLFLWAIRNPASGYVQGINDLLPPFLVVFLLPFSPE
FT                   GDIELLDINKISSERMFEIEVEIYWCLTRMLDTLQENYVTEQPGIHKLIVHLQDIIKRT
FT                   NKPLFQHLKEQGVDFLQFSFRWMNCLLTREFPTKCVVRLWDTYIAENTLNKTNKPLRSS
FT                   SITSLDQIPTGNNVISHFNAFHVYVCAAFLLHWEKKLRNMEFSEIMLFLQNSPTKNWTE
FT                   RDIDSLLAQAFVLQSLFHFSPRHLIDYSN"
FT                   /protein_id="XP_626817.1"
FT   gene            <653435..>654574
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2570"
FT                   /db_xref="GeneID:3373904"
FT                   /locus_tag="cgd3_2570"
FT   mRNA            <653435..>654574
FT                   /db_xref="GI:66359279"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2570"
FT                   /db_xref="GeneID:3373904"
FT                   /locus_tag="cgd3_2570"
FT                   /transcript_id="XM_626818.1"
FT                   /product="conserved protein"
FT   CDS_pept        653435..654574
FT                   /locus_tag="cgd3_2570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved protein"
FT                   /db_xref="GI:66359280"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2570"
FT                   /db_xref="GeneID:3373904"
FT                   /translation="MRYRKKKQKKMNRLKNAIFTLQSKKTVISICKHIGLFKDLALQVD
FT                   LVKNILNCEILKKYPLPLIYQRNLICEIVKIIESAGDEVSDELYMHLSQLMGSCHSNLV
FT                   SHIIITFPNNQTDICLNSSNLVNSGNFVFGFEECNLVGMRPWSAGYRLVEWLIHSVNLG
FT                   RNVANSDLIELGSGIGISSIIPYSVLPIKSICSTDHDPKIINNLRYNFEINGILLNSEF
FT                   EEHAKSNSNKKYARVMCLDWETININIAKEILKPLKNPIIISSDVIYDNDLTLLFVRTL
FT                   RFFLSSCHEKKFGSYHKKCISKDPKNKSVKWDELQEADFGSMSTYAISVNTVRNQHTIQ
FT                   YFVDCCIENGLTISRDSKVIPMIFNIELDTPTVIFIISY"
FT                   /protein_id="XP_626818.1"
FT   gene            complement(<654831..>656015)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2580"
FT                   /db_xref="GeneID:3373974"
FT                   /locus_tag="cgd3_2580"
FT   mRNA            complement(<654831..>656015)
FT                   /db_xref="GI:66359281"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2580"
FT                   /db_xref="GeneID:3373974"
FT                   /locus_tag="cgd3_2580"
FT                   /transcript_id="XM_626819.1"
FT                   /product="RNA binding protein"
FT   CDS_pept        complement(654831..656015)
FT                   /locus_tag="cgd3_2580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA binding protein"
FT                   /db_xref="GI:66359282"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2580"
FT                   /db_xref="GeneID:3373974"
FT                   /translation="MFHLSRFWGKTTQHVSMFRSDPYSQSIASNNDNRLFLNSNHQNYS
FT                   IQYQGASKNPCQHVITTDLDDPITETYISRTLYLCKLPYDMTEDSVRELCEPFGDLKKV
FT                   AVYPRKGIAFVEYFDIRKAEGARNTLKSSLVQGRIIDAQYSRGRDGRPSRDTNTGTLYI
FT                   KPIVSNKTATDPNTEDDYKELFCAYGEVKKVSSNRKRESEKFVEFYDIRGAEASQKALN
FT                   GYDFNGVILEIQFANTHSRTLNSDSRATASSRNSGVCNKSLRISSEERYKQQSSLNTKK
FT                   KYKPIKCGTSRVLKRLVARDASHCELYSEFSKRNVNRNDLRVHPDFRLLYQSSAPFQET
FT                   NNLGEFGKFPIITQRPSDDSTRTGNIAESLKTLLSTFKHQKYDIECNNSKNNAY"
FT                   /protein_id="XP_626819.1"
FT   gene            complement(<656068..>657699)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2590"
FT                   /db_xref="GeneID:3374073"
FT                   /locus_tag="cgd3_2590"
FT   mRNA            complement(<656068..>657699)
FT                   /db_xref="GI:126644784"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2590"
FT                   /db_xref="GeneID:3374073"
FT                   /locus_tag="cgd3_2590"
FT                   /transcript_id="XM_001388077.1"
FT                   /product="kinesin-related protein K2"
FT   CDS_pept        complement(656068..657699)
FT                   /locus_tag="cgd3_2590"
FT                   /gene_family="HOG000116164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin-related protein K2"
FT                   /db_xref="GI:126644785"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2590"
FT                   /db_xref="GeneID:3374073"
FT                   /translation="MKRENTQIRYNKSRQGDINIFFQEKINDLESKQAELSDLLIRRQN
FT                   DADHLILINKEKSNTINSIKKKLSVMVEDHKSYTNEMNELKKNLKEMLDNKKDQLLRIE
FT                   TKLGKLKQLHDEATNENNELKETFSEKSIIKRDLENKLEVLNETIKKKYWANTARLSLA
FT                   QQLELANQEILSWKYRLQRHSILLNDTRRKLFNELQDIRGNIRVFCRVRPPTISEQDFC
FT                   IKYDISEDASTITINNTTTRGTNLLTFKFDYIFSSVSTQHEVFEEVSQLIQSALDGYNV
FT                   SLFSYGQTGSGKTFTMLGGKDVNEYGMIPRALKLIFDNIDRNCEKGWTYNLEYSAIEVY
FT                   NETIRDLTTPKQKNSEVKIDQFGSATIVGINLIKVNNINDVNNLLKMAHKHRSEASTDC
FT                   NERSSRSHSIIQLKISGKHCQDADESNPDSRNISSTLSLIDLAGSERVNKSGVAGERMK
FT                   EAQFINKSLSALGDVIQSINQGKDHIPFRNSKLTMVLKNSLGGNSKAAMLVHISPSSHS
FT                   INETISSLRFASKVQNCVTNRNREKN"
FT                   /protein_id="XP_001388114.1"
FT   gene            <657918..>661523
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2600"
FT                   /db_xref="GeneID:3373973"
FT                   /locus_tag="cgd3_2600"
FT   mRNA            <657918..>661523
FT                   /db_xref="GI:66359283"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2600"
FT                   /db_xref="GeneID:3373973"
FT                   /locus_tag="cgd3_2600"
FT                   /transcript_id="XM_626820.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        657918..661523
FT                   /locus_tag="cgd3_2600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359284"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2600"
FT                   /db_xref="GeneID:3373973"
FT                   /translation="MSNNTFEEVPIRGTIKLLHDKLSLLFRLSILESTEILLEIDESIS
FT                   KCDGYCISSCAEVIVPPIIMAIHNCIRNKLHPTNELSGSNHNKNLNTKSSLQLEELLKI
FT                   LLNVLQKMNSKTSKIIFSRISNAFFDILYVITEVLRIFIYERNEFIIEYSIKIAHLDFN
FT                   IFWEYWEHKNTNTNINQHLIIPVIIQFLLSIAIPSKNEFNYSKETQTLALKLLSEIPGI
FT                   IENNDLLIKVYPGVIQRLSIQLINSIEKGSSKKLIELSLFAIIEWISNCLSNLNHETKN
FT                   ICSNMENIKNTAKILNYIIKYKTLELNLDCSYKSGNINYLNDSVCMLKVKSLFASITRM
FT                   CFTDLFDIFYDSFDELLITSLDFLISLKSEGNYNNPLIDNVLNSISKNQSNRKMRSFFS
FT                   NYSRKFGINFDQSNTEKFTSVELNEENNLTDFIRKLTLYIGFHKTENQFFKHIISTFCA
FT                   EKAFNFFLIILISNLNLTMYEKSIKDSKKNFSFNFKNRSLNKENYILKAIDLTERTSNN
FT                   IFQNYSYNIPNKNESIISNDKLEAFQLYGDLFTLTFFNIKRFGFEKSKMISSLFIKSIS
FT                   ISILDLNYEKMECKYILQCITQHFVKLCNSERDKHIPLQHFILYILVCNATQLILNQSV
FT                   FGNPLYNELPNFETKNLPNIIISWFNFAIEELSIELIQESMSNYTEINRNILLILLGNL
FT                   LLIARNIGLDGEIFIKKLNKVITQLISLYGYGSPITKKIAAYILNQIFLMLGYSSYKFS
FT                   INTIINEYSLEIIRSLEIMYYKGYSEEKVDLILTALQHCKLGFILELSDLIEKFNDINI
FT                   NNNPWIFEFIAIITKRIANCILTYWDNFSFHKIFKNAQISAFKQKLESFQTLNTTIKEI
FT                   YYEYFLDYITSQENDIPNFYPTQNFINSIKSQNIDHLDLFEQELLEEIDISNEISKIRK
FT                   VIERMINIIYSYTSESDEKNFSIQDHRYLSTYSLLNCIFILSTETTCLFPYANMIIPGI
FT                   INQWMAIISNIRSDNFEKSKIEAIKSRELCQTNIIVIQLIISCTEFAIKVLEDKLIPLI
FT                   TEFIEFIFSSHEAITLMDDRESELNSEFQKMCISTLEVLYYFTKFYLKLNSAEIKFETL
FT                   NNIVNLLISPINSFLSVKWRIVVSKTIFHIYFKFPCIINSKLIVQSKNYNTTCLKEIVI
FT                   MIKLAENNLTAIFNNISIISETRGEFNLKLKINKF"
FT                   /protein_id="XP_626820.1"
FT   gene            <661604..>662179
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2610"
FT                   /db_xref="GeneID:3373972"
FT                   /locus_tag="cgd3_2610"
FT   mRNA            <661604..>662179
FT                   /db_xref="GI:66359285"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2610"
FT                   /db_xref="GeneID:3373972"
FT                   /locus_tag="cgd3_2610"
FT                   /transcript_id="XM_626821.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        661604..662179
FT                   /locus_tag="cgd3_2610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359286"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2610"
FT                   /db_xref="GeneID:3373972"
FT                   /translation="MDANNIVPENIKHIQQQSLNPTTTLNKKLIFSSNERNNLWDLFSS
FT                   NFLLFKFYPSGNEIEEELKSIHEMIKVFENWKSLISTKKMSLFDFCKTIEKFTFHTETQ
FT                   DYRLRTVFNYKSIKSGMHSNMSNYEFRPISSKEHTDQRNIVGDQNDDSKSINSNQNLDT
FT                   SCGIEEKLKAKRELALKRRKLLLTNKVL"
FT                   /protein_id="XP_626821.1"
FT   gene            <662428..>668136
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2620"
FT                   /db_xref="GeneID:3373777"
FT                   /locus_tag="cgd3_2620"
FT   mRNA            <662428..>668136
FT                   /db_xref="GI:66359287"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2620"
FT                   /db_xref="GeneID:3373777"
FT                   /locus_tag="cgd3_2620"
FT                   /transcript_id="XM_626822.1"
FT                   /product="putative DNA-directed RNA polymerase,possible RNA
FT                   polymerase A/beta'/A'' subunit, long PHYSPTS repeat at
FT                   C-terminus"
FT   CDS_pept        <662428..668136
FT                   /locus_tag="cgd3_2620"
FT                   /gene_family="HOG000222975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA-directed RNA polymerase,possible RNA
FT                   polymerase A/beta'/A'' subunit, long PHYSPTS repeat at
FT                   C-terminus"
FT                   /db_xref="GI:66359288"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2620"
FT                   /db_xref="GeneID:3373777"
FT                   /translation="RRIIQEIMSTALELNSPFSSKELKRVFSIEFGVLSPELIRKYSVL
FT                   EIKVSDIYENGRPKSGGLNDPLLGTTDYHILCETCHMDIKTCPGHFAHIELGKPMFHIG
FT                   FITTVLKLLRCVCYACSKLFVDTLDPKFKQIKRIKNPRLRLKKILEMRSSSSRCIISSD
FT                   GSGCGFVQPTYSKEGYNLYINQNQDENRIIDDESVDSKRLLAAEEVLTIFKRISHDDMK
FT                   ILGFDPVKCNPSWFINTVIPIPPPAVRPYVQFGSDRSEDDLTLKLQQIIKLNENLKKQI
FT                   RIGSPEHIISEMSTVLQYHLITLINNDLPGLPQSRTRSNRPIKSLRARLKGKDGRIRGN
FT                   LMGKRVDFSARTVITGDPNLAVDQVGVPYSIAMTLTYPEVVTPYNIEELKELVQRGPHE
FT                   WPGATSIIQEDGTKVDLRFSNTSNNSNNILQYGWKVERHMKNDDLVLFNRQPSLHKMSI
FT                   MGHRVKILPYSTFRLNLSVTSPYNADFDGDEMNLHLAQSHETRSEIKNLMMVPRQIVSP
FT                   QGNKPVIGIVQDSLLGIFLLTRKSTFLTRDKFLQLLLCIPYWNGNIPPPAILRPQPLWT
FT                   GKQIITVLLAFTTDLGEPIELNLMRDGSIVSIKQSNNSSNTDKDDSKEAIVNNPWISEL
FT                   DNQVIIQKGEHICGVLTKKIAGSSSGSLIHILWNEIGPEKTGLFLTYTQMVVNTWLLEH
FT                   GFTVGCQDIQPQNYTLEKIMNSLEGSKLQVQQIIRRAQKGKLDCQPGKSLIESFEAQVN
FT                   QELNSARELSGTIATENLDSSKNNIVAMVQCGSKGSTINISQIMACVGQQNVEGKRIPF
FT                   GFRDRSLPHFLKYDYGPESRGFVSNSYLSGLTPQEVFFHAMGGREGIIDTACKTSETGY
FT                   IQRRLIKAMEDCMVQYDRTVRNSNGDIIQFLYGEDGMAGEFIEDQVIELLQMEAAVFQH
FT                   KYRHNLEHPRWGSSWAGVQPSLIKNLQFDLESQNILNSEYKQLVTDREQLGKDIFPDGE
FT                   TRQHLPININRIIQMAQQKFPQRVSDTSSSKDWGPVYIIKKVESLLDKLLLWKNVGIIN
FT                   DEGNKSNFVFDSIIAEVQKNATTLLGIHIRSSLASKKILEVDRLGPTAFEWILGEIEHQ
FT                   FYRSLAHSGEMVGTIAAQSIGEPATQMTLNTFHFAGVGSKNVTLGVPRLRELINVAKNV
FT                   RTPTLTVYLESGIANDQEQAKDVLTLLEHTMLQNITTIAHILYDPEQDKTIVEADKSWV
FT                   SDYYEFPDDADITSRLGTWLLRIQLNNKLVTDKKLSMKEIGDKILMEFSKDELDCIWTD
FT                   DNSDELVLRLRIKNIEPTNNIRDNIHSSEENDSISPSITSGVEEHKFLEKLMTECLSQI
FT                   TLRGINNIKKVYMKEEQVSRYDSVSQKMVRDNQWVLDTDGCNLEAVLCHTAIDSTRTIS
FT                   NDITEVFSVLGIEAVRRALLRELRTVISFDGSYVNYRHLALLCDNMTQKGHLMSITRHG
FT                   INRVDKGPLQKCSFEETVEVLMDAAMFGETDYLNGVSENVMLGQLAPYGTACFDVLIDP
FT                   DKLRDTATHLEIHGEFAKLGKFSTLSQTTRSYSDSGAFESDSFESPMSPLSPMSPLYQS
FT                   YEPMSPMISGQFSPVQMTPRSPMSPVSPGGIFSPVPYSPMSPSSPLMDYTPTSPIYAAS
FT                   SPTYNTEVSERARKKYKVNNTLSSYSPSSPLNSDNKISNISPDLSPTSPHYSPTSPHYS
FT                   PTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTS
FT                   PHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPSSPHYSPTSPQYSPTSPNY
FT                   NPASPNYSPTSHYSPTSPNYNPTSPNYSPSSPNYISNNSGSPGYSPSSPQYDPIAVASV
FT                   PRSPSYSVGKMVDAEYSPSSPLDETKNS"
FT                   /protein_id="XP_626822.1"
FT   gene            complement(<668174..>670933)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2630"
FT                   /db_xref="GeneID:3373969"
FT                   /locus_tag="cgd3_2630"
FT   mRNA            complement(<668174..>670933)
FT                   /db_xref="GI:66359289"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2630"
FT                   /db_xref="GeneID:3373969"
FT                   /locus_tag="cgd3_2630"
FT                   /transcript_id="XM_626823.1"
FT                   /product="diacylglycerol kinase"
FT   CDS_pept        complement(668174..670933)
FT                   /locus_tag="cgd3_2630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="GI:66359290"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2630"
FT                   /db_xref="GeneID:3373969"
FT                   /translation="MIAYSKYETYFSLVIEIINKFIPFREASNVIKIALNIIKRHISAL
FT                   KAGHWYFLIFTTLIASIVTIAILYYLQKNNSNNSILRHIKLRHNWVLYETPEYPKYCTK
FT                   CSGIIKKRFLLMRNYEGWQCLICKRISHMHCIMQSDSEYCKDECSSNYFIKSGSLIQFK
FT                   NKTFLNNDESNNLDGLIPQQKIHCHVLMKGNLHSGAICSICLTVCFSPFGLYGQKCIWC
FT                   NRTYHDECAENNKITQKQCDFGTLKYIILPPNSFVFELHSLEKSGNSTLSTNFSTLKNE
FT                   EKNIFNPNSLINVSANNLDTNPTDVIKTNLTSSPSKRSISHYIQMFHKSNLIKKKLKFF
FT                   DDFLYTNSGKPLLVFVNTKSGGHLGQGLIKNLHIYLNPIQVVDIQSSKGPDEALYLFKH
FT                   LAKMKKLMILICGGDGTVRWVIDRCREIYGVNSNSLPPIAVLPLGTGNDLSRTLGWDVT
FT                   FNGDILNFLKRICTSNIKQMDIWKCTAWDLKNGDSNNTHDNHNMLFSSTFINYLDIGIA
FT                   ARIALKFHNLREAYPQHFKSRLGNQLVYGEVGFRDFFNKSIQLDGLKILCDGKEVSISN
FT                   QVGGSFSSKSEESINLLGNRSINDDYFQGYHHLMNIYNFIIKKYINWFLIPAADIFGLG
FT                   NSIKNKVNNKSITEIHNNFNSRENRLEGLIICNIPSFSGGVNLWKISNQFFKKPRKNRD
FT                   TNTIRRTTTLTSRKMGKGLSDRSMSFSIDNFKNSGYLSCSNSEFSECDETDNTRLELRE
FT                   GRKRSTNLLKSWFSKAFKQGLSLSPKLNNLEINDEPTKFGINKFQLQKIDDGLIEVVGI
FT                   RSLFHLTQLQVGLTEPIKLCQGSHIVVYIPRQLPFQVDGEPRIINKCKLIIEQSGKIPV
FT                   ICSEKIENTVSLSVQNALEQAVQKKIINTSQRAWITEHIIQENKLLIS"
FT                   /protein_id="XP_626823.1"
FT   gene            <671334..>672644
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2640"
FT                   /db_xref="GeneID:3373970"
FT                   /locus_tag="cgd3_2640"
FT   mRNA            <671334..>672644
FT                   /db_xref="GI:66359291"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2640"
FT                   /db_xref="GeneID:3373970"
FT                   /locus_tag="cgd3_2640"
FT                   /transcript_id="XM_626824.1"
FT                   /product="hypothetical protein with conserved domain"
FT   CDS_pept        671334..672644
FT                   /locus_tag="cgd3_2640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with conserved domain"
FT                   /db_xref="GI:66359292"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2640"
FT                   /db_xref="GeneID:3373970"
FT                   /translation="MKYLYSSDNFGTIKEYKTTKFLNSDCSFIDSIVEYSNESMKKITY
FT                   IYAEKKLNSNEESQPKDDMFIGYSDGTINVISIPLKSQSDIPKITFLVNGKVIFIKDIT
FT                   FNYPNESEKGNKVIIVVTESRKLYLFRLPQINKENPYFQSTINFNVCNENACLTNPDLI
FT                   IETFDLPCNDLKCVAYNKTKNSIAFGGYESDIKMMNLESMKLTWSSKNIQLKMLKNRMP
FT                   IDVTKLAFLQENPEILLCGTGYGEVRLYAPQLQRRPIINYEIWEEKSSITELEIIKNWA
FT                   KLKSNRNSYGSVVAIGNNKGSVLLLKITDTQVDIYKRSSFRSESRDSALNKKKILPLIR
FT                   EYVSFKISTDKFKKNKLNNIKSNHKIEISALGNFKGIMGGITTMNSFKLSDKEHKESIF
FT                   LAIGGPGRYIYIFEVKKRRLVRKIFTSQKIAFIKILE"
FT                   /protein_id="XP_626824.1"
FT   gene            complement(<672674..>678037)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2650"
FT                   /db_xref="GeneID:3373971"
FT                   /locus_tag="cgd3_2650"
FT   mRNA            complement(<672674..>678037)
FT                   /db_xref="GI:66359293"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2650"
FT                   /db_xref="GeneID:3373971"
FT                   /locus_tag="cgd3_2650"
FT                   /transcript_id="XM_626825.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(672674..678037)
FT                   /locus_tag="cgd3_2650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359294"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2650"
FT                   /db_xref="GeneID:3373971"
FT                   /translation="MLEVALIAAAECRIDDLTLLFNDPELRIYWKLILNSIPETLHIDQ
FT                   YKHIIPKPTNVQIGDSYEDNHLFSNEQNTFHDSIESISQWSIERCFHIVKNTLNISDFA
FT                   LPFLTFIIEHLGFEIADQSILLNNLQEKHLIFHFDSIIVLYSFYSILEQYCIAFERNIK
FT                   FCKKILDPIKFIINSPINRFKLVIEQFSDSSYSELSKLFSSLFGSYYCISYLNSLYDKQ
FT                   LNKDGFESTKILRCQPLVQKYCYSGYFQQFYYKDANFIYKCENNLTSSLYSNAHVPLEE
FT                   SVINYLFDEKDNITIDLFCKISKILVKNSKLTNNLTNRFIACPIRVIQFILLCINGRDS
FT                   PLLNVNALEIQEYIDEVYECTPKSSIIIKYLKKDLTIQKLNSSILKIDNSLIPSDYICC
FT                   PFCKNVSVLYQGPQSIQSFRNWLNNIFFSIESIEKHQLFIDLYREIPISVIHEITIYDI
FT                   FKVLYNPINAECFLINLISKLPRFYTTDLLNTVISIYNLITDSIRLPNYPLGSLLGLIF
FT                   YLLEKLLIVENLNIEISTGDIVKQIKQYITSTNECEFMDLFLQLFNRIYEYLEPPLYNF
FT                   TIFINKLNKEIVLNNETMDFKFKLICEHIFISNIINELVKYSPNETEIYPIFRACSKIE
FT                   FEKLCPNLCNNFEFSYYHPNSIIFENNKEKILMDIFLSNPSLAIINKHSLILDKLKFII
FT                   KKFVCINEDHLIWKSIIKLQITTLIIYGSQNLAIEILFNSVSNKEYIDEETIKISFYLI
FT                   KNSKFLNGISTENSSLLNIIEKTLLSNSPLHFLSFLLNYKSTPIYDKNIIFNEEKIQSN
FT                   LEKCFSSSYYYTVKDSNYENTIFDLFFNNQFIKSDLRYPDLVFNNFNKYDLLIYCSADL
FT                   LFNNGYKSKLIINSANVNQRTKILICLSLISILSIKNLLPRSLSSIKSLLSIVSTIRSY
FT                   IQIIHKVRALVSTKVNISKLLEYEEKVPIYLIKFNSDFSLKRWKMFLDILPFSDILPLL
FT                   HMIERIYIRNNSCKKTNLISYLEIYYLTENLITNYEYKIPVISEHHIKVFLNHPMYCYK
FT                   ALLYIYTQSLEQESIRHVAVIIHLLVLKFLTIKFDQAKINDIHLLVKNDQFRKFTKLFK
FT                   LFPKYKALLIKQIIAKEKSITNLLNFSKIWNNYWLVLKFLKSINQNLISIFSFELLYYI
FT                   FLKNERFPVKTYKNLILSDGSCISHILNDLLKNLSKDADLTIKFVEKLQNNKHKLDIIT
FT                   LIINHLSKDSQYDEQKKLFVYLNNSLLTTKIILYLPNFENKIGLQIVTYNQILKLILDL
FT                   FMDSNYYSINILIFNILRPLKINFFELLIEAIMLYLNQVIESCNNTSTEFFDFIKLIFK
FT                   KENSSLFSNVDGNFCDFLYKIYNGILYNMESIHFSVIFSIELVSRKLFNVTLLNNLTNK
FT                   VIANINSLTAKMNIDNNFSSLYECLNGISKLAFDQYCSKKLNHIICDILYLLLQYTYVL
FT                   DRVKISVFDENMQIRDSDNDKPLLECTISHKKIISEFALNMLSFILSISDERQFLKYWF
FT                   VFGETLIEFNDKVIFFDLNKKKLFIGLNSSFKKHILNSITSVRMKEILASKYYKPSSYT
FT                   TLELICCLNIILNSASYLFLGTRLFSNLIFPILMNTKREKDNSSIHIGKRICNVLNIRY
FT                   YDTEELTIIGVFLRTLLIYKKKLINYLIPQLFALKSQNIVSEMVASESHILRYSHISSK
FT                   YTYKILSKMFDKFYYTNFDSIRLEIENEISSDNMQNYLNSANGNILDSGDMNFFSENMY
FT                   QRLLTKFYTFLFGRKHHFLEFKLVEGKINII"
FT                   /protein_id="XP_626825.1"
FT   gene            <678204..>678815
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2660"
FT                   /db_xref="GeneID:3373968"
FT                   /locus_tag="cgd3_2660"
FT   mRNA            <678204..>678815
FT                   /db_xref="GI:66359295"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2660"
FT                   /db_xref="GeneID:3373968"
FT                   /locus_tag="cgd3_2660"
FT                   /transcript_id="XM_626826.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        678204..678815
FT                   /locus_tag="cgd3_2660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359296"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2660"
FT                   /db_xref="GeneID:3373968"
FT                   /translation="MVVHTEIIQTSNLDLAKQILSEEHEISGEIFWSLLFWKMPELFFL
FT                   SVSKSTQISKEQLSNSLNKIILNDFRDAFNSIIIILAKLTDLIEIQTILPNESNSLNNT
FT                   SIPNLTEVIFLYTTIIYTIFPYFNEEISLIESQGIQLLPLLSKAKKTVNKFSLIYKDLD
FT                   RIIEKISQIHEIKRGLLKGVLSGIANQITQVPIIKQLTFE"
FT                   /protein_id="XP_626826.1"
FT   gene            complement(<678876..>679375)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2670"
FT                   /db_xref="GeneID:3374062"
FT                   /locus_tag="cgd3_2670"
FT   mRNA            complement(join(<678876..679218,679266..>679375))
FT                   /db_xref="GI:66359297"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2670"
FT                   /db_xref="GeneID:3374062"
FT                   /locus_tag="cgd3_2670"
FT                   /transcript_id="XM_626827.1"
FT                   /product="protein with UBC domain, ubiquitin conjugating
FT                   enzyme E2"
FT   CDS_pept        complement(join(678876..679218,679266..>679375))
FT                   /locus_tag="cgd3_2670"
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with UBC domain, ubiquitin conjugating
FT                   enzyme E2"
FT                   /db_xref="GI:66359298"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2670"
FT                   /db_xref="GeneID:3374062"
FT                   /translation="KRRLLRDFAKLSNNPPHGICGTPIDDEMLHWDAVIFGPEGTVWEG
FT                   GIFKLDIRFTEEYPNKAPKIRFVTRVFHPNIYNNGNICLDILQQHWSPVLDVCSILTCI
FT                   QSLLNDPNPNSPANAEAAQLYIENKLEYYKMVQKCVKESQEEINNK"
FT                   /protein_id="XP_626827.1"
FT   gene            <679418..>680029
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2680"
FT                   /db_xref="GeneID:3373776"
FT                   /locus_tag="cgd3_2680"
FT   mRNA            <679418..>680029
FT                   /db_xref="GI:66359299"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2680"
FT                   /db_xref="GeneID:3373776"
FT                   /locus_tag="cgd3_2680"
FT                   /transcript_id="XM_626828.1"
FT                   /product="possible signal peptidase subunit, signal
FT                   peptide"
FT   CDS_pept        <679418..680029
FT                   /locus_tag="cgd3_2680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible signal peptidase subunit, signal
FT                   peptide"
FT                   /db_xref="GI:66359300"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2680"
FT                   /db_xref="GeneID:3373776"
FT                   /translation="INLRLEKTYFITNLLLIIPRLCNSFHIFIKMDSLFSRINIIFCSF
FT                   VISLACCAVGNFASSFIYKELPIGDTELHSILDLGISPYLRNDQANIALNINTNLSNSL
FT                   NWNTNQIFTFIYVSYKNKHQNNYVTVWDDIFSKKKNKTSFSMKGVINKYPIRDIGRNLR
FT                   SKSINLNIAFCYMPIVGSIKYHHLKVSTEKKLPVNYFQYK"
FT                   /protein_id="XP_626828.1"
FT   gene            complement(<680105..>682000)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2690"
FT                   /db_xref="GeneID:3373967"
FT                   /locus_tag="cgd3_2690"
FT   mRNA            complement(<680105..>682000)
FT                   /db_xref="GI:66359301"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2690"
FT                   /db_xref="GeneID:3373967"
FT                   /locus_tag="cgd3_2690"
FT                   /transcript_id="XM_626829.1"
FT                   /product="DNAj domain, possible transmembrane domain"
FT   CDS_pept        complement(680105..682000)
FT                   /locus_tag="cgd3_2690"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNAj domain, possible transmembrane domain"
FT                   /db_xref="GI:66359302"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2690"
FT                   /db_xref="GeneID:3373967"
FT                   /translation="MGKKKSSNKQELNSVLQRNANFGNTNGTTENNLKKFQSSQNSLLS
FT                   YLQSFKWAELKETIINLSILLLILCILISTIILRAGEEFYSISGKLNKNENQKNYYEVL
FT                   GVTKKSSNLEIRKAFRKLSLVWHPDKNPDCEPCLEKFRDISKAYEILGDNEKRQVYDTT
FT                   QGGEIEIIPSAAVTLTSDNFDNLVMLQKTNSWVIQVYTDHDELCHHFSSIWEESIEEMG
FT                   KYYKFGRIHAKKENSLLKKLPLSVKVFPAIFIITSGYQYEMYSKIYDPSLESFLEFLSN
FT                   SFPMTLGLLNSEKSLTGWLKKNNLYRPKILILSNKPSPTLLIRSFALRWSSTFELAYYQ
FT                   NNKKNSILYKWGIEYDKPYLIALPHIFKDSDLTPEIIIPLGGFSNEDVLQTRQIDDQLF
FT                   NFINRPTSLVQKLEQSLLYTQQIYVPFIDSSNAKNLCESNSLNRIICLVIIHDRLDGMA
FT                   QNQEIVRALDISRQKYINIRRNSGNASNMIDSEADEDIGELFIQPVQVALLSKVRGIPS
FT                   MSKIKGFLELSRNVAASEFLLIDFDGDRFSILKTLTNVYQKVFEEEIYWSRLPQICSNY
FT                   NNDNLYKNCLFNSSDEPSFFQLVSPVLKLKNMFYIFILSASIYFFKKEIKVFTKK"
FT                   /protein_id="XP_626829.1"
FT   gene            <682066..>682783
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2700"
FT                   /db_xref="GeneID:3374072"
FT                   /locus_tag="cgd3_2700"
FT   mRNA            join(<682066..682307,682351..682468,682511..>682783)
FT                   /db_xref="GI:126644796"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2700"
FT                   /db_xref="GeneID:3374072"
FT                   /locus_tag="cgd3_2700"
FT                   /transcript_id="XM_001388078.1"
FT                   /product="Trafficking protein particle complex subunit 6B,
FT                   putative"
FT   CDS_pept        join(<682066..682307,682351..682468,682511..682783)
FT                   /locus_tag="cgd3_2700"
FT                   /gene_family="HOG000200502" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Trafficking protein particle complex subunit 6B,
FT                   putative"
FT                   /db_xref="GI:126644797"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2700"
FT                   /db_xref="GeneID:3374072"
FT                   /translation="MEENNQISLSLLTFLRYEYLNYCINKSSELISDEKNFQTVKHSKK
FT                   LSISGLQVCKDSLIRELSMSTLEESGFYLGIRLVERLSVFRHRIYDQKEIIKFICKDLW
FT                   NFIFLKQADRLKTNRRGGYAILDNELIWLSKLPSSISANSRKVQFEPAINVIIVCGIIR
FT                   GALQHLGLTCSVAAEVSKIPSCKLLSRIFYFNSVLGTFQIRVYAPSR"
FT                   /protein_id="XP_001388115.1"
FT   gene            <683009..>685633
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2710"
FT                   /db_xref="GeneID:3373966"
FT                   /locus_tag="cgd3_2710"
FT   mRNA            <683009..>685633
FT                   /db_xref="GI:66359303"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2710"
FT                   /db_xref="GeneID:3373966"
FT                   /locus_tag="cgd3_2710"
FT                   /transcript_id="XM_626830.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        683009..685633
FT                   /locus_tag="cgd3_2710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359304"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2710"
FT                   /db_xref="GeneID:3373966"
FT                   /translation="MRIAGIKSNSITPLRQPFETFVTGNDGTYKSIDRWRSKYYSSNDD
FT                   YLSPTFLDDSCSLSSSPIFHDETPNTTIGTPVTSPRKKSSSTRKVRVSIDSVLTNSNEN
FT                   TPTNNLNYKRPPSIGTPILTPPSAKTAVHDNEGFLIPDLPGTSRTRNFRSSHRNDISRS
FT                   CNNYSSADPVHITMPPRLGLPSQTPLNMKDQYRKSPLPVVSANLDYRTVYMGDKLAARA
FT                   KDLRRNYTVSLREASPFFRNNYEYDHSYSENPTIHEDDLILHRGEILRNKYSKLHRARP
FT                   STNCVASDQRSRSLSSYYSESASRKNFSPGYRSNSLYNNYRHSIFGNFRWNNKRRRLGS
FT                   YIASQNDILQQHIQIIDKSLDRSSNGDFALFEGGMLDSPDSNKNCTHESSSPIKSRYIN
FT                   SQELNFNLEKSSVKAISSPSNEVKSSNINSREANNSEAINYTTDNMKNLEVPSDSGKLT
FT                   FKHFDSNEPDDPAQPNDQDVSFNSVFGSSQANEYGESDIQDLSVVVMSSSSKKCLPSAI
FT                   SNSSLDEIVPHPIPNSSEISNRDIYGAPNEIESFTNDDSHSNENKPEKSKNVKNKRTRA
FT                   DSQKKHARGKTINRRRHIDYHIPIDQVKPPPGIGTKPLSDEPSNFENSSRRYPKRLRTA
FT                   PLKWYLGERLEYHRDEKNELGYTIAAIHKVANPKMLPNERGSIHPNSDISTYPASCKPN
FT                   TDELEFHKKSNRDVCSDKSKPRAENTNISKKVKSKVKRVSGNDQEKKSNAVILKDYETN
FT                   EEFSMISVFDRNTLCWADVEYTAGKPYSVALSFISSQATCCEICLPPLTEKGLDESQDN
FT                   YILGHVYMAPDSKSLQIMISDNNVYNIGVGDWFLIPDNTNYNFSNTSDHSEIYISLYVI
FT                   KDS"
FT                   /protein_id="XP_626830.1"
FT   gene            complement(<685657..>686633)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2720"
FT                   /db_xref="GeneID:3374071"
FT                   /locus_tag="cgd3_2720"
FT   mRNA            complement(join(<685657..685777,685821..685912,
FT                   685954..686015,686062..686152,686197..686264,
FT                   686306..686482,686537..>686633))
FT                   /db_xref="GI:126644798"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2720"
FT                   /db_xref="GeneID:3374071"
FT                   /locus_tag="cgd3_2720"
FT                   /transcript_id="XM_001388079.1"
FT                   /product="putative topoisomerase VIA"
FT   CDS_pept        complement(join(685657..685777,685821..685912,
FT                   685954..686015,686062..686152,686197..686264,
FT                   686306..686482,686537..>686633))
FT                   /locus_tag="cgd3_2720"
FT                   /gene_family="HOG000284587" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative topoisomerase VIA"
FT                   /db_xref="GI:126644799"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2720"
FT                   /db_xref="GeneID:3374071"
FT                   /translation="DFSEILQIPRISFGLFPSPKGMIGGRIKLIYKDVEELGVSGATIT
FT                   DIFDPNDSKYIIKTNVKYLLVIEKASIFQYLMEREIYNRIPCLVITGKGFPDISTRKLV
FT                   SDIICKSGITALYLGDFDPHGINIYLTYVRGSSNFESQLAACPSIYYLGIHFEDTELIP
FT                   SDTRVILSEKDRSTLKSLIEDPAIKVSTNIKYKCKLMYEHNYKCELEAFQSISSDYLVN
FT                   TYLPSKILRRTWI"
FT                   /protein_id="XP_001388116.1"
FT   gene            <687215..>690751
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2730"
FT                   /db_xref="GeneID:3373965"
FT                   /locus_tag="cgd3_2730"
FT   mRNA            <687215..>690751
FT                   /db_xref="GI:66359305"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2730"
FT                   /db_xref="GeneID:3373965"
FT                   /locus_tag="cgd3_2730"
FT                   /transcript_id="XM_626831.1"
FT                   /product="protein with 10 transmembrane domains, possible
FT                   calcium transporting ATpase or aminophospholipid
FT                   transporter"
FT   CDS_pept        687215..690751
FT                   /locus_tag="cgd3_2730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 10 transmembrane domains, possible
FT                   calcium transporting ATpase or aminophospholipid
FT                   transporter"
FT                   /db_xref="GI:66359306"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2730"
FT                   /db_xref="GeneID:3373965"
FT                   /translation="MVKITNDENERTIILNNKNEESFIHSFKRLNVIKTARYSLLFFLP
FT                   KNLYDQFNNVANIYFLAIGIMQMVPSISSSGGIPTIALPLICMLCFSAAQAAYEDWKRH
FT                   KADSEINNLPTYAYDPIKGNFAVTKWGDLKNGDLVIVKNREIFPADMVLLASSQNDNRV
FT                   FVETASMDGETNLKLRESPRILFNNGVRNISDILTISKGIMYCGEPNDHPKKIHINSKF
FT                   VLKNSKDDEKELNFSCNSSNMLLRGCKLRNTSWALGVVAYTAHETKIYQSSFRSAPHKM
FT                   SNVQSLYNQVTIASFIFLLFICLSFGIIVACIDYFGGPELSKKFIPIGKMEPNESVIKT
FT                   SIITFFTWIIVLANLIPIGMFFYLVISKVSQAIIIASDSRLTSQNSTVVRNSDLNDELG
FT                   QVSYICTDKTGTLTRNYMEFKTVCINGNVYGGNHHEMRQDTDQLSIEHTEKQKITPHVD
FT                   MEDELLRKNLKEGNKEEIEILLNFALNHTVLIQENEVDLDEPPLYSASSTDEEALVLAS
FT                   HHFGISLVSQNCSKSTIKFSGIGTNQTSVEFETLLRFEFDHARKISSVLVKFPKKIFSY
FT                   ESNDSDGYRYILFSKGSESAIKECCVNQESLDIANETFEYATEFASNGYRTLCFAKKEL
FT                   SENEVIDILNNFKHDNKIHLEEVRTFFESNLTLQGCSGIEDILQHRAQETIESLIASGI
FT                   KVWMLTGDRQETAINIAVRVGIISDEMEVIIFDENKLESFSNNLIKEFPDRSSFLNREN
FT                   GSFNFSNVVLVIDSKILEKALVIDEAKFAKIATKCSSVVCSRVTPQQKAQVVKLIQEFT
FT                   KQRVLAIGDGGNDCTMLQTANVGVGIHGSEGMQAYNVSDFGISQFCHLQPLVLIHGRLC
FT                   YRRTSILVLYNLYKCFTLNIVSVYFGFASLFTGSKLFFELLFQLYNFLYTSVPPIIFAT
FT                   FDSDIPITLPYDYHEPLYLLGITKPFFSLKIFGIWSMNAVFHAAVSLFIPYFILGGNNP
FT                   ISNDGYVPDFWTTGLAVYTNVVIVVNTKILLEAFTSWSLVLFSIIICAFLFFLSILCFP
FT                   YIFHIPELELAAKRAIITPMFVITIVISITVTISLDWILKIYKRSLYPEISHLLQNKWY
FT                   KIYKKKYESHRQLLLKHLSLNWLESMRRLKRKKSAEVEQIQIRKKSSDIIGYAFNYPDV
FT                   NVSQLFLSNKTI"
FT                   /protein_id="XP_626831.1"
FT   gene            complement(<690777..>692405)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2740"
FT                   /db_xref="GeneID:3373964"
FT                   /locus_tag="cgd3_2740"
FT   mRNA            complement(<690777..>692405)
FT                   /db_xref="GI:66359307"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2740"
FT                   /db_xref="GeneID:3373964"
FT                   /locus_tag="cgd3_2740"
FT                   /transcript_id="XM_626832.1"
FT                   /product="T1Dc domain containing protein"
FT   CDS_pept        complement(690777..692405)
FT                   /locus_tag="cgd3_2740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="T1Dc domain containing protein"
FT                   /db_xref="GI:66359308"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2740"
FT                   /db_xref="GeneID:3373964"
FT                   /translation="MGNIKSTEENKLLENSKSGGVCNNYSWCNLDQAELKKIGNLFGIN
FT                   DLNFESIKKDFRIDLNLIENRFPAILRRFYLGFFSFCCEDDFGKVNLTDFVKCVDSILY
FT                   CNKKGIINKVSEYVTSNISDELDALRVIFSIVYFEISFLLCDSKSSILSLKPNNIDQHL
FT                   ISLTSYLDFEFIVKEYYKKKMINCSKQSSVGLISDFIQEYLPLFAFFMKLSIRVHFDMI
FT                   SHPNNVQNSFMEGINLIQDEYNKNNDNNCNRQKDCHNDSQNGGCISSLDLFKLSRWIDD
FT                   NSRVLSTEHCCILRCQYFGDASSGECLTLFQPWNLLYASWKHGLSLNRLVSLIEGYSSN
FT                   VLLLIKTTDNCIFGSVCTGDWKEGNGKYCGDETCFLTSLRPMFSIIGQSGKGRNFMYIN
FT                   TRYDFSPKGIGFGGEPEYSRLWLDSTLGTGTCLKSDLTYNIGMLYQPSNNSGKRNSCLL
FT                   LGTPYSGESDESTTEINKFSVADIEVWGLGGESILKNYLEGKATNDYFKQERKVIDKSK
FT                   FIKNEFDKEYLLGNTYSRGNTHSFD"
FT                   /protein_id="XP_626832.1"
FT   gene            <692540..>693775
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2750"
FT                   /db_xref="GeneID:3373961"
FT                   /locus_tag="cgd3_2750"
FT   mRNA            <692540..>693775
FT                   /db_xref="GI:66359309"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2750"
FT                   /db_xref="GeneID:3373961"
FT                   /locus_tag="cgd3_2750"
FT                   /transcript_id="XM_626833.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        692540..693775
FT                   /locus_tag="cgd3_2750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359310"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2750"
FT                   /db_xref="GeneID:3373961"
FT                   /translation="MRNNFIDEDIFKTDDISSLIGSETLLNSSCVVIQNVDYTPLQASL
FT                   IHNSIKIRDFILKQNSIDINIQNSKGENVLITAIVNKAPLTFIKELFRRNIDICLPKDS
FT                   KFSSIIDFADPSWEGYSELKHMLQRRKSYNFNYRKQNSEKQIENKSNDVEKKETEQSDY
FT                   SINTIQFGSELAEVEKKNGPDNNIFDLKRPNTMNIDDKNLNTIADQLEIVEGNNALEPI
FT                   NQITNKKNTSRSISKSIFIPKSVIKPNAHSSTSESKKDTKLKNDTQESSSLKHETEISL
FT                   EPLEAEKKGEENKRNIVQMKNSTTNDEDNGIINNKDKLRSDGNKSSEIISEKMCNIKPS
FT                   GKNTEPEFTIKKTKNQDFNCDQRGGDYCKYIGVDDEYMSLIDQQLNESIETSKKLFSCA
FT                   CCAGIRPWKSET"
FT                   /protein_id="XP_626833.1"
FT   gene            <693980..>695488
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2760"
FT                   /db_xref="GeneID:3373962"
FT                   /locus_tag="cgd3_2760"
FT   mRNA            <693980..>695488
FT                   /db_xref="GI:66359311"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2760"
FT                   /db_xref="GeneID:3373962"
FT                   /locus_tag="cgd3_2760"
FT                   /transcript_id="XM_626834.1"
FT                   /product="hypothetical conserved protein"
FT   CDS_pept        693980..695488
FT                   /locus_tag="cgd3_2760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="GI:66359312"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2760"
FT                   /db_xref="GeneID:3373962"
FT                   /translation="MDYTQRNLEKTVLDNHHICLNLKRKNKLTSENKDHIYYELLENKY
FT                   INPYLDQIDYSKIFKRFFSQKDAIEYYDSINSHFGQIENSDDSRILPIGVFAEETTING
FT                   SRNYIVSSYESIWNYISSLCKYERHVYEVILANQPCWLYFDIEYNKSQYNLDDNRILID
FT                   FTSHLKLWIKLLFGYSIDKKDIIYLCSSNADKFSYHIIIKRIDMVQNFSTLFKDNISMK
FT                   IFVTHFISFLNKNNVLLDEFDHFNLQNIIDTGVYTRNRCFRMLYSSKFGKKSILQIDEM
FT                   NTSFVLTEILPIKLFRSMITFLNTRTFSKSNFISRINVINQLCFNLEKFCLPKICGINE
FT                   ISFNEYKSNENTKFIPRHLVKLTEYVILFWNKLSEELQNNPELMLSNLEESKLIDYCLK
FT                   KINFDFDDKISIRIQMFISTTMYFKEKELIIISVSKLNKLCFNIEREHISNGIKLIIDF
FT                   YNKRFYQKCFDPDCINFKSRSFTVPESLINYSYDILELSEMIKF"
FT                   /protein_id="XP_626834.1"
FT   gene            <695522..>698452
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2770"
FT                   /db_xref="GeneID:3373963"
FT                   /locus_tag="cgd3_2770"
FT   mRNA            <695522..>698452
FT                   /db_xref="GI:66359313"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2770"
FT                   /db_xref="GeneID:3373963"
FT                   /locus_tag="cgd3_2770"
FT                   /transcript_id="XM_626835.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        695522..698452
FT                   /locus_tag="cgd3_2770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359314"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2770"
FT                   /db_xref="GeneID:3373963"
FT                   /translation="MEFSTEDSSLICENCRGDRVYIDTNTGEYFCEDCGIQQQEIRELE
FT                   RDIDDVYFEISNGPDGRRSNVRRASQSTEKLSNKENNIESLKDDDTLYDQTLNNISNKK
FT                   QTYFDKWFNKKPKIVKNSDFLIGVQLIVQNIIKDMIERRQIKNDVLKTSKSIWFSFLEY
FT                   LCKNRISIRAFFADLRCSVLKVPFNETASNSNINNIQTKNLKIPNIERKVYENENTILY
FT                   DLLHNLFGLDRVEYLSKICDGIIRYCNSTNARKRMSNNARTDESSGGNVLEEWEISARK
FT                   LQQLANVRNIPYSNWYGESNIPRSELIKSVIDMIYEYDFLESYFSRISKSISDENGHIN
FT                   QSRFNEWINFHVIFLMNNRKINQDYISISNYLELPTNEFQNRRDLEFQLYKVRIIHLLL
FT                   YKILGKCLIRVFHNSSLSDYSPIFEFIGNIESQNLRKRSLPKDCFKNLSLECPKIDYSF
FT                   ILCIIWISLLKSGYQVTSFDIIEWVKVGKIDIFKSENAIPKWLKDAGFKWDNDINSITQ
FT                   TRSITQVSKIPSPADLERVINFFSMSINLVIPPFNVPIMIHRILSNCNLFGNRGGISIQ
FT                   PLCIRLWEFLFKEGNIIKFFSKLTIVPSIIIVIARSIWPIFVYHPIPNPKYILENLHFH
FT                   NELSKSNVSATIESLNLDFGFDVKLSSWILKTRENQSLLEEKIRFYSILNGIEWSGIFA
FT                   INWLYNYLSNMSAPSINVNDIFRNSDTKSPEFIIEKKGRPTINLRGDFFNSIRKKRQGI
FT                   KKKIGKSNWSGITPSEPKNCEFYSFDKKKISIFSRYLPSNREIFHSMLFKYVNKVNIFF
FT                   DHDILQSWDLFDDDEKVQLVSNWGKILLTSKETENSSILKGIIEYNFPSVVCSLFPVLI
FT                   NNNFLKNEGSCFNSIESIINHIFNLKLDFLKKLFQEPGIFTFIVPPLPQFIHSRQMHTN
FT                   SEASLPTPYSILLLQLAKITGENYLNIHNCAIKIEEILRERLVKGR"
FT                   /protein_id="XP_626835.1"
FT   gene            complement(<698463..>701753)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2780"
FT                   /db_xref="GeneID:3373960"
FT                   /locus_tag="cgd3_2780"
FT   mRNA            complement(<698463..>701753)
FT                   /db_xref="GI:66359315"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2780"
FT                   /db_xref="GeneID:3373960"
FT                   /locus_tag="cgd3_2780"
FT                   /transcript_id="XM_626836.1"
FT                   /product="hypothetical protein with transmembrane domain at
FT                   carboxy terminus"
FT   CDS_pept        complement(698463..701753)
FT                   /locus_tag="cgd3_2780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with transmembrane domain at
FT                   carboxy terminus"
FT                   /db_xref="GI:66359316"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2780"
FT                   /db_xref="GeneID:3373960"
FT                   /translation="MSISENFKLIGEGISKEEYENAKKNICALDSIMDDDIIESIQTYI
FT                   SFKSFSENNKSSEVRPFQDSQQDSSFNIQKLIAECLSLIVQNYIGYAPMCQILSEWIDI
FT                   LDYKSDSFNNGDNIGINYITPIQSKINSKKKVKTQKTGRSNSNKTLFSENMVEPMAMLI
FT                   ERYFNTETLRKYMDNNRDLLGQGGWQPPPCYWSLMKHPAVVNSIQKLFARNRKSEFLLA
FT                   FLQDLHNFSKTNPNIDCLPKKMNFSSTSNFSVFTKNVTELLADFLLTDETIEAALQGTN
FT                   LLPLSGTINNPLYSIDGKNNSSDYYTSNIIQEICSTLSQSENAYFYAQALLHYMIVWRG
FT                   DYSGCRRLSQMLYHYVRVTLKEPRVAQLNLLFTNLTNFPELFKLCKTIFKMDISTMEEK
FT                   GSANGGLGGFESAIKFSMNPNQISSLYDMLSGIIDRFESLQMLLYERKRIKNTKDNEID
FT                   SEKKYSNVSIKKNSNERFNSAQNEISANTKEWASLGSLQFSLRDLELNVSPRNCSLESF
FT                   LQTNCLNKNQDPYIDPSETFQRKISDCSSDSENNTYGSQKYDTKNSNCDINSYNETIFD
FT                   MPSVSRMGDIPGSDEIQRLKIGPERPPMDALRESALLDTLIDILVNQSIWLTPEEQSKT
FT                   IDLLLLLSVYSPYELLLFLEEQKEWNIVKKEVNSHVNNSIQDIWSNSEDEFECDERIKY
FT                   NVDTLSDFISSESSNSIDSISESNSSMNKEKNHYWLPNKIKNTTTNTRNASSIPVESKK
FT                   QTDSTIGCKSTIDSCIYRNVHTQKILGSLRLLPKNKAKKMKEQFQNIRDLCDRFKNRAR
FT                   KELFRIYNIIHDNLIKDELKWAYLDHLITTPIGASAVLRYIEIFLFSGMNGSSPLITLS
FT                   SSMVVIIKHITQWHPKKRICVFHLLRLCLEHGLQDQTSISVCTINSLASTKSEKRRWII
FT                   DFFVYLIGGGLYGAVLAYMSKVGIKYLDKTLIRDFTIKLSEFCGPPYSIDFSVSYLDFL
FT                   VDANAIGALDLNAFCEGTLSSSSHKVKLSIIEIVTILDYLESTATSNGALNIRSNSINK
FT                   ISESYIHLKHDLQKVMSKCKVLKQILGKSMNKQVFRGKGLGKAWHQSY"
FT                   /protein_id="XP_626836.1"
FT   gene            <701911..>704466
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2790"
FT                   /db_xref="GeneID:3373955"
FT                   /locus_tag="cgd3_2790"
FT   mRNA            <701911..>704466
FT                   /db_xref="GI:66359317"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2790"
FT                   /db_xref="GeneID:3373955"
FT                   /locus_tag="cgd3_2790"
FT                   /transcript_id="XM_626837.1"
FT                   /product="cullin domain containing protein"
FT   CDS_pept        701911..704466
FT                   /locus_tag="cgd3_2790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cullin domain containing protein"
FT                   /db_xref="GI:66359318"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2790"
FT                   /db_xref="GeneID:3373955"
FT                   /translation="MEMDLIPTNISFNPFRIESLIDDHTAVSLYRGIYECLELIKCGET
FT                   HKLSFEFLYRTCYRLTINNYGGMLYCGVLDFIVEMLEKERKDETLDEIVNFWKTFEITM
FT                   DTLHDVLMYLEKNFIISNTKVPIKTAGMSIFLKYYLLSSNRIVNVINNVLEQLNYIRKS
FT                   KKLDINFSKEIRFIVEQILSLPSIEVNIKSLPEDIVDTIRFNEVCCQSTIIEDDELISL
FT                   KSKIPLINRAYDNKILIFTYKFNHKAPEFNWRDFAIFNQFFMPYFLAKSREYHEKEFEI
FT                   SHSLDKDSISQIRNYLSKCEQNYMFEKMIVENCLVFQVWEELIKEMDKVWIHPFFERFS
FT                   SINLFEFFLIGAKNDLQQLFRILSRVPECLEQLKNSLKQFFSIRLDKIFPVDEVFINDG
FT                   FKKFIDEVHLFKCRSEFIFIECFKNNSMFNQVLSVSFEDFFLNRNATTTINLIVNGFDI
FT                   VLRSLYNDNKIDENNKHLDTLFWLFKYVSNKSLFEIKYRTLLCKRLMEFDVNKRNIEHN
FT                   IIIKLRGECGHGYTLKLEGILADMIQSEILNMEFQQINNEISVLSNTIINYKVITPNFW
FT                   ITHPYINFSFLNNLNCKLDNFTQFFYSKYERRKLQWHLGEGSAIINVNLKSRFNKSFTI
FT                   ECSTIQMFILDIFNTFDFISFEEMQKIIGCSDINLLKHNLLCLVFENEPLLNIIPITRW
FT                   KEITINNKNLNENKGIIGVTELNICPKEHFPTNTNSLIASVSLTDIICINNDANVKDNS
FT                   IIKYNYDSLDLNYEIKQNFDSEGSSIRDKGYIIDSIIVRNLKKNKTLHIDDITRRVINH
FT                   NDVLLHGSTELIVERLEMLCQKEFVSKDLFSQNLYSYVP"
FT                   /protein_id="XP_626837.1"
FT   gene            complement(<704480..>705070)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2800"
FT                   /db_xref="GeneID:3373956"
FT                   /locus_tag="cgd3_2800"
FT   mRNA            complement(<704480..>705070)
FT                   /db_xref="GI:66359319"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2800"
FT                   /db_xref="GeneID:3373956"
FT                   /locus_tag="cgd3_2800"
FT                   /transcript_id="XM_626838.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(704480..705070)
FT                   /locus_tag="cgd3_2800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359320"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2800"
FT                   /db_xref="GeneID:3373956"
FT                   /translation="MYKRVALFSSDLLSNSLNCKYLRENIEKQINKVYGDDFSDESPKN
FT                   VEEHSDSLLKNEDIKTESIDSVEYDFIGKFKCILCPKKIIINESDLDKHIKSKQHLNMV
FT                   EKWQKKQEDARKIREKFNILHNLTDGDKIIDEINPKNALSSGLTPNKQSNRKNKRRKSS
FT                   NLSEEQIIAKKMKFVRKKERRLARKSQLTENIC"
FT                   /protein_id="XP_626838.1"
FT   gene            complement(<705141..>705875)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2810"
FT                   /db_xref="GeneID:3373959"
FT                   /locus_tag="cgd3_2810"
FT   mRNA            complement(<705141..>705875)
FT                   /db_xref="GI:66359321"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2810"
FT                   /db_xref="GeneID:3373959"
FT                   /locus_tag="cgd3_2810"
FT                   /transcript_id="XM_626839.1"
FT                   /product="DNAJ domain containing protein"
FT   CDS_pept        complement(705141..705875)
FT                   /locus_tag="cgd3_2810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNAJ domain containing protein"
FT                   /db_xref="GI:66359322"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2810"
FT                   /db_xref="GeneID:3373959"
FT                   /translation="MIFNISNEKLLVSRLISKLAPNYKILVSYFKQFPCSYLLINSNFK
FT                   TNRYLRDKSNYSDMRKTFKLLNEENLSGILNMNAFQLFGLENKFSINKKSVDLSYKELM
FT                   RKLHPDVSNNVNENISIHIIKQYNTVNDPFERALLLISLKSGMTRDSLINIMDTIPVNS
FT                   SLLEQIFEIDDKIMEISNADFNITDFDEISKKNKFKIDNCIKSLENEFEKDNFSITKIL
FT                   SILKELRIYQKLSDRASSILDN"
FT                   /protein_id="XP_626839.1"
FT   gene            <705965..>708436
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2820"
FT                   /db_xref="GeneID:3373958"
FT                   /locus_tag="cgd3_2820"
FT   mRNA            <705965..>708436
FT                   /db_xref="GI:66359323"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2820"
FT                   /db_xref="GeneID:3373958"
FT                   /locus_tag="cgd3_2820"
FT                   /transcript_id="XM_626840.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        705965..708436
FT                   /locus_tag="cgd3_2820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to POP1 N terminus"
FT                   /db_xref="GI:66359324"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2820"
FT                   /db_xref="GeneID:3373958"
FT                   /translation="MNSRFEYQLNPLTLTSSKNSLPQIVNVPHLSSGRKDEICRYVNFI
FT                   KKSNSTKRCFQRLPPAIRRRSMSYNVYRAPRKIRPTLFYEMAKAPPRISRKRRKERKKL
FT                   PWIRRNLLLRAINRENFCGKEILPFNIRNSSDLSTAFRKKGQRSTKLPFNQFKWMESHL
FT                   YHSKRFKMCDAFGYKLPICSTSKRNRKIYRAFKHEFVVHDSSYLQLFELNGVIEDISIL
FT                   FKLCNFNVDFLFSNDYFNTSYRGGGFLFKLKDNILDKMSINTLFPEKTHFYSWERIAPI
FT                   EFLWSPFCKNCGYSKSLWVWIHPIASHQQFFYWEKCIEIFGLDVCINLVEDVNRFEFRG
FT                   PKSLNFIESFRLKRPLSQIEKFVAEQDFVNSIHIKVPLTYSSNKLPNEVFKSNKYPALK
FT                   DNFMGCSLFCKKYREAIRSQFFSSKNLLYNKQTTKCEKYHSPLINILNYRSRKRKNIKT
FT                   LLSNIMERNEKFNSSLGSNSSRKRVQQKFVVSKALIIIHQGSNFGFDLVFPRGLNSSLI
FT                   LRYMHFYSAQIIGIGERRKLFTQFGIPMFPFDFIETLSNQKLQISNPIYTESKELFEEL
FT                   SNEVVNFSNFLKTPPSKRINYFFNKIEFPFLINWNKILNYSCEEFVTFQNNFLTLNQIV
FT                   STSTANNPDKITEVENYNIFVARVGYRGTRKEYKNVSSYILENPIMKLRTLVLVKITSP
FT                   RKINHKAHIYMCNKDDIKEIKRKNYLTEEPNKYGKISLKENATNQPEFFNFRNPGFSTL
FT                   RKLVGIVTSGGYSMLLRKGIGIGYISLFSFDESCLEQNKESFFWIRDRCLRYTPVNVEK
FT                   YSATNLHFNIY"
FT                   /protein_id="XP_626840.1"
FT   gene            complement(<708438..>709322)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2830"
FT                   /db_xref="GeneID:3373957"
FT                   /locus_tag="cgd3_2830"
FT   mRNA            complement(<708438..>709322)
FT                   /db_xref="GI:66359325"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2830"
FT                   /db_xref="GeneID:3373957"
FT                   /locus_tag="cgd3_2830"
FT                   /transcript_id="XM_626841.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(708438..709322)
FT                   /locus_tag="cgd3_2830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359326"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2830"
FT                   /db_xref="GeneID:3373957"
FT                   /translation="MQLRSKLNHNVADYFRKSLQVSSANLSDSNMPFPYKHEFFSGLIK
FT                   LPFLSSEPEYINFPISQASIQEYLTTLYEFTHNLQINMIPRHNAGFSNDSIKAEDAVEN
FT                   PSRKNHISSDDLAIIDEEIIGVYYGTKANECDITSQSVCMERGTIETDDQVVKLMHPIK
FT                   QNVTAVSILDIIPLDMNYCSTFQVMLDSQEEGMDTILELDEGWNHPTTRFSLYNKIENK
FT                   LYKYVRDYSSNLPKEYTKSYIISLPRHFLECKEESKSSETSGSKAYLISTKSPKLLLSK
FT                   VSSMKRKPKIKLL"
FT                   /protein_id="XP_626841.1"
FT   gene            <709422..>710252
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2840"
FT                   /db_xref="GeneID:3373775"
FT                   /locus_tag="cgd3_2840"
FT   mRNA            <709422..>710252
FT                   /db_xref="GI:66359327"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2840"
FT                   /db_xref="GeneID:3373775"
FT                   /locus_tag="cgd3_2840"
FT                   /transcript_id="XM_626842.1"
FT                   /product="FmRP interacting protein like, contains 2 C2H2
FT                   zinc fingers involved in RNA metabolism"
FT   CDS_pept        <709422..710252
FT                   /locus_tag="cgd3_2840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FmRP interacting protein like, contains 2 C2H2
FT                   zinc fingers involved in RNA metabolism"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359328"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2840"
FT                   /db_xref="GeneID:3373775"
FT                   /translation="IKSKQNNYSDLCQFISENILLKRANNQFQFKNNTGYATSARIYFY
FT                   IKKHATQNDKLIFYMKKNNKSTYQKTRKLDNYCNVCEKGFINNEKHVQHILNFHVTCSE
FT                   ENCNYSAPKEIMHYHKLKHINNNEGNSITESTEEIEKWLICRKMKFPRPVCSKNHSIKS
FT                   QDSNEILQDNKKKCQSTQISALEHYIRINMSNQLPFSRSKKLNKPLNKKNINYNSNLKV
FT                   HKNKMYGEAFPENKKIQKSLLFRLFKSEIHIYEKKMISAINHILERSHFKNLLN"
FT                   /protein_id="XP_626842.1"
FT   gene            complement(<710784..>711893)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2850"
FT                   /db_xref="GeneID:3374107"
FT                   /locus_tag="cgd3_2850"
FT   mRNA            complement(<710784..>711893)
FT                   /db_xref="GI:66359329"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2850"
FT                   /db_xref="GeneID:3374107"
FT                   /locus_tag="cgd3_2850"
FT                   /transcript_id="XM_626843.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(710784..711893)
FT                   /locus_tag="cgd3_2850"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359330"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2850"
FT                   /db_xref="GeneID:3374107"
FT                   /translation="MSGFNIEKLINLNSFSQGISENETLALSLPTGNTVDLDFESYCYY
FT                   YSDNTYNNEDISSILNKKNEINGINNWVNFNSVENTKYFEECIPSNINTNINGMNHVND
FT                   AEYTCHDYYNKDNFLPSLINSNFVTNYFHNSEVKVKSKVKSIVLFLRANLGINVAKNFK
FT                   EEVEALGAYVFIADNCKELLDVNNELDGCKRLIVTSADVALNERLAEEISKKKLSNFLG
FT                   VVLYCGPHAEYHIKWCSKVSSIKFLSQNLIEVRRAISWLFSESLLNANEMPNIGRRGKK
FT                   VALQDLKRSSQSKINSVASSFPSLGMQTIGTQSISEEDRNIHSTGSYSPFGINNGNPHD
FT                   NIASMFRTLALETKIATQVNNGQFFSIDN"
FT                   /protein_id="XP_626843.1"
FT   gene            complement(<712149..>714149)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2860"
FT                   /db_xref="GeneID:3374106"
FT                   /locus_tag="cgd3_2860"
FT   mRNA            complement(<712149..>714149)
FT                   /db_xref="GI:66359331"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2860"
FT                   /db_xref="GeneID:3374106"
FT                   /locus_tag="cgd3_2860"
FT                   /transcript_id="XM_626844.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(712149..714149)
FT                   /locus_tag="cgd3_2860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359332"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2860"
FT                   /db_xref="GeneID:3374106"
FT                   /translation="MNANNLKSSLYSSLFLSNGHSSKLGSETPDSNKPNLKIKNLDIKV
FT                   NNSRSKIINKQISLNSCEKSSISKVNSKCLNSNSVNTTKSNITTKYNSNCLTNKNNPTS
FT                   ELGKFSLLDRSDDQSIVPSNIDSNAKNKVDSEDFNIRKNKDSEDFKVLGEKKIQLSEEN
FT                   ADKNNLFNIENQNLEKEVKNDIYLRSNLIKVSKDDNNEVIISVPCKLNMDLESLFYYFS
FT                   NNSVYLKCKQFASMLHLSKLYHKSKPIDILGRMFPSSQENLPSEERQIEYNLFLKLLHR
FT                   FSQFKFRSIGATEDEKLNLVVSFLLSCDYADIISNKLIRSERSIQVNDPTMQRKDKDIQ
FT                   IKAELRDSSIQIEQSLNSVAVDATFSVADASCYCDIEQELNLTNIQRELDDPSNEEHQN
FT                   QVFDYLNVYNIQDQLRLQEIVVKPELEELNQQDLKKSEKKNLQKKKIQKISDPESEILV
FT                   ALTSINQEDDKKLYRIFVYYSGPNSDRLSYRQFYNLMNDSGLLGGNFEEYITPIQLERC
FT                   YSAVITNPKGLDYWEFKEILLYCGEASSCGNDPISAFQIIIRKYIIPLILMIYQPNNFE
FT                   KCEDVVLDQSVSGEFDNVKSLQTMINKAILPWFRLGSRPILSDESDEYSETCSCSSFDS
FT                   HFDSFEDKQSSISSSNISSSATQGINTQTPK"
FT                   /protein_id="XP_626844.1"
FT   gene            complement(<714364..>716697)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2870"
FT                   /db_xref="GeneID:3374105"
FT                   /locus_tag="cgd3_2870"
FT   mRNA            complement(<714364..>716697)
FT                   /db_xref="GI:66359333"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2870"
FT                   /db_xref="GeneID:3374105"
FT                   /locus_tag="cgd3_2870"
FT                   /transcript_id="XM_626845.1"
FT                   /product="putative acyl-CoA synthetases"
FT   CDS_pept        complement(714364..716697)
FT                   /locus_tag="cgd3_2870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative acyl-CoA synthetases"
FT                   /note="similarity of possible bacterial origin within
FT                   discrete region similar to long-chain fatty acid acyl-CoA
FT                   synthetases"
FT                   /db_xref="GI:66359334"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2870"
FT                   /db_xref="GeneID:3374105"
FT                   /translation="MCVFLLFTVNLNINFIKMKMKVLNTTETKKKYVSFEYSSIFYNSE
FT                   KNICDQTKEEFSIEYWRKNGERPEKISILKDSFEYFQYFMTIKLNQFVDLNQIKENDSC
FT                   SINTIKVGTLWDGNKIEDLIFREVCYNNNTFIPVFLNYAVDNPEIISYKLSVADCQILL
FT                   FDVDIPKSFIDEVSSNFSTKYDKKIFLLPSDQVLFSNLTNQNLYLNNFPNNELTNDSQK
FT                   IYSYSENYLENFFETNQVKIDKANEYTNTSKKVQNSKINQSLGNIEGVYSGNETNNITN
FT                   VGKKMGISGPEIYSKVRNIVFTSGSTGRPKGAKLTFGNYSGMISTLSVLCNNNNNIKSI
FT                   FVITNPLHHVNSTCFTEYCIRSSSKLILIHKYSKVYWQILNETIKISINSYGNNFNMIV
FT                   PLVPKHFEYFSSMIENNYFEDRNEILTNLSHPSVSFFFGSSAVSNDLINEFKKLFNGKI
FT                   PRIRFGSTETCLQLCGTDLLMDHSLLNAALKITSNINEINSKTKKKNGYFIGRSIQPFA
FT                   EVFVVKSIDINADNFLIPTNEFEVGHIICRGKTIMSGYINHENVLITREIVNRINKIGF
FT                   STQKCRKMLFICDNHPWYLGLGDQGYWTAEKINTNSEPSTVYILGEERQVAHINKDPNI
FT                   IIEEKLNSCACCKDNIFVDNIFLFWLSRSSSIIKIGGVKYSSEEINDRIVSTLRNLNKK
FT                   KFPKNFFSTVISNKDDKISEDDKIIFIYEPFENSENFEHFIRNELNYSNIPKSYIPYKI
FT                   IETNIPKTFKGSIDREKLLEKIEF"
FT                   /protein_id="XP_626845.1"
FT   gene            complement(<716759..>717532)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2880"
FT                   /db_xref="GeneID:3373774"
FT                   /locus_tag="cgd3_2880"
FT   mRNA            complement(<716759..>717532)
FT                   /db_xref="GI:66359335"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2880"
FT                   /db_xref="GeneID:3373774"
FT                   /locus_tag="cgd3_2880"
FT                   /transcript_id="XM_626846.1"
FT                   /product="U2 small nuclear ribonucleoprotein A' like LRR
FT                   repeats"
FT   CDS_pept        complement(716759..>717532)
FT                   /locus_tag="cgd3_2880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="U2 small nuclear ribonucleoprotein A' like LRR
FT                   repeats"
FT                   /db_xref="GI:66359336"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2880"
FT                   /db_xref="GeneID:3373774"
FT                   /translation="TYLLIMDTLLTQLSTIFLNKINESYSFNIRNSKIKAFDNTGILKD
FT                   QFECIDLSDNSISSLSYISNLNRLSTFIACNNEIEYIESGFTKSLPNLESLVLTNNQIK
FT                   NIESISAIFFLRNLKRLSLVNNPITKIPNYKTILIGMLPNLIYLDFQKINKVDRNASEL
FT                   FFETNSIGKDLLVQYSFKNFEDNSIKIMNNVSTSKINTIINLPINKPNHTQLNNIKIAI
FT                   SLCNDIKQLRVLEDSLMKSEITPEAQEIVDNYINE"
FT                   /protein_id="XP_626846.1"
FT   gene            <717773..>724912
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2890"
FT                   /db_xref="GeneID:3374104"
FT                   /locus_tag="cgd3_2890"
FT   mRNA            <717773..>724912
FT                   /db_xref="GI:66359337"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2890"
FT                   /db_xref="GeneID:3374104"
FT                   /locus_tag="cgd3_2890"
FT                   /transcript_id="XM_626847.1"
FT                   /product="Prp8. JAB/PAD domain"
FT   CDS_pept        717773..724912
FT                   /locus_tag="cgd3_2890"
FT                   /gene_family="HOG000184103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Prp8. JAB/PAD domain"
FT                   /db_xref="GI:66359338"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2890"
FT                   /db_xref="GeneID:3374104"
FT                   /translation="MDFNNALQNEQASQINLGIKHLNWSKLNEARYCRRSKVNGNQIVR
FT                   KSKLPPEHLRKLINIHGDMSSRKFQNEKRVYLGALKYIPHSIFKLLENIPMPWERVKYV
FT                   DCLYHTTGAITFVNEIPWVIEPIYIAQWSTMWTMMRREKRDRKHFKRIRFPPFDDEEPP
FT                   IDYCENILGVEPLDSIQIVLDGEEDISVYDWFYLDSKQQFKYFHKKGNYKKHQWHLTFE
FT                   QLGTLYRLSMQILPILLENNSYYLFNKDAFFTAKALNIAIPGGPKFEPLNSTSFDEDED
FT                   WNEFNDLNRVIFRSITRSEYKIAFPHFYNSLPKFVSTSVYHYIVNIFTKPENPNSPIFE
FT                   FNEYYHPISPNNSLLENIYQIVDEEIHNIKIHFSPFFHEYSLETSSTTNGILLFWSPFP
FT                   FNVRSNPRRRSYDISLLKEWYKYNNISSEQPVKIRISQQKLLKNWILNSLHNKVAKNCK
FT                   RRNFLKILQNTKFFQSTEMDWVEVGLQVCKQGYNMLNLLIHRKNLTYLHLDYNFNLKPI
FT                   KTLTTKERKKSRFGNAFHLCREVLRLTKLVVDCHVQYRLGNIDAFQLADGLQYIFNHVG
FT                   QLTGIYRYKYRIMRQVRMCKDIKHIVYYRFNTGSVGKGPGVGFWEPSWRIWIFFLRGII
FT                   PILERWIGNLLSRQFTGRQNSNPYRSISKQRVESHFDLELRASVMHDILDMMPEQLRSS
FT                   KARPILQHLSESWRCWKANLPWKVHGMPPAVENIILRYVKLKADWWTNSAYFNRERIRR
FT                   GATVDKTVVKKNLGRLTRLYIKAEQERQISYLKDGPYISSEEAVAIYTTAVHWLESRRF
FT                   IHIPFPPLNYKHDTKLLILALERLKEVYSVKSRLNRSQREELTLIENAYDNPHETLARI
FT                   KRHLLTQRTFKETNIEFMDLYSHLIPVYEIDPLEKITDTYLDQYLWYESDNRKLFPNWV
FT                   KPSDNEPPPLLVYKLCNGINNLDGFWKFDDDSVGLLVETQFEQIMEKIDLTLLNRLLRL
FT                   ITDHNIADYITSKNNINVTYKDMNYLNSYGIIRGLQFSSFVCQYYLLIVDLLLLGLTRA
FT                   NQIAGSPSHPNEFLKYSDKKIELSHPIRLYCRFVDKLYIIIKLSKQEIKEIVQRYLSEN
FT                   PDFSNNQNLIGYNNKKCWPRECRMRLVKNDVIIGKSVYWELSNRLPKSITTLEWERSFV
FT                   SVYSKSNPNLLFSLAGFSVRILPTCRIGKRTFEASNTSFIGNEDSQYYTRESTWQLSNN
FT                   LTKEITSYVFLMVDESEIRNFENRVRQILITSGSATFTKIANKWNTCLIGLMTYFREAV
FT                   IYTEKLLDLLVRCENKIQTRIKIGLNSKMPTRFPPVVFYTPKELGGLGMLSMGHILIPQ
FT                   SDLRFTRQTDLGTISHFRAGMTHDQDEHIPNLYRYIQTWESEFIESQRVWLEYSLKRQQ
FT                   AQLQNKRLTLEDIEDSWDKGIPRINTLFQKDRHTLAYDKGWRIRQIFRQFQILRNNPFW
FT                   WTHQKHDGKLWNLSNYRTDMIQALGGVESILEHTLFKGTYFSTWEGLFWEKSSGFEESM
FT                   KYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYIGFQVQLDLTGIFMHGKLPTLKIS
FT                   LIQIFRAHLWQKIHESIVMDICQVLDNEVDALGIEMVQKEAIHPRKSYKMNSSCADILL
FT                   LSSYKWVATNPSLLLDKKDDISSNSLINTNKFWIDIQLRWGDYDSHDIERYCRAKFLDY
FT                   TSDAMSIYPSPTGVLIAVDLAYNLYSAYGNWIPGLKELIQKAMAKIMKSNPALYVLRER
FT                   IRKGLQLYCSEPTEPYLNSQNYNELFSNQTTWFVDDTNVYRVSIHKTFEGNLTTKPVNG
FT                   CILILNPCNGKLFMKVIHTSVWAGQKRLSQLAKWKTAEEVVALIRSLPIEEQPKQVIVT
FT                   RKGMLDPLEVHLLDFPNIVIKGSDLSLPFQALLKIEKFGDLVLKSTQPSMVLFSLYDDW
FT                   LKTISPFTAFSRLVLILRSMHINPERTKVILKPNKNIITMHNHIWPSLTDEEWANVEVA
FT                   MKDIILDDYSKKNNVHISALTQSEIRDIILGMEITPPSIQRQQIAEIERQVKDLANKTT
FT                   ECSDITSLTTKTVNVHGQEIVVTTQTQYEQKTFSSKTDWRARALASTTLSLRSDNIYIL
FT                   SDDSILNISNNSIIPYIIPKNLLKTFIEISDLRTQIGAFMYGKKIVESIGKGKCYSENS
FT                   CEMETVIEIRCLVLAPQHGNQNSINMTDILPKNPEISDLEFIGLIKTKVQEEFSIAISD
FT                   IDYLWRISQNNLDVQVDNIAMVSCSFTPGSTTLSAIKLDHDCIDWYKNNIENKDLNYET
FT                   FKTCSSDYTEKIKLILSETYNGFFLIPEDGVWSYNSMVVKYNYSSKCSYIVDKPNAFYD
FT                   EVHRPQHFLQFAYLENIDDFDECGLLEIDEIFE"
FT                   /protein_id="XP_626847.1"
FT   gene            <725143..>727041
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2900"
FT                   /db_xref="GeneID:3374070"
FT                   /locus_tag="cgd3_2900"
FT   mRNA            <725143..>727041
FT                   /db_xref="GI:126644800"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2900"
FT                   /db_xref="GeneID:3374070"
FT                   /locus_tag="cgd3_2900"
FT                   /transcript_id="XM_001388080.1"
FT                   /product="protein Roco7, putative"
FT   CDS_pept        725143..727041
FT                   /locus_tag="cgd3_2900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein Roco7, putative"
FT                   /db_xref="GI:126644801"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2900"
FT                   /db_xref="GeneID:3374070"
FT                   /translation="MQQIPTILKNSKSWSNSTQRSEYNKHSNNWVDFNLNVEKLNNCSN
FT                   SNFIYKFLNTDLSRNYHGNLNHAGSERYRTKNEGVIQNSLIKENKVSRQKLVNSRPVEI
FT                   ECKTLLPNLFSVNGQKHIPFDINLNRFDTFETESKNSHKSKPQIINRKLGNDLNYYNTK
FT                   IINSNHCPKLVPIACNNLFRATSFLEVKPNFNNCNNNSSFLRKNSSFISENYRNNGIKS
FT                   NVNVSCIQEKNYSSSNLTNSQQKIIYSANQENSSILLNSKSKNLKMPNYFSSKLFIRNL
FT                   PKVSINNLSSKPIYQIDGLESSDNGMEVNLTSIKMFSILGFGSTSLVYSAVWRGTEVAV
FT                   KILGNYAKSIKSSDCNHLNLSINKAIKHMEITKKDCQRYLEFRNEIRIMNLLRHPNIVQ
FT                   YMGGNISSNPPFLICEFCSGGTLFNLLHGDSKKCLGSNSFSFSGPSVNLSLYQRIKILQ
FT                   DIARGIHFLHSANPPIIHRDIKSLNIFLSLPIKSNADVPIAKVGDFGLCQQLFSDKGFI
FT                   NGSGNLVGTYQWMAPEVLTSQIYNEHIDVYSFGMIMYEVLSNRTPFFELGVDVNPEILA
FT                   DEIIKGIRPTLKYIVNDVPIEIKNIMIRCWDPQPSKRGTMLVIINELQHFMEKIGN"
FT                   /protein_id="XP_001388117.1"
FT   gene            complement(<727091..>727759)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2910"
FT                   /db_xref="GeneID:3374103"
FT                   /locus_tag="cgd3_2910"
FT   mRNA            complement(<727091..>727759)
FT                   /db_xref="GI:66359339"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2910"
FT                   /db_xref="GeneID:3374103"
FT                   /locus_tag="cgd3_2910"
FT                   /transcript_id="XM_626848.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(727091..727759)
FT                   /locus_tag="cgd3_2910"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359340"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2910"
FT                   /db_xref="GeneID:3374103"
FT                   /translation="MSYIECSKVGRVNINQLEDLLDLLKSLCVEVKLVKWRENTWCPNV
FT                   MESHCFSRKLDFTKAQKHTEAEARILQYIYPTESKDLVNISYQTPIIEPTTNSLEMALT
FT                   SDKDKKATIQVNKVVECFSSKSILEIMQHLNIGSLNSTPPTLYNTLYISCYLCTFNPLK
FT                   ADEVVIFVQTEFKDINFNYNSNDHILVILKSKCLNENVISTNKQAILNLSRKLEKIVSF
FT                   "
FT                   /protein_id="XP_626848.1"
FT   gene            <727870..>728916
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2920"
FT                   /db_xref="GeneID:3374102"
FT                   /locus_tag="cgd3_2920"
FT   mRNA            <727870..>728916
FT                   /db_xref="GI:66359341"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2920"
FT                   /db_xref="GeneID:3374102"
FT                   /locus_tag="cgd3_2920"
FT                   /transcript_id="XM_626849.1"
FT                   /product="possible peptidase family C54"
FT   CDS_pept        727870..728916
FT                   /locus_tag="cgd3_2920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible peptidase family C54"
FT                   /db_xref="GI:66359342"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2920"
FT                   /db_xref="GeneID:3374102"
FT                   /translation="MNFGRTIYFSISSFFREMTQKFLSAEEEIFMLKNKFAPEEKKYFL
FT                   KEFHDIILFTYRNEFKNIIITRNTVQLTKNYSKNINSDVGWGCMYRVTQMSIAHGICQF
FT                   MKRFLGNLNIEKILNNFQDNESAKFSIHNMVNIGLSEFGIDPTSWIGPTTSSMIANKLI
FT                   NDNRSIISNIQIASITYVEGTIYRDQAVKHFSEVGSDSCTFVWLCMKLGTSKFNINSYK
FT                   KTVISMSNVSQFICIMGGNNYSSGALLIVAFSNSFLYCLDPHIKVLPSFSDKNFIRDDF
FT                   IQKVPTRIYWGELNSSLSMVYICRNLEDFDDLCSNLTRINSDLFEVINNCDFEVKSINE
FT                   LDSGFLVV"
FT                   /protein_id="XP_626849.1"
FT   gene            complement(<728935..>730209)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2930"
FT                   /db_xref="GeneID:3374101"
FT                   /locus_tag="cgd3_2930"
FT   mRNA            complement(<728935..>730209)
FT                   /db_xref="GI:66359343"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2930"
FT                   /db_xref="GeneID:3374101"
FT                   /locus_tag="cgd3_2930"
FT                   /transcript_id="XM_626850.1"
FT                   /product="possible mitochondrial import inner membrane,
FT                   translocase subunit TIM44"
FT   CDS_pept        complement(728935..730209)
FT                   /locus_tag="cgd3_2930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible mitochondrial import inner membrane,
FT                   translocase subunit TIM44"
FT                   /db_xref="GI:66359344"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2930"
FT                   /db_xref="GeneID:3374101"
FT                   /translation="MEGLSSNALTKVCINSLRYNLRQDISICRNIFLFYQSNKYYMHFT
FT                   QLNNLNFRKRRCYSTFNSYFNKFVSQLKNEIKSDKILQDDIALLKKKFDNLYFKFYSNL
FT                   PFINFYSSVYFINIAELYKINRFLSHIKFFTAKISSIFSRFLSSNLFSRHIEIIKVLFY
FT                   DETNRNVIERELSSWKSDCNKESNSEIKTSNKKIINKNIEGKTIVPIVENSVVLHNYSL
FT                   RNRLGVKLKDMLLLKNIFESEYFKTIYNGNKISKVVKEMKAINPNFKLTDFMSFFEEYI
FT                   LPKFMESYLKCDEHKLRLHCGDVAYRQLCSNIEKLKKMGLCLNTKILQLGNVELIGAEI
FT                   SDLMFSFKDCKIQTNQPEFMFTFKTQQINCLQDSNGRIISGSIDDIKELQYSIKVTPHP
FT                   NANVPGLEYPYLITNLEIIGSIPIF"
FT                   /protein_id="XP_626850.1"
FT   gene            <730362..>731792
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2940"
FT                   /db_xref="GeneID:3373773"
FT                   /locus_tag="cgd3_2940"
FT   mRNA            <730362..>731792
FT                   /db_xref="GI:66359345"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2940"
FT                   /db_xref="GeneID:3373773"
FT                   /locus_tag="cgd3_2940"
FT                   /transcript_id="XM_626851.1"
FT                   /product="probable
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthase, 2x SMART_PLDc domains, possible bacterial
FT                   origin"
FT   CDS_pept        <730362..731792
FT                   /locus_tag="cgd3_2940"
FT                   /gene_family="HOG000281469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="probable
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthase, 2x SMART_PLDc domains, possible bacterial
FT                   origin"
FT                   /db_xref="GI:66359346"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2940"
FT                   /db_xref="GeneID:3373773"
FT                   /translation="ACKEIPYFFFLMKRKDKNEIINTNYIASKPWLAEEVNNRLKERDN
FT                   IFNVCEDEFESNKWFQLMNKFSKYGEITRGNKIKLFENSRDSYLSMIESIDSAKKRVWF
FT                   ETYIFEECETGEKFVDSFCEASQRGCEVILLLDAFGSSKFPKRWEQKLLKNNVKVIWFN
FT                   PISQIFKDTFLFRNHRKLLIADEKAYCGSINITNRINDSSLNDEANIKNYNIICNSAYK
FT                   KLIFLFKQVIYSISPIKVNKLCFYDVHAEIEGPATYDLGKVFIDSLKESKCGQIPIIFQ
FT                   RPKEIKNGTILQVLYSNTRRQHRGIQNVLNIATKNSNSYIYLTTSYFFPPSFLRRAIQT
FT                   AINNNVKVSMLLSGRSDIPGDTIATKYLIKRFIQNNVRFFFTRNIHCHAKYITIDGIWS
FT                   SFGSFNWDGFSANRNLEVSVASFDSKIASQLMKMHSKMTHSFQSTEQTINQWNEQSRLT
FT                   RVCSKAAYMLIKFVNKYL"
FT                   /protein_id="XP_626851.1"
FT   gene            <731899..>732975
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2950"
FT                   /db_xref="GeneID:3374100"
FT                   /locus_tag="cgd3_2950"
FT   mRNA            <731899..>732975
FT                   /db_xref="GI:66359347"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2950"
FT                   /db_xref="GeneID:3374100"
FT                   /locus_tag="cgd3_2950"
FT                   /transcript_id="XM_626852.1"
FT                   /product="ribosomal RNA assembly protein
FT                   mis3/dribble/Krr1p. KH domain"
FT   CDS_pept        731899..732975
FT                   /locus_tag="cgd3_2950"
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal RNA assembly protein
FT                   mis3/dribble/Krr1p. KH domain"
FT                   /db_xref="GI:66359348"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2950"
FT                   /db_xref="GeneID:3374100"
FT                   /translation="MLEMSVGTPMENQEIISKKRRYRKDKPWDTDDIDHWNVPKLTPED
FT                   NPHGLLEESSFAVLFPKYREKYLRDIWPDIRNALKAHHIKCELDLVEGSITVRTTGKTW
FT                   DPFIIIRARDMVKLLSRSVPFHQAVRILGEGEDDNNLGCDIIKIGHRNKEKMVKRRQRL
FT                   VGPNGSTLKAIELLTNCYVLVQGQTVSVIGSYKSLKLVRRIVEDCMNNIHPVYHIKELM
FT                   IKRELEKDERLRGENWDRFLPKFKNKCVKRKVKKQIKKKNKSIFPPEPTPRKEDMLLET
FT                   GEYFYSELERKAKQIKERISEQKEKKNEKHMEREKMYIPPNEKLFLKNKTSNQNEINYK
FT                   TFGQNSEKYKNNLSNFVV"
FT                   /protein_id="XP_626852.1"
FT   gene            complement(<732982..>741057)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2960"
FT                   /db_xref="GeneID:3374098"
FT                   /locus_tag="cgd3_2960"
FT   mRNA            complement(<732982..>741057)
FT                   /db_xref="GI:66359349"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2960"
FT                   /db_xref="GeneID:3374098"
FT                   /locus_tag="cgd3_2960"
FT                   /transcript_id="XM_626853.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(732982..741057)
FT                   /locus_tag="cgd3_2960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359350"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2960"
FT                   /db_xref="GeneID:3374098"
FT                   /translation="MYLKKVIELGSLPGLNLQKYTNSIRKVTIFNERLSIIVENLVFFF
FT                   IITKDHENAKLIYSWKINSEEELILNGIWIDNNLFIILSSSSVYLLALENESVLEVKTA
FT                   KHGLTKTIENSEIILIDNFSNIPIDRQRIIAIVNFSSGFFPVSIDRFNSGYSIEIGNII
FT                   TTESKGATPCENGIFVVNSSFIQKFYIDSNTIKCTMIDSLSIGEILNMSLGKCDFKLIS
FT                   FYKAVKGNIVNVIFLNIEDGIPFNGIEIAISSDNLIPLRANKINIKDPDNIINISQTKF
FT                   LDDILANIIVYDSSVVVFKGHEISSEICIANYNDLNTSFIPFVSHGLCETTIFYAGCTL
FT                   EEKTGNILINILEEEPNYNLIKDKRIPRFENYNVKDEQIILNSEKTLNNQFDRAFKFNI
FT                   VIPQLTKLISNSEKVDWNDVFEYLDKIPLYNVEDALNLLSSLISALENSNSSNSHIMKM
FT                   NYIIQKSITFDIIYKNNYKNFEAALKICSEYDSNPNEIDTNWDILLKRFLKCDLGKLCN
FT                   CLLSFNLVEEFFFLFNRHFIHFGDGDEEVRSEIILESLSNLPVNLPEKIEKEIPSWLVN
FT                   QVFPFVTNKNKLLNLIADRAITLEHVSNGDIDRCLFLLSSVFLNEYSYSNNHVLPKQIV
FT                   SNGILWAGSGDKRYSINKIPLNKINQVYWAFLECNDLKNRYKLEINFSSLYYKKISNRD
FT                   IAFKLLSRISSSELLNYEINHHVIPFCKIRGLEADQIIMEYLLELISSINYNSLESNLN
FT                   STDGKKYYQPRIISLINSITNDEYKAHALLQYLSLNNKCLAIDRNIDLKFPHSAQNEID
FT                   FLMSYAKNISVNGKKSFELKNRIALIDAQNLLSRYNLDSMASIILFEKNAPRRLILHVI
FT                   SQVDAGIESFNDAMFLIDYLKQETNTTFMGISEAYCLRLRFLIFRRRNIIEWEKMTKKS
FT                   IKEIHNKTIEEDILDIFSNVDCKKIYSITQQFVCFVWQFLDCYSKNCIKSNRLKIRCEI
FT                   ATYSAVVVLRELFKTIQENKWKLRQNTFWTSNESFNTLIRLQQLQFEFGIYIRPSDIMI
FT                   DKMDHDQNCLIGKEIQDKMTYLEPIQNKNTLSNPFGKIEADLCNKQIIDESFISEWRNG
FT                   YFQLYKESCYIKLCEIFDEFAQPYFEKKISDEKKKGIFTKLLRLGSLIGVDESYIRRTN
FT                   IRNSLRDGGKLCIFRRLTQELFKTPSSKNAITIVDEVQNIILNLLTVDLVDKKKNYAAK
FT                   FDKESRIDGLELIFIFSKLLQVVATCIPYCPIKLISFVLALSSDILWVHDFLLYASDAI
FT                   DNIENPNNKLISNHLDNHLFSKIIMKSLKNLHFLPLDSYKSYYKEICTLYPFTDAKQIV
FT                   MAFLYTKIRIFKELSKQISIKKIYISPFLIYNFWTDPTLWTIQTNENYPIDVGKYIQEL
FT                   RENVDVLAKQLYQSECLTLAMSIYLKHPLLISDVKLALNINTEFFRKVLKGRDPIDGQL
FT                   CMALSSSLEKKDSWNVFVQSLNPSNILDNYYRTQRMARIGWDLGILFNHYSMRKEMEDL
FT                   HKQSKWCNSFRQLKIEFDQSLFFQKQDPQNNNQGYKKSIICKLIHKSDFDLILCLQYAK
FT                   DYNINDEYILFLWSKQMILHNFDPKFELIMQNILSFVTPELGKEIFESTFEFISSFNYE
FT                   RLKFVLNWYNKNCINTIELPNSMNAYLRTEANNEYSTSSSSSEINKGFVENQNHKNIST
FT                   ISKLEVLKILSTYKRVCPADKDEKLFIKNEAERINGNIELGKKVNFKVESNKYRIPFHY
FT                   LIKHPINALKYEINDETIYKIKKMSEYLGIKNISIDIQFVWNIVLCRKYKYLSENNLLK
FT                   TESNEFQEYCFKLVESDKILLRYIESIASVDLEAGIAIVLLVIDEIPLSKTKIKLIEWC
FT                   ERKSGSIARVELKKGYPIINMEFLLYNRFNEVIINIENYLKSKKSLISSKLILKKHKLD
FT                   IIFSKLIEETNDINIFISSLYYYLTPLISEGIYWKFRNKLQESVCQSFCIDPKPEREIY
FT                   SFSRKNSIEKSPGSSNFTLKENFNFFIDEISSVYSSDIRKIRVRIIKNLLSKPFETPYE
FT                   ALKNKFPTIKDIFKDIESSGIITGFDHWYRIQSLNSKVYDCTYIDRISFICGGISLNDA
FT                   IILLLSISFKNSSNYSYSTKCNALKTLFQIASIKNIQKRYPKYDDLQVIWLHNYYMIYF
FT                   NELHIPQDFSKFYLSEKVGLARSLWREFNNRKDSYKLLKPNQIHLDQIEDTKDAEFLKD
FT                   ENRKRKVRCIVGKENEYSNALYLSSNTRCQSVDKKLNQILYLITKLCLDFGIYDSNLFS
FT                   NTIKNLYLQLFDENDVKIFSNLIFAAYISGYIYKVKINKSIIDVWNLLVLDPIFLLKNT
FT                   VEYISNLINKYAQNGKDKKECVYNNNLLYNLPNKRFIIPILSKIFNTCPVIPFIEVFEL
FT                   LNAIIELINSILNLKKLIESLNSFSKENDRRLINNILSFFTNLIKDISENNKINSLEKR
FT                   CKLSSIMRDKNFDIYEVNSIFDVAIIELLFSYVNPVDLHYALFSMNREKIIKVIIDKKD
FT                   SFNMLPYLIYSTNSNILASALSNELIKTNNSKLFFEIGAQLDELIDFKRKSQVEEIYLM
FT                   ESIKATQVYEFIVNKYKNIYSTESVRIIRRCIEFYKIEAIIPLIIKFLSGQVKSESAIV
FT                   EQISLLENRANNHELSKKEIYNYIKEVIIKLSKKYKSTNIVQELIDQLKS"
FT                   /protein_id="XP_626853.1"
FT   gene            <741512..>745144
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2970"
FT                   /db_xref="GeneID:3374099"
FT                   /locus_tag="cgd3_2970"
FT   mRNA            <741512..>745144
FT                   /db_xref="GI:66359351"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2970"
FT                   /db_xref="GeneID:3374099"
FT                   /locus_tag="cgd3_2970"
FT                   /transcript_id="XM_626854.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        741512..745144
FT                   /locus_tag="cgd3_2970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein with possible plasmodium
FT                   ortholog and cryptosporidium paralog"
FT                   /db_xref="GI:66359352"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2970"
FT                   /db_xref="GeneID:3374099"
FT                   /translation="MRNIDFFEIFKRLDINYTNKQVNSCSSINLKKDSIQQEVNSKENQ
FT                   PPESGGYKHRENDGIYLDINFNSNSIALQPCIAIKEKSFRLPIFELTYDFQMPNTTYQV
FT                   KQNSRLYEEIYSLVYANYSNIIINEITPSRKIKISETKPIFEISEKEGNQYSIFWDDED
FT                   IKSNSSILLGEFTGLLYNDEKKYYNKYSFKLPNVSNEELSVILDASHYCNEFAFLKHCR
FT                   LPFPFDDQRIRPNTQLQWLFIDKWPHLVVLTIPGIEIKQGDELVVDFGNNYHMYYVNSL
FT                   KTIFKNIIKIKAENTQIFQICTVCRLELEKSIIECKKCIICREYIHDKCGYYYKNSGNS
FT                   VCCTTCLKKSFNIIFGINKKFDYPFSGTNNSSKDSIISILKIYDGDACEECLSLFRKKD
FT                   LELERCKSAFFCKLLHEFYQVDKHPDNIDSFYAEYNSKNETEPKSSINMDIKALENIYY
FT                   IFERLVKYLKDFYDENSVCERLKFESYFSQDNYVGYSNRQSKCLFPDSLIYETWGKSKW
FT                   KDFIFWDQAKNSWVGLLRPNGIFSRFDCCNKYPTIIESFYETEKWVEQRISETTIPKNL
FT                   ISAILNNSDKGSNCNEKDYSKSQEDIVSHTYYHSPYLPTDLASHPDFKIFSNENGNKYQ
FT                   GNLPPVNETNNLFSMNDNQLLNGKLKNANATHSVESELFSFSNSPEFLLNDIRPRVSTT
FT                   GYIQCCSPVNRKRRIRSTLPLTSNAAKCPTEWRVRGITWHAERKAFIVPYRRDKDGGLT
FT                   STTFGAMKYGSPLTAFLKALEFRENYLKEQATKLPEEIKQPSVICDQALLIRNLPNIIW
FT                   DSNKLVWRALADEELLCNNNLTHKLTFYTQDIEINAMPYGARIAYEIAEVCYIRRKALL
FT                   LNSKVNTIKNSSVSRIRNKSNSLEGHGDEYQLILEDQNHLLLPKNSQMDISNSQSSCFK
FT                   QIRLKIIFPNGEEVIRSDLIAWHFRSNSWIITNMIDGSTSNQTKNISFLNYSDSNIKQK
FT                   SLIQSLIYAIECCTSIPPKCQVYVHAEEAESIIDSEDLAELLKPFPTGISWYCKKRRFY
FT                   TSNGLDSNGRGQHFSIALYGSLISAFNAAIDYRNIFLKNRRKAILPKVEWILCFPVNQC
FT                   STNTGSNERISDSDIINNRDIVKELDSCNIYHLSDNYMGSCNDRNIDRINSQISSLNTC
FT                   ISGDSYHSGSDWLQHPTTVSLLDDQIIEPQNDLDNRIMNIELIE"
FT                   /protein_id="XP_626854.1"
FT   gene            <745200..>748796
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2980"
FT                   /db_xref="GeneID:3374097"
FT                   /locus_tag="cgd3_2980"
FT   mRNA            <745200..>748796
FT                   /db_xref="GI:66359353"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2980"
FT                   /db_xref="GeneID:3374097"
FT                   /locus_tag="cgd3_2980"
FT                   /transcript_id="XM_626855.1"
FT                   /product="conserved COOH terminal-specific cysteine rich
FT                   domain"
FT   CDS_pept        745200..748796
FT                   /locus_tag="cgd3_2980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved COOH terminal-specific cysteine rich
FT                   domain"
FT                   /db_xref="GI:66359354"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2980"
FT                   /db_xref="GeneID:3374097"
FT                   /translation="MNRNSIISQCNVDPTVFFYYSGNNFHKKLGLYFIDDFTYENINKI
FT                   FEHTNESKLTFTPAIGEISDPIFSGETSIEYSSEFFPRFSWSKNDTFGAFTTGISREIK
FT                   ILYLNKGQLQISEEIHTPDYFCSCLELNNYVNFHLLASSNIKYFNSQNFAQGIISIIDS
FT                   NTKQNIVNYHKGSSFERLNNISGYPNNVKWINSNCLVSGWKLCNYSSQLHFYDIRAKDA
FT                   IFATNIMTNCNELLAVSQTGGNYLLSSNLNNIICIFDIRFMKNEPRQNIIQTLNCIYFN
FT                   DNEINDIQWFPNGELNISIYTNDGIFIAELNKEINSHISFEAYKSDNRFENIYWNENLI
FT                   KHYKPLSLKEDFSDTFCWVNYFGGSNNKHSLVYTTSESAYLLSNLEIKINSFPTFRISP
FT                   LDSHSIDTKHKPQKINYRVSNSPKLFGYSWIPYRIIKYYKNDKKIEEYNCIELLRRLEN
FT                   INSTEARNLVINQNDQKKLIDIGIFPLALNNLTNIIKIIKSASHAFNYLSTLPNRIIHW
FT                   KDILRQFNKQGLFSGENVSVLDKLMLPGIRDLVYIFKLEAGNSDISTQLRFINVKYEDL
FT                   ENKSSKCLNMRENFHHIEIFCSPFREKLINLFGVSSFIIETPIFIDNNDPIQLESFLIT
FT                   FFWNCITLQYQNFISHGDKLSNILDNFIDNENKLLKSSFLKNIKLFFNSAGIFISNLYS
FT                   SEELNKISLSRKDIQFYYYSIISTSEHLLDEDYYLPIWNSNIHFESSLQLSIRFIVAFS
FT                   KFINIHDQNKQFSSYLLDELLIPSMRINSYIYIPANLLLLIGIYYLPLEEICNLIEIII
FT                   RKMAQNGFLDGISILGFNTFTDETFLLRSFPDNYNSEQFETFLGNFNLNENLDSIFLEP
FT                   ENNINKNFGYNLSSQVFLNLIFRKYLSLSFGDIQTVALIGSCIPNLSGGLKKNMELLKI
FT                   CIDEYKDLLKNNSLIYYLIYSSNIIGLLKNGSKSAKFTYNNVSGILYELNILRSSYYKM
FT                   IHIDQDQLKPLLPTGNILFCYYCEQPLCQAYFEQSCFFEKSNSNMDCNSIISQSFNTDL
FT                   SEVQLDKKEIVFKNIYNRDYQVGYSLRWTSSNKSSINSLIQPEAIQSLELSSMILNCPN
FT                   KYCNKPLPRCVICLTEMSINVISNSINDDAAQKDCTQQCNYNKLSKWYTWCLHCHHGGC
FT                   FKHISEWFECFDECPVPECNCWCNSVDRWHKL"
FT                   /protein_id="XP_626855.1"
FT   gene            complement(<748868..>752080)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2990"
FT                   /db_xref="GeneID:3374096"
FT                   /locus_tag="cgd3_2990"
FT   mRNA            complement(<748868..>752080)
FT                   /db_xref="GI:66359355"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2990"
FT                   /db_xref="GeneID:3374096"
FT                   /locus_tag="cgd3_2990"
FT                   /transcript_id="XM_626856.1"
FT                   /product="hypothetical protein with signal peptide and 7
FT                   transmembrane domains"
FT   CDS_pept        complement(748868..752080)
FT                   /locus_tag="cgd3_2990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide and 7
FT                   transmembrane domains"
FT                   /db_xref="GI:66359356"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_2990"
FT                   /db_xref="GeneID:3374096"
FT                   /translation="MSVKYCITSIFCICIYLFGKVEASLTDIPWSVSTPYILSSLEKAQ
FT                   QVINYSRVSTLEEFVSENCGRYDKLQESDLAYKKEMWESFKSWHSDYSVLAGIIFENAI
FT                   IADSNKTHINLKPLISSYLDALIWREIASCIIFGISIFTFIAVSLGFVLCRVMNDRVVS
FT                   FEETSNGLWKVKLSIYILSTLLCGLCVIYITLSIVIIVNFFAFSDSFLTSVCWFAIGAD
FT                   AFSNGNININTTSGSFSIAKSFLKTNTTVPFIGSLPLYGLFQELGSVETLIEFFKDTIN
FT                   YIRSAGFPTALSIRLNELANVFTNSSVINPNGIDWYIPAKELLKNSVLNAVNSFMPVNE
FT                   TLFNSMIPVLNKITDIIKSVDTSSMSFSVNEYFEIFKKFISYILLFLNVSRTASNIVFV
FT                   IITVLCVSSTIIGVISIIFSILHIKLFLSGRSHIGFFQSRSALVAVAFIFMGLSTFVSF
FT                   VSYTLTVSGTVGKDYCGWIVSDLFSPIGMNWISTVSPELGMIMSICMYPLASYIKIKSD
FT                   NKRYLNEKDFITDRIRVLEYHGIKNHIYLDLFNKLQSDESKDSENIKDIFFNYSNKSPR
FT                   FLLNQNHLFSNESLKSELYLGDLSTKSRAMNKNDFISNLFLNYNNELLKSNSNDILLAE
FT                   RFGNQEIVGLLDDAPIESSLSYLLVQLLPGSFVNDMSKIVPEYINIISTSQAIAEQCFN
FT                   YMNITDYIKYSLMYFPDVEKSTPDEQDVPVLVLITQSYKEENWLMKSSIFGYTTYTALC
FT                   SSPNSNVSTLMISQSLPIKVPGLEVLESIIYPFKIKYLVDTSDTINGKQEKTEENPTSK
FT                   LSSLENIFEPTSSITEDNTNSEENLIISADTDIDQLAIEKYHKDNKHFKDYPISSFKHT
FT                   LVWVKKSMELYNHNFFCYPFSWIDIEGIKEIPNFGNNSLYIKYYNNTCKYVEFQEYIAS
FT                   ISYDYLINPTNFAANEVERLNLVLNDRIRKMFGSAMILNSIKTEAHNCGQVSVDFTNGI
FT                   VTFCGMVGRTKDTLIVILNFATFIGFAISIVIGIIWLISLRYESRIADSIMEMEQSSNE
FT                   SLGNVEQDDNVNVKINEADTNH"
FT                   /protein_id="XP_626856.1"
FT   gene            complement(<752199..>753830)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3000"
FT                   /db_xref="GeneID:3374093"
FT                   /locus_tag="cgd3_3000"
FT   mRNA            complement(<752199..>753830)
FT                   /db_xref="GI:66359357"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3000"
FT                   /db_xref="GeneID:3374093"
FT                   /locus_tag="cgd3_3000"
FT                   /transcript_id="XM_626857.1"
FT                   /product="TBC domain containing protein"
FT   CDS_pept        complement(752199..753830)
FT                   /locus_tag="cgd3_3000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TBC domain containing protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359358"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3000"
FT                   /db_xref="GeneID:3374093"
FT                   /translation="MTDFEVFENDEYYSKIEDSSFIDFFEYLKGNPKQNFIKYTENVCN
FT                   VKYVQGKNENILDIPRLKWMILLRIIPVDFFSLSIHDCYKKIHELLEMERSNYSRSFNK
FT                   NKLDISKVTSMDPLKFHPLSQIANNPWNEQHKNGELLDEIWKDVTRTYSERQLFSDSNT
FT                   RQLLQRILFTWTRENPDLGYKQGMNEIAAILFLINHSQKIVDNRVYSNGLESKNEYNGD
FT                   NFSLEHIFRSDSIEADTYIMFNSVMNVFGLKYMFKSTYNECNSNDNNSMKNDDSNKPPI
FT                   VHRCINIYGILEKVDYELFIHLYREHEIEPQLIFLRWIRLLFSREFSDLNNSIIIWEGI
FT                   FCDALQNGKFSNSEILMDGSAKGRKNINKEVCEAVESSLPIVNFIAISILLARRSAIVN
FT                   SDFNHTLKLIVNQSNLSISPLEILSNAKSLCYTVSAENECLNSPKLLSGSAFDDKNYKK
FT                   VLLSNQRSHFFEHRDIHYSQIRCNLNSEPELNSNAPKLNESLLEITKNLYNSAKDIKDI
FT                   EQVKCNVVSSCRELLRICKILQEKNI"
FT                   /protein_id="XP_626857.1"
FT   gene            complement(<753863..>761128)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3010"
FT                   /db_xref="GeneID:3374094"
FT                   /locus_tag="cgd3_3010"
FT   mRNA            complement(<753863..>761128)
FT                   /db_xref="GI:66359359"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3010"
FT                   /db_xref="GeneID:3374094"
FT                   /locus_tag="cgd3_3010"
FT                   /transcript_id="XM_626858.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(753863..761128)
FT                   /locus_tag="cgd3_3010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359360"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3010"
FT                   /db_xref="GeneID:3374094"
FT                   /translation="MNNLLIKLSNRYFYRYPYVKKDVAQIIREIGLGLEIDFEYGNAEG
FT                   KICSTDVSSISRSCCLILLLIAFVENNRNLKRKLLNYLRSFMQKSKIIQPNISEYTQFV
FT                   LDSFNNLVNFVVENMIEDINTDFYTNNSNLLKGENQLLIEKYIYSVQFILNDLFEMLVS
FT                   SAGLNNKETLRSNNVLPILFEGIYNLDLVLKKILIYLLQTPDFAYKITSFLNSNNMENT
FT                   IDHYFEIDQQILLSIISILNRISSIVICCSNSFSSLIKYTKILFNTVLGEHKDGKITKK
FT                   VINSIFYRILCSNSLDKFNKDLITSIGLFLSLLYISEQVTYDDKNDLYIKSMNKIAKNV
FT                   KEHVQKCKFSNVCQVAFYRGLVLCCSMIHDAVQFKNPINNHEIFEVSFHSLACLITDYK
FT                   SDEDSAYGLQSLVIWISRFKYEISSIDKTSINLSALCFYLTPISDIIFSFLDQPINYHS
FT                   KLANQILEEFVDYLLVLDSIFEQDIIEEISSGPLNWFMNLILNNSFNNNKNKFLSLNIL
FT                   FNGILNHSKNHKFKNQFCKLNRFINLSIDQLDLTQLDHSFVEIQLIYYLVYSLSIHNIS
FT                   SSSQNLILAWFNLGKRVFLKEEINNGLEENFFLDFILFTSIQIIKRDHNNFEKKEIITP
FT                   EGKSDIFTRILQILKKADRKYYYEKLPLIFDRFFEEILRLDNSFITELNFIQIQTLIEL
FT                   KRSECLFWENEFEGGDYLTNNFSLVVIFDSKKKPYSKIHGDYFIKTLTSNNSISLSRIL
FT                   ELLSLSIKPSEMKNLSERNCLLNEMECLYIIICNIKPLNICSGVLSRIISIFGQFFILS
FT                   NKILLNKTFPLKIRDVYYSWLHKIFNFLRTSIGLQISSDKVDLYLPIFLLFLETFSFED
FT                   LNGDLFDCSIILKRCIVESVMPNIQSQLFSSSNECKNLVNNLLINNKKFCKIFDQFHFN
FT                   TIQPHNLPSFNRAFSILKKLSKIIRPREYYVSNILLYYYMKKLSIDLESQRESIIILLK
FT                   TLFNLKNFEMLDIINNIYFFLSEVIFFELITRIQNFCSNNFDINVLIFGNNNIPLQSII
FT                   NLLNMSFISEFIFNSENNFKRLCWNLLKILYLFTLLLFILSDSEFISNYSNKFHDELIQ
FT                   ELDPSERFYNQNLNQNFSRIIEEVCNFIKIILAKITIDSIFEESHNQLNSIPNDFITSN
FT                   LYLNSFLNRLNIAFNSKKCYYFSYKLCIIYINFILKCDHPGSSENLLEIFYAIINSYST
FT                   KLFESSHEKQSKNKGFKLPITRIHILINNEAAKTFNDFILMSSHSILNKAKIQDLTYYK
FT                   SSLNKQTDNLPKNLLLHILYSLLSFDELSSDCNNDKFNHREVENCILDYEQIDNIFFQF
FT                   FDGYTKSGYVNNEFITTNSFYDTNKLFLLHGNLNNNLEKLYIPPPKRKSNNLCNIINIL
FT                   VSIIIKDFKLHKLVKYTIKLLIIASLNINLFNGIINKQDYDSDYILFQRYRCSIHSNHI
FT                   LAKLISKSKSSSGTNTLCEIFDLSLLCGSLFSAFNNIKIYDLKVKDENGFALCNSSLNL
FT                   MSALLKRFSFKANGIESNIEYISKTNNRCEILNNDFKTTPGSDDLPILFNKVLKDVLSI
FT                   VLNKQFDYNCVNSLISEINTSTRFSLKSIKRISGIFEPCIIDILLNSTHTQFQGMVLLL
FT                   LTEISISWADCSYELAICIIKSIYSSSYFVRMYSSKLLGEIIFLTLNIPNLSLHPLNEI
FT                   SNANLDGILLEIFINNSNNQASKANSLLNLIFQSIKFSINNSENKYNLIHGILNLGIVL
FT                   MKKFKNQSCWNSFKSIDNSIYENLLVFIRDSFTTFKHPLLRITALELMSLLFELEFPIN
FT                   EKSNCLENLIYYWKNISSKSKTLYIDFSNLNNNLYLSISHPKNYFNENLSEHIYLIKII
FT                   VNNVFKYIDSGELNSLICLSPAFDKIIHPKILLEFYSSIIDILSISEKKDTFVQKLFNL
FT                   IDNNLKSIKHLISANNKEQYINEKTKIRKLSILTDLVKVLTGCLSFIGYNYKLSFVFLE
FT                   NEQSDSIIESVFDLIYHQELSKYKTSEGEDENSEEKTDIDLINSKIGRFFFEDQIAILE
FT                   FSIFFIRFYKNIARHDSIPYFIVYELEKIVFDKILKMVCNNICNGTQLTLEKKCLICKI
FT                   IRTIFESLETELFLEIKVEKNDRIRNLFCTKIGINDIHEGTILFLLCFNHNYWYNLMVC
FT                   LIYLITDEAASIENKAILTFNSFIHIIKYFCSNFLHQNEDSHGSGLNCYNEYENQIKQI
FT                   VLLNDQNSCLFSIIILDVISESLRSMETQNNSVFFPREIDNICNEYLNISQVATCQIFK
FT                   YFKAISQKTLNSDEISKIELHFEQWGTQIKSQINLFKRVYDCIKECPTQLISIELFGSV
FT                   LIDEVSILTFVISIRKLIIISKYREINNREDIFENSSFYISFFEKRLDFLLSNIHEKKI
FT                   NFSNYNAKDFAGNLTK"
FT                   /protein_id="XP_626858.1"
FT   gene            complement(<761774..>762847)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3020"
FT                   /db_xref="GeneID:3374095"
FT                   /locus_tag="cgd3_3020"
FT   mRNA            complement(<761774..>762847)
FT                   /db_xref="GI:66359361"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3020"
FT                   /db_xref="GeneID:3374095"
FT                   /locus_tag="cgd3_3020"
FT                   /transcript_id="XM_626859.1"
FT                   /product="possible guaning nucleotide exchange factor,
FT                   eIF-2B"
FT   CDS_pept        complement(761774..762847)
FT                   /locus_tag="cgd3_3020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible guaning nucleotide exchange factor,
FT                   eIF-2B"
FT                   /db_xref="GI:66359362"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3020"
FT                   /db_xref="GeneID:3374095"
FT                   /translation="MEKKNVVQNIFNCPICPYFGRNSISHSFISILDQSKIHPAILRLG
FT                   MRMKDRKIVGTNMRSKCLLIAIGQMLEDYYCPPYKSIEKHLKMVLDVHISYITSQRQHN
FT                   IAMGNVIKWLKKQICKINPSLPPNEIINQLISSIKTYIYQRIVNACERISYLVSNKYIT
FT                   DGDVIVTYSNSSSVIKSLFKAAEMNKNFQLIVVDSKNNLDSSSQDIAKKLSLKGIKITY
FT                   TLLNCLAYHLRYATKVIIGSCAIFSNGYVMNRSGSSLVAMLANIHHIPVMIVSESYKLC
FT                   EKNYFEYSTVFNEVVEQGISDNLQYVPENSESLPKPQIATFIPCYDVIPPKFINAIVTE
FT                   DGIFSAESFSIQNKPIN"
FT                   /protein_id="XP_626859.1"
FT   gene            complement(<763047..>764747)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3030"
FT                   /db_xref="GeneID:3374069"
FT                   /locus_tag="cgd3_3030"
FT   mRNA            complement(<763047..>764747)
FT                   /db_xref="GI:126644802"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3030"
FT                   /db_xref="GeneID:3374069"
FT                   /locus_tag="cgd3_3030"
FT                   /transcript_id="XM_001388081.1"
FT                   /product="MAPK, putative"
FT   CDS_pept        complement(763047..764747)
FT                   /locus_tag="cgd3_3030"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MAPK, putative"
FT                   /db_xref="GI:126644803"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3030"
FT                   /db_xref="GeneID:3374069"
FT                   /translation="MKITKNITVNVEDGSTYTVPEHYKFIKKVGSGAYGCVVSFYDKSR
FT                   GSYIAVKKIFDAFQDLIDAKRILREIKLLRQLQHENILGIIDLLPPDSPNFEDIYIVTQ
FT                   LMETDLHRVIYSKQTLTNEHIQYFMYQILRGLSYLHKVNIIHRDLKPSNILVNLSCDLK
FT                   ICDFGLARGNVCDIDKSKDELTDYVVTRWYRAPEIILCVNRYDKAVDIWSAGCIFAELI
FT                   KRSALFAGHDHLDQLKAIISCLGTPSRDDLDSWLPYKGSTENARKYLDTLPNYKGRHIS
FT                   TLFPGFNCPEAIDLIEKMLSFNPKKRITAEEALSHPYFNGININSGYDSPKSSSAHNIQ
FT                   FKSNNSIEPELISLDSNTTDSIDWSFDNFEPTKRLLQNKVYEEIADFHPEILIRDFPFI
FT                   HHLGINVPKKHLQMLRSKYATNTLRGKDRINAYMVDSLMSTSSSTSITPSNSFDILGTI
FT                   DMVKRLSIVHKQNRMSNSQPAQSGTIIPSNDYDVGSEGLLLHRSQELCLTTPALQKRTY
FT                   PFISYPSDSESGNDANLNMENTVIGVGQRVKSTTDNLKRIAYGKTESNI"
FT                   /protein_id="XP_001388118.1"
FT   gene            <765322..>766500
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3040"
FT                   /db_xref="GeneID:3373827"
FT                   /locus_tag="cgd3_3040"
FT   mRNA            <765322..>766500
FT                   /db_xref="GI:126644804"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3040"
FT                   /db_xref="GeneID:3373827"
FT                   /locus_tag="cgd3_3040"
FT                   /transcript_id="XM_001388082.1"
FT                   /product="protein kinase, cAMP-dependent, catalytic chain"
FT   CDS_pept        765322..766500
FT                   /locus_tag="cgd3_3040"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, cAMP-dependent, catalytic chain"
FT                   /db_xref="GI:126644805"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3040"
FT                   /db_xref="GeneID:3373827"
FT                   /translation="MDGIWKRLVSGGKNHSSKEGGNSQKNAVAANNRTCENGRSLDFNT
FT                   NNKSHNNPNNDTRYPATSNMNKHDTDISGNNQKKYSIDDFQLIRTLGTGSFGRVFLSKH
FT                   KEDNSIYAIKRLKKSVVIRQKQVDHITNEKAILSRIKHPFLVRMFGTFKDDRYLYIMME
FT                   FVIGGEFFTYLRRCRHFDNETSRFYAAQVVLMFEYLHGKNIIYRDLKPENILIDKDGYL
FT                   KLTDFGFAKAIEYRTFTLCGTPEYIAPEVLLNKGHGKPVDWWTLGILIYEMVVGFPPFY
FT                   DDEPMGIYQKILAGKIFFPKYFDKNCKSLVKRLLTPDLTKRYGNLKGGVSDIKLHKWFY
FT                   NYDFNSLISRKVDPPYIPKVNSYDDSSNFEEYPDSHEQPTTVTGNADPFVDW"
FT                   /protein_id="XP_001388119.1"
FT   gene            complement(<766669..>767628)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3050"
FT                   /db_xref="GeneID:3374092"
FT                   /locus_tag="cgd3_3050"
FT   mRNA            complement(<766669..>767628)
FT                   /db_xref="GI:66359363"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3050"
FT                   /db_xref="GeneID:3374092"
FT                   /locus_tag="cgd3_3050"
FT                   /transcript_id="XM_626860.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(766669..767628)
FT                   /locus_tag="cgd3_3050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359364"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3050"
FT                   /db_xref="GeneID:3374092"
FT                   /translation="MSIRREEEERRFCQNISPRGCRKENVKKDQLEFEGVDGDEFKDIN
FT                   PVYGCLVPCLKCCIYPCRAFFLTGRCISQKRRMKKAKYSKRKYNNNNAYSYNANNQKPQ
FT                   YNQFYSASSNIGVSPNLQGSINADGSVKGNLRHPTLAGNCITPICSGSSASFCTIQAEY
FT                   PSNRRSVLPSSSSYGPRRYVEKTVESPIFNEPNKLTCNCLGNSHQEIEFEERYDNIESN
FT                   SFHKIVDNTLSREIIDENYFIKHSENQSNEFKDFFPENSERECFCIEECFEHNLKDNKA
FT                   YPNKGNLLTNSIFSSCTPCEYSDHVSLKYSQGNCFVDN"
FT                   /protein_id="XP_626860.1"
FT   gene            complement(<767862..>771662)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3060"
FT                   /db_xref="GeneID:3374090"
FT                   /locus_tag="cgd3_3060"
FT   mRNA            complement(<767862..>771662)
FT                   /db_xref="GI:66359365"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3060"
FT                   /db_xref="GeneID:3374090"
FT                   /locus_tag="cgd3_3060"
FT                   /transcript_id="XM_626861.1"
FT                   /product="putative exportin 1"
FT   CDS_pept        complement(767862..771662)
FT                   /locus_tag="cgd3_3060"
FT                   /gene_family="HOG000284126" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative exportin 1"
FT                   /note="CRM1 homolog"
FT                   /db_xref="GI:66359366"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3060"
FT                   /db_xref="GeneID:3374090"
FT                   /translation="MDISLLLDLSQPYDLQKVEMLDELVGVMYGLRPGDRIIADKILSE
FT                   LKQKTDSWRIVGNILQLSSDYNTKFFALSILEKCIQFQWKILPFDQKTGIKQYITELCI
FT                   ELCQDEKILNENKHFLNKTNETLIMIVKQEWPDNWENFITEICNAAKTNQYICENTMKL
FT                   LRLLSEEVFDFGEDQMVSKKVEKLMDILNQQFPQILSLILFVLTSYLENPQNIKVNLVV
FT                   SSLQCLCHYLKWIPLNYILECDLRPQLPHSIASNGNNNIIYNLLQFLLDHFWGNPSFRL
FT                   ESIKCLTEISPLKFDENTKDSNGGLNKQIEDQMVQIWLSIVNRIKEVPNEYAQYDSMPN
FT                   VSTSTRLYYERYFNYIALLLSSFIKTHRLSICEKYPETIQGMDFALERMVNISYIQNDE
FT                   IFKVCVDFWLHFTQQLVYDVLDNSKKKSNDSSMMNSQAKSSPLFLLKNDTFGNIDNSDP
FT                   HRQENPFNNPEEYSSRLVHYQSLLCDVRKMVICRMAKPQEVYIAIDPETGEVTRENIPD
FT                   TDEISLYKSLREILIYLSNLGQNYMEKIILQLLQEEFDVVCINCGIICTCNSSSGNQWN
FT                   PIKLNRLCWAVGSISGSLSKNIERRLIIEVIKSLLMLCERKRGKANKAAVASCVMYVVG
FT                   QYPRFLRDHWKFLQTVINKLFEFMHETFPGVKDMACEAFLKIATKCKKSMSSNNFIDGN
FT                   NRSSSNQMLPEIIDGGSQEIKFLKYMIGYSHELKQHLDDKQILILIQGISLTISSLKDV
FT                   DEQYLYVTELLLIFDSLYWKDIISRLVELRSNPDNQGIINELCSMECSQKLIIIVRIME
FT                   TIASSCGVGFARVLIERSSFLVELYKLYSNFIAGEVQRKGIVIISHAHIKQLRISKKEI
FT                   IKLINSFISFIAPRKKLKLSENKNLSGYITDIQSILYHNITGTEMLQYIIHPIIIPVLE
FT                   DYHACISEIKESQVLILSSTIIVRLNDIVKANNDLFNAIIYHLFESTLSMIKDNFHAYP
FT                   DHREFFYSFLADCNEFCFLQLFNLPGNILTLYIESIIWAIRHEQPNMAEKGLIVLYNFL
FT                   INLINHNSSKNNGIQSSCAQSNTLFQFCHAFYLSIIREIFCVLTDTLHTSGFQYQTMVL
FT                   YELIKISEFSLFEGNQGNKQTNIASNSSLICDSCQGTTCKISKVGVMEYIADLLIKSFI
FT                   TVQKEQVEVFVLELFNSVHSKTISDFQRLVHDFLIQIKEFTNEESKQMFEIEKSIALKR
FT                   AIEIENSKQWMIPGLINQEIGLNSNSGEGDDDDIEDDDEDE"
FT                   /protein_id="XP_626861.1"
FT   gene            complement(<773383..>775170)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3070"
FT                   /db_xref="GeneID:3374091"
FT                   /locus_tag="cgd3_3070"
FT   mRNA            complement(<773383..>775170)
FT                   /db_xref="GI:66359367"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3070"
FT                   /db_xref="GeneID:3374091"
FT                   /locus_tag="cgd3_3070"
FT                   /transcript_id="XM_626862.1"
FT                   /product="WD-40 repeat protein, SMART LisH domain"
FT   CDS_pept        complement(773383..775170)
FT                   /locus_tag="cgd3_3070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD-40 repeat protein, SMART LisH domain"
FT                   /db_xref="GI:66359368"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3070"
FT                   /db_xref="GeneID:3374091"
FT                   /translation="MDHVNFSNVNVLKLILQFLLESGLLESYSTLSYESGVSLNWIESV
FT                   DEIRTIISKGHWNELIEVLKYIKIPANLQIILFEHIALELLELKEPFVAQYLIENNKSL
FT                   FLHNQFDEKYNTLLEIIEKSKNIISNVKNNSVELNYSSILTFVKNSYLEGESKEKSRER
FT                   LSKLITENFIEVRKSLLLEVIGDSLKYKSTLELDNEEACENLGFDHNENNFTCGRKQLQ
FT                   FNETKEFKLFKSSSTIINTEQFGDLCCITFTPSGEHIFATSKGYIIIGNANLYGFTNKN
FT                   VNSKNIYSHCEEEVKVLGLSATCIKNQVSFGNKFENDHNSDRIIIASTSEKADIKVWDY
FT                   SNSNFIFCVNAYESYITDFVFNKDATCILSSSIEGIIKIHGLKSVRTIKYFPKKSEFFV
FT                   NKVSYNNSETMVISALSNGSINIWDIKSSSCIATYDICSSQILELTLVNNYDLLFSIQK
FT                   DRKLKKNIQTFDSFFIRSKSGMYLVDISNGETTSLPIGENVMKSLLFSTFNSKMSIIIC
FT                   LLKNSKIAIYDIINQNIKYEEINIENPCENEQILMDQISGNIVITAKNKLIKLYYSNQV
FT                   SNKVDTDSKISLISTNSKL"
FT                   /protein_id="XP_626862.1"
FT   gene            <776127..>779132
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3080"
FT                   /db_xref="GeneID:3374089"
FT                   /locus_tag="cgd3_3080"
FT   mRNA            <776127..>779132
FT                   /db_xref="GI:66359369"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3080"
FT                   /db_xref="GeneID:3374089"
FT                   /locus_tag="cgd3_3080"
FT                   /transcript_id="XM_626863.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        776127..779132
FT                   /locus_tag="cgd3_3080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359370"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3080"
FT                   /db_xref="GeneID:3374089"
FT                   /translation="MNNEISIDGDSISPSRRPSMATNNSANLIPESSIKILRNISEQLN
FT                   KLTFVSGIVVPKKQYFSEELFNKTSLYSDNCIKNIFKEDLVESQFNKLEMIKTSFNIIK
FT                   NEWDDILYRNTINKKNLEQLESRKVEFIGNTSCFQSICDTSISQLGNLESQARIIEEYI
FT                   FPYQQYTIIYYKLQNDKFSNNLKEISSCFEIIDNSIIFFKNHMELKRTDYYIEGYKKLR
FT                   VRLCCIIKNIMKNILKDCQVKNSVDENHNITEISSQPLDYNGENKGGYNISLYFTQLRA
FT                   KGKLFNEYIKLLMQRYKETLQNETYRSAIEEMERYYIDLRISDECCGVRSFIKFGSKKL
FT                   YSGKNSQNCLALNIKSFTRLVLNYCKYEWATYKSFFCCQETLNGKNENKIYEIQRLSRE
FT                   LGNKINASKKNIEFNNYFSSLIERFGNEYYNALILQIKAQRDPELLRESIQYLSQDIVN
FT                   ISNDLYQSVSFPDIYLSSLLHYIIKLQSSILEQLMYCTEAFIKEKIQDYELKVEELNYP
FT                   EILQLFSADKRLIRSLQPLEDSASNISTNRGHLSKASSHNNLMEGEDFEVTNKTLRPEN
FT                   NKHHYESELLTNVSFPPNKISLQTNSDAEDFLFEDEYFDIFQEESEKSINDRNTAPSNE
FT                   SCQKQNGRAINVSIGCYPVVKNTLLALSFIDNLVPNSSYLFLNKLIIQKCCDKLVSAKE
FT                   FICNEFYLNDKISRMYHGNLFIVRNLLYLKYELINLSKQNNCKGFDVFERNLCELESNE
FT                   KNLSNTKITESNLLIKDSNLLCFKATLDSIVNIVDVLINSNLEEMINNICSNISLPLTK
FT                   IVLQVHPEIQSSDIKELQCTNHKYIRESTELFWKNLKFHTSNYILKYLNLYLSIAGKEE
FT                   METLFYSIITEIGYEGDSKVDIDCKLSNESCNGEPTNFRNSGNLNSMGYEYDKAHLNSV
FT                   VSSILPSPMSIFLSVKEVLIGVIFEFDHVLNKRLGIEKSVIEEELDWKLQNIIKFLNSV
FT                   ENKLDAYENTNS"
FT                   /protein_id="XP_626863.1"
FT   gene            complement(<779133..>781037)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3090"
FT                   /db_xref="GeneID:3373826"
FT                   /locus_tag="cgd3_3090"
FT   mRNA            complement(<779133..>781037)
FT                   /db_xref="GI:126644806"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3090"
FT                   /db_xref="GeneID:3373826"
FT                   /locus_tag="cgd3_3090"
FT                   /transcript_id="XM_001388083.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(779133..781037)
FT                   /locus_tag="cgd3_3090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to protein FLJ37300, putative"
FT                   /db_xref="GI:126644807"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3090"
FT                   /db_xref="GeneID:3373826"
FT                   /translation="MERVRVVLRVRPNADGSDDEDIVDIRGQRKVIISKPGKKNTYLLS
FT                   QQTRYYEYTFDHIFPPNADQETVYNISTCNFLKNAISNGINLTVFVYGATGTGKTYTII
FT                   GNEKNPGIVIRGINETFEYLFSDERFVKDNNSDMSSSENNSSNELKPNSNFFVTASYME
FT                   IYNETIRDLLNPSNNSSNCQYSCEILEDQSNIQISNLTQLLIENSKEGIQALNFGNKYR
FT                   KIEQTVANNVSSRSHAIFQLSIFLERKKLFNISANNNPHKFIRSNNYRNDHFPSEKLYK
FT                   PSINNSTNPQLWCKISFIDLAGSERASATQNRGIRLTEGAHINRSLLALANCINSLALS
FT                   SSSIDGQSILNQNNDNRYHVKYRDSKLTHILKNSLEGEKCFVVMIANISPSSKAFEESH
FT                   NTLKYANRAKNIKVKISNQLLNDNEENDLSCTCNCNIGINSFDQKVKSKKKSQIESSSQ
FT                   TIISGLVTVEEKKIFQDENNYGLNLIHHINNNIYDVINSLSEFSSQISSKKVNETIIEN
FT                   NSFSEKENNSLFQQSEINYSDKQLNRASFVSTQSNDEINSLEISKVGESMCIIELFKEL
FT                   ESKIFIIMADSLNKLKEIKLEYNETLNSEALLLKKIQELAEDFSIKRQKKYTESFINE"
FT                   /protein_id="XP_001388120.1"
FT   gene            complement(<781370..>783205)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3100"
FT                   /db_xref="GeneID:3373884"
FT                   /locus_tag="cgd3_3100"
FT   mRNA            complement(<781370..>783205)
FT                   /db_xref="GI:66359371"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3100"
FT                   /db_xref="GeneID:3373884"
FT                   /locus_tag="cgd3_3100"
FT                   /transcript_id="XM_626864.1"
FT                   /product="12 transmembrane domain protein MFS family sugar
FT                   transporter"
FT   CDS_pept        complement(781370..783205)
FT                   /locus_tag="cgd3_3100"
FT                   /gene_family="HOG000284255" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="12 transmembrane domain protein MFS family sugar
FT                   transporter"
FT                   /db_xref="GI:66359372"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3100"
FT                   /db_xref="GeneID:3373884"
FT                   /translation="MDKQKNAQEKSIPFNQGPIIDQKVYDNNSKKKLKHFNSSCSTLSN
FT                   NSGSSVELYEASELQRLHSIALRSIAIVCLAASLDGCDEQLLPASLRALEVDLKLSPKD
FT                   LGNIILCQILCLALSCPIWGLLADRYSRKYILATGVTVWGFVTILLAFSSSYWEVLITR
FT                   AVNGAFLGSVGPLAQSVLADTLNSKNRGLGFGMIQLSSCVGRVFGAVLTTSISQKLIVG
FT                   FQGWRFAFLLVGVLSAILGGIIVFLMDEIPHLHLHRFRSIRSDPNSESEQEPLEQQEQS
FT                   EFSISVVARPDTGGADSDTQSVIGTMSREEGQRDSLLNTFNTNRIFLHDENEEISDIID
FT                   ENVSTLQFMKNVITQSLIVKSVILMILEGISGTIPWSSLTFMTMYLQYCDLSNFQAALV
FT                   VATMLAGSMIGGPMGGLLGDCLNRISADHGRPLVGQISMAIRIPIMCILFLVIPKESSS
FT                   FYYFMVLSFLMGFFAIAGAAASRPILSDVVRASHRATVFSIAVLFEGISAATFGAPVVG
FT                   ILSENVFGYKTTAENVSQMNADSRLINANALANALVFLTVFPWCISLLLYSLLHFTYGN
FT                   DKRSLKIELSEISGYTRTIRSRLESNGSDTLSNRS"
FT                   /protein_id="XP_626864.1"
FT   gene            complement(<783405..>784676)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3110"
FT                   /db_xref="GeneID:3373883"
FT                   /locus_tag="cgd3_3110"
FT   mRNA            complement(<783405..>784676)
FT                   /db_xref="GI:66359373"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3110"
FT                   /db_xref="GeneID:3373883"
FT                   /locus_tag="cgd3_3110"
FT                   /transcript_id="XM_626865.1"
FT                   /product="transcription factor TFIIH with a vWA domain"
FT   CDS_pept        complement(783405..784676)
FT                   /locus_tag="cgd3_3110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcription factor TFIIH with a vWA domain"
FT                   /db_xref="GI:66359374"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3110"
FT                   /db_xref="GeneID:3373883"
FT                   /translation="MDFAEKLADTSNNSLDEQEVVYSWEQGLIKNWERLVETESGLVVI
FT                   DDETRFDSNNADESYNIELLKRGPNTNIRRGLLRNIVIILDMTSNMLELDYKPDRLQCM
FT                   VKCNEIFIKQLLEDNPLTQISVISIYDGIGEVIISYNSNFLEIMTSILNYLKKGCKGSM
FT                   SIQNGLEKAKYLLVSIPPYGTKEIIFFLGSMRSVDNSFLFNEWVEGFSSNNIIINAILF
FT                   IPELYIIKTITKMTGGVCLCAMNNDHLLKLTLENFIKPPPNNIASTPLNINLVTMGFPE
FT                   YVSNQTHPFGCSCHRSLTHRGYSCPKCKSIVCYLPTKCPVCLIYLISPNHLAKSFAYLF
FT                   QHPDITPIKNGEYSKIESSSIKTKCELCESQFSNNVYLNSGSRSNIINKYLCTNCSTQF
FT                   CNECCKFIFNTLHQCPICCSLRIS"
FT                   /protein_id="XP_626865.1"
FT   gene            complement(<784931..>785938)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3120"
FT                   /db_xref="GeneID:3373882"
FT                   /locus_tag="cgd3_3120"
FT   mRNA            complement(<784931..>785938)
FT                   /db_xref="GI:66359375"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3120"
FT                   /db_xref="GeneID:3373882"
FT                   /locus_tag="cgd3_3120"
FT                   /transcript_id="XM_626866.1"
FT                   /product="AOX1,alternative oxidase, possible fungal or
FT                   bacterial origin, 2 transmembrane regions"
FT   CDS_pept        complement(784931..785938)
FT                   /locus_tag="cgd3_3120"
FT                   /gene_family="HOG000178442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AOX1,alternative oxidase, possible fungal or
FT                   bacterial origin, 2 transmembrane regions"
FT                   /db_xref="GI:66359376"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3120"
FT                   /db_xref="GeneID:3373882"
FT                   /translation="MYYVRNLSNTNKLRYFYGRHLWLLSSKVNLNNLCSIVHSNKGQKI
FT                   TSKLYITLEKDRSSNNQGDFSKKRTLECKSDQINKFDAENEEKVGSHFMKKSNHAASIL
FT                   EGKEYGFNSPIWDLEEVNNVQKTHLCPNGFKDKMSYYLVIALRKSFDLLTRYKKGHNEY
FT                   QWCRRIIFLETVAGVPGMVGAMLRHFSSLRKMKRDNGWIHTLLEEAENERMHLLISLQL
FT                   INKPSILTRVSVIGTQFAFLIFYTVFYIISPKYSHRFVGYLEEEAVSTYTHLIEEIDKG
FT                   LLPGFERKAPKFASVYYGLPEDATIRDLFLAMRRDESHHRDVNHNLADIRLNGE"
FT                   /protein_id="XP_626866.1"
FT   gene            complement(<786206..>787159)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3130"
FT                   /db_xref="GeneID:3373881"
FT                   /locus_tag="cgd3_3130"
FT   mRNA            complement(<786206..>787159)
FT                   /db_xref="GI:66359377"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3130"
FT                   /db_xref="GeneID:3373881"
FT                   /locus_tag="cgd3_3130"
FT                   /transcript_id="XM_626867.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(786206..787159)
FT                   /locus_tag="cgd3_3130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359378"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3130"
FT                   /db_xref="GeneID:3373881"
FT                   /translation="MFCRVAIKIGLLELLIQIFKKQNDNCITHRLKNALLRTIIGLIRF
FT                   SPTAASYTWVKLKNEISELIFSDDISMRIWGIKYISTIIKMVEADSQDCLALDFIQPLE
FT                   LCPSIFVLMYDECVPIRLQTIKILCRIIITQGSEKECKQLVYMGIIGLLLDVLKQNDLR
FT                   NCTNSIAFPIIISLIRLIKISEKWCMIFIYSKGVEITLTYLKYSVEKIIIPVILLIFNA
FT                   CSYSSFHTNKVLECKTLDKLHRIKELINSEEFIRIIDQVIYSLIMKCTEYEILYSFIMN
FT                   SGDPYIIENRSIQDHLKIIQKKSNKLKKFIHANKSK"
FT                   /protein_id="XP_626867.1"
FT   gene            <787918..>790275
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3140"
FT                   /db_xref="GeneID:3373825"
FT                   /locus_tag="cgd3_3140"
FT   mRNA            <787918..>790275
FT                   /db_xref="GI:126644808"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3140"
FT                   /db_xref="GeneID:3373825"
FT                   /locus_tag="cgd3_3140"
FT                   /transcript_id="XM_001388084.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <787918..790275
FT                   /locus_tag="cgd3_3140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644809"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3140"
FT                   /db_xref="GeneID:3373825"
FT                   /translation="MRESINSVHSELFPKTKLGAEFLPLNKKENIPGKKVESIKKDNSE
FT                   KKISDTKENEEINEKMTKEKKPSKKQVQYSSSDSSSNPSPRIKKNSSEIASDESASIYT
FT                   DSSNKIGKKINAKQFSRNKHEIKNEVHNIGKKVSESKKLKVSENVPDDLRAQFELAVNK
FT                   VRAYIEKEYIDRMCEIDSENAIKLQRELNKILQSERDALEREKFNFEKRLREEMEREMH
FT                   ATIEIAAVENKKKADVSLAEIRKDIESHYIARQKEVEQELSKKKELLEEEYLRKSSELS
FT                   DIISKRKAELEEEYNGKKSEYLEGISRRKKELEEDFEERKKSLESTFNERASALESIYN
FT                   ERMNALENQYEENLKIKLEAEVAKSQAKQQTSIIEKEKEFIQGKILVESLKEQLEKMTI
FT                   QKNELENMSSSTISNMKNYMKELQDSSEIQKSQIGTLEKTVKALYVKEQETMELVNQAN
FT                   EKISNMMDLKEAKKIAYNSLLKGMAVQLLDETLRVHYKQNYLKKGFEILKKQISRPKIV
FT                   STNEDGKGLKGNDLTLFLLRKEQLSLFAENENLMSQVEDLRVKHLEELKKTQESFMMYK
FT                   KDLERDSNTETNVALYETSMLHFAYIINTKIRLQMVDAFWRIQTRPSKRNLVETEEVKR
FT                   EGLTKPMDLNSRDKLFGNFLSSLYRISRIKLISFTWRKIVLNAKLSSFKTLPTVPFKDM
FT                   NNNRGLNIDSFHLRDFINSMGKDGVMNFAHQPNYYNKLPSVINVQNKAVFVPLRRDNPI
FT                   TYGTYFQYNKEILSESCVTGKPMGSYANTDFN"
FT                   /protein_id="XP_001388121.1"
FT   gene            complement(<790379..>791035)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3150"
FT                   /db_xref="GeneID:3373880"
FT                   /locus_tag="cgd3_3150"
FT   mRNA            complement(<790379..>791035)
FT                   /db_xref="GI:66359379"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3150"
FT                   /db_xref="GeneID:3373880"
FT                   /locus_tag="cgd3_3150"
FT                   /transcript_id="XM_626868.1"
FT                   /product="Rab5 like small GTpase"
FT   CDS_pept        complement(790379..791035)
FT                   /locus_tag="cgd3_3150"
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rab5 like small GTpase"
FT                   /db_xref="GI:66359380"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3150"
FT                   /db_xref="GeneID:3373880"
FT                   /translation="MSQTAIKTPKTLHLKLVLLGDASVGKSCLVVRFSKDEFHEYQEPT
FT                   IGAAFMTQSVNVDDDYTVKFEIWDTAGQERYRSLAPMYYRGAAAAIVVYDITNVETFQG
FT                   AKSWISELQNINNNDIVVALVGNKYDLESSRTVDSETARNYAKEKGILSFETSAKTGYN
FT                   VQELFEEIARKLPNTKKLDSNSMSTENNGKTGGFQLFRSDRRGGGNCFSNGCSSN"
FT                   /protein_id="XP_626868.1"
FT   gene            complement(<791534..>792469)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3160"
FT                   /db_xref="GeneID:3373879"
FT                   /locus_tag="cgd3_3160"
FT   mRNA            complement(<791534..>792469)
FT                   /db_xref="GI:66359381"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3160"
FT                   /db_xref="GeneID:3373879"
FT                   /locus_tag="cgd3_3160"
FT                   /transcript_id="XM_626869.1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains"
FT   CDS_pept        complement(791534..792469)
FT                   /locus_tag="cgd3_3160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 4 transmembrane
FT                   domains"
FT                   /db_xref="GI:66359382"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3160"
FT                   /db_xref="GeneID:3373879"
FT                   /translation="MTPEEAQKEFLEYDWSKSTLWQQYYNNLYPTPSASQLTTFKRKWF
FT                   KKNVNPNLEIQLKEHNYNKYQEESKFSSFNSQAKSNESKLLLSTGYKQWMILSLSISLL
FT                   ISSIIPILNFLPIIRGSKFTYLLVRISSLFYILGLGSHLYDISIKPIKLLSIDFWQKIL
FT                   IEESFHSLISVVAYFGLIYSFPMIFFIPAITSLFIVSKYQPIVNNIQIINIFDLANKNK
FT                   NKLYQRKAYFEVFVVGIYIFFAVLTRRISIVYISIYWSLIRLKYPIDPFVQYAFRVANS
FT                   QINGFMKSYSNYIPGFIPRSYNWVSSNKVN"
FT                   /protein_id="XP_626869.1"
FT   gene            complement(<792700..>793851)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3170"
FT                   /db_xref="GeneID:3373772"
FT                   /locus_tag="cgd3_3170"
FT   mRNA            complement(<792700..>793851)
FT                   /db_xref="GI:66359383"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3170"
FT                   /db_xref="GeneID:3373772"
FT                   /locus_tag="cgd3_3170"
FT                   /transcript_id="XM_626870.1"
FT                   /product="replication factor RFC3 AAA+ ATpase"
FT   CDS_pept        complement(792700..>793851)
FT                   /locus_tag="cgd3_3170"
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication factor RFC3 AAA+ ATpase"
FT                   /db_xref="GI:66359384"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3170"
FT                   /db_xref="GeneID:3373772"
FT                   /translation="LRFTFKMEEAQLPWVEKYRPSGLQDLLSHKDIINTIEKFISSGQL
FT                   PHLLFHGPPGTGKTSTIHAISKCIYKDRKYQMVLELNASDDRGINVVRDAIKSFSESAS
FT                   TTLNHSGGTNSNIEDIEMSDVSTRNLDCNKSLCENIKLIILDEADMMTSTAQMALRRIM
FT                   ERYSEHVRFCIICNYVNKITPALQSRCTRFRFSPLPIEDIRNRISEIALSERIFITREG
FT                   QESLIKSSRGDMRKVLNVLQSCSMSNYGNIEKHKDSGELNGASIEGLITYINEEMIHRI
FT                   LGIPTKSELDYIFGILSRESFSSGFSALQNSQNENGYSTQDFVNGLYSKSMEANWPDEV
FT                   VPLLMRRLADIEYRLSRGASESIQLAAIVSCFHEVRMEMEKLV"
FT                   /protein_id="XP_626870.1"
FT   gene            <794660..>796687
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3180"
FT                   /db_xref="GeneID:3373878"
FT                   /locus_tag="cgd3_3180"
FT   mRNA            <794660..>796687
FT                   /db_xref="GI:66359385"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3180"
FT                   /db_xref="GeneID:3373878"
FT                   /locus_tag="cgd3_3180"
FT                   /transcript_id="XM_626871.1"
FT                   /product="Ser/Thr protein kinase"
FT   CDS_pept        794660..796687
FT                   /locus_tag="cgd3_3180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ser/Thr protein kinase"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359386"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3180"
FT                   /db_xref="GeneID:3373878"
FT                   /translation="MHEELRIRNGSLNEQRVANINKKGNSVFFTQECSCNNSENCFALA
FT                   SPHASFTSMASFALSSSTSNSIQPIGNTSPHKCEQRCNAGNEHLKKHCCIPSTSLSSTS
FT                   VSLGETSKLAISSGTSNGKYSIINKQINCNISTIINNNLTGKPEKNAQNTTLKVENGRY
FT                   TSNTVSNSNKSHTNGVCYSNINAFSQEENDKLVMQQSRDIDISNVNTLNHPKVTTYECE
FT                   NTYSRCSSGMLNGNEKDIVNSSNTNPNPTTNSFSAISKISKPSILGSKGQMVSKNYSLV
FT                   YKRLYDCLGPVMFPIAPLKGIKHPRGELKLWPTSYDRVISQNSSKRKVHRSLWIPPKSY
FT                   EHAYVNDLNGTETISAYPMALKFVEDGNARDGRSIKREIECHLYIYQRLSQLQQDQGYD
FT                   NLEDAWPCAELIGYYLDKKNPGNSVLVTRKLSGPDFFDIIRSEHSSSANSVYSKCQALY
FT                   EYNKLQWCTLALTRIAQYSALGIRHNDIKPDNIVLDFYYNSTNNERHLDVKIIDLGTAS
FT                   MHSAKDFTGGTSWYESPEQKMLEYYTKKSRDLKSAKTVEIGLSSDSWGAGISIAEVLMG
FT                   RRVVDSMKSPYGPGPLEFKGKDGWLIEPQEWIEFAKMALGFDNSNCPYKYKICEEAAKY
FT                   VFNMLVQVNSNKRANIKDVIQKMDYFTQKAYQAVKQKHQT"
FT                   /protein_id="XP_626871.1"
FT   gene            complement(<797010..>798977)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3190"
FT                   /db_xref="GeneID:3373877"
FT                   /locus_tag="cgd3_3190"
FT   mRNA            complement(<797010..>798977)
FT                   /db_xref="GI:66359387"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3190"
FT                   /db_xref="GeneID:3373877"
FT                   /locus_tag="cgd3_3190"
FT                   /transcript_id="XM_626872.1"
FT                   /product="GCN5 like acetylase + bromodomain"
FT   CDS_pept        complement(797010..798977)
FT                   /locus_tag="cgd3_3190"
FT                   /gene_family="HOG000135689" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5 like acetylase + bromodomain"
FT                   /db_xref="GI:66359388"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3190"
FT                   /db_xref="GeneID:3373877"
FT                   /translation="MFIEEANASIDRGIRTIIFEEFSPLVVENINKDYLEGIYRDYSDP
FT                   KLLKLCNNFGFVEFLKLSNEQGDLNNELIRIFKVTLEEIFSAVLSIINIQQWLSIEARE
FT                   RGPFPTIKKDERASVKSFVMNYLPDENYENNYNSWKLFLKRDSPAGRKVCEMFKLSFLK
FT                   SLLLTNIGVILNDIETSGIFTKFALKSNLSKAICMKFAIKLCVACGIASKESIDHLKRQ
FT                   AWDHLRYISDDETLQSSLLSETGLGFLHRDSGSAKEEALGIISFECITNDREPEHLVKL
FT                   IALKNVFARQLPKMPREYIVRLIFDRNHYSFCLLKKGKVIGGVCFRPYFEQRFAEIAFL
FT                   AVTSTEQVKGYGTRLMNHLKQHVKKSKIEYFLTYADNFATGYFRKQGFRKEVSMPKERW
FT                   FGYIKDYDGGTLMECYINPEINYLRLSDLFHEQKSALLRAINTIRPLKVYPGINLWENG
FT                   DESMVKKDLNIELTSDQKNIESTISEPMNDGDPAKNFQNDPCAEDFTPIIDTKPENDLN
FT                   INTKKIKPSDIPGVLEVGWVEKIIDPVEQSKVDLSMNDQIWQLLDTLSRHENAWPFRKP
FT                   VSIGEASDYYEIIKEPTDIQTMKRKAKNKEYKTLSEFSSELKRMFDNCRFYNAKNTIYT
FT                   KYANQLEAFIWPMLQTIQES"
FT                   /protein_id="XP_626872.1"
FT   gene            complement(<799471..>800739)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3200"
FT                   /db_xref="GeneID:3373824"
FT                   /locus_tag="cgd3_3200"
FT   mRNA            complement(join(<799471..800329,800414..>800739))
FT                   /db_xref="GI:126644810"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3200"
FT                   /db_xref="GeneID:3373824"
FT                   /locus_tag="cgd3_3200"
FT                   /transcript_id="XM_001388085.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(799471..800329,800414..800739))
FT                   /locus_tag="cgd3_3200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644811"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3200"
FT                   /db_xref="GeneID:3373824"
FT                   /translation="MKEDQKEFLRKVANVCELTLYTSEMNNKLLKNAIREASSDQLLAP
FT                   VSISTYPQFIPSVKHSLPENSSTALSTVVAWPRGDGCSEAIDAEIYNAVEYYKVHEIEY
FT                   VVDYRHQLLLQQMEKVINEIARVKSLIGPNILLKVVLEIGEINEASRLSSLVRCAILGG
FT                   ADFIVTCTGKVKKGLNSQDLKQLLIEVKSSIEGESPCDKEIAAGDDEEVLEGLQAHYDE
FT                   SFVKGTLILPNRLRYLQKRKVGIKLQGGVSSLDIAREFIKQVEDVLGNEYVSSPNTFRI
FT                   GSSTLHPLIIQELLGIDDELRIVHTLGIKPINAEQVNQEDNISSPENELVGISHPSAPI
FT                   SSNQTREKIGSQEVIDINKDIIKVEALNGDKTIISDSDLVGNKSKVISVEYLIN"
FT                   /protein_id="XP_001388122.1"
FT   gene            complement(<802148..>803875)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3210"
FT                   /db_xref="GeneID:3373823"
FT                   /locus_tag="cgd3_3210"
FT   mRNA            complement(<802148..>803875)
FT                   /db_xref="GI:126644812"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3210"
FT                   /db_xref="GeneID:3373823"
FT                   /locus_tag="cgd3_3210"
FT                   /transcript_id="XM_001388086.1"
FT                   /product="PV1H14080_P"
FT   CDS_pept        complement(802148..803875)
FT                   /locus_tag="cgd3_3210"
FT                   /gene_family="HOG000246456" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PV1H14080_P"
FT                   /db_xref="GI:126644813"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3210"
FT                   /db_xref="GeneID:3373823"
FT                   /translation="MWGRIVSSVSSVLDINQATLSGCIDIIVVPQADGTLHSTPFHVRF
FT                   GKAKLLKSREKHVSINVNGNDIPLKMKLGAAGEAYFIHQDDPPEDSFENISSPTDSRES
FT                   SPSDVEISTPSQPANNSSLNISHAKSFETTVEYRNKTDSTDPSNFTNIETENENIQNIN
FT                   EVFQRYNITLSLCGHLLYGGEEDSRHDEYVFQSNIISFEQFENDPDLWYHSCLVAVIDG
FT                   KPPYYPIKAFYPVITSIIAFGKPPSTQALKKFLGIPEKSSKKIRSSSDCGIIDSNFDHI
FT                   SGNHRANRCLSSTLPLSSKSHIQGCLTAPVSVDNCEVSSFESIESISSSPNLLRMDNPT
FT                   NTPNCIYLCRSKPPVKYLRHSLRPTSDQLKSMNLKWGANRVTYTVESSLQGRKTVSGTI
FT                   YLWPPDSRIVVSDVDGTITRSDVLGQLMPIVGRDWSHQGVAELMTNIESNGYKIVYLTA
FT                   RAIGQADATRDFLFGLKQVGNSGNVTLPDGPVFLSPDRLFPSFKREVIDRKPYIFKIAA
FT                   LRDIRNLFPIYRNPLYAGFGNRDTDYRSYSHVGIPEGKIFIIDPKGVIHHINKTYAKT"
FT                   /protein_id="XP_001388123.1"
FT   gene            <804433..>805374
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3220"
FT                   /db_xref="GeneID:3373876"
FT                   /locus_tag="cgd3_3220"
FT   mRNA            <804433..>805374
FT                   /db_xref="GI:66359389"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3220"
FT                   /db_xref="GeneID:3373876"
FT                   /locus_tag="cgd3_3220"
FT                   /transcript_id="XM_626873.1"
FT                   /product="possible relation to actin related protein 2/3
FT                   (Arp2/3) complex subunit 4"
FT   CDS_pept        804433..805374
FT                   /locus_tag="cgd3_3220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible relation to actin related protein 2/3
FT                   (Arp2/3) complex subunit 4"
FT                   /db_xref="GI:66359390"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3220"
FT                   /db_xref="GeneID:3373876"
FT                   /translation="MQSKKIELHDTDSNAPLLPYLRRLFNTLNREICLFYLPLNLPCMY
FT                   SVPFIEQEHLIKNLSSADNIDISSSKKSFNRNNKVELIKSLYVYRHSKEFCYIESCIDS
FT                   VRVSLKFYFKCEFERRLFNQLTIFMKKNSDYLQLVRKKSIEGFDISFLITNHILNSYNN
FT                   KICISNKSNYDGQMGKYDVIHFILKFVVDIDRQIQDKMLQSTYFSRYYIRKLLQEFNVN
FT                   VLYKQNSINIPKHKKQLDETNKSEIKGIDPNKAEISISEKNNNLLETKKSLTSTKNINS
FT                   GSIATQLNDSIGRDAIVLKALKTRNRIKNLIN"
FT                   /protein_id="XP_626873.1"
FT   gene            complement(<805371..>810017)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3230"
FT                   /db_xref="GeneID:3373874"
FT                   /locus_tag="cgd3_3230"
FT   mRNA            complement(<805371..>810017)
FT                   /db_xref="GI:66359391"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3230"
FT                   /db_xref="GeneID:3373874"
FT                   /locus_tag="cgd3_3230"
FT                   /transcript_id="XM_626874.1"
FT                   /product="Ser/thr protein kinase"
FT   CDS_pept        complement(805371..810017)
FT                   /locus_tag="cgd3_3230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ser/thr protein kinase"
FT                   /db_xref="GI:66359392"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3230"
FT                   /db_xref="GeneID:3373874"
FT                   /translation="MSKDSIISLAEELEIISKDEHAIVHILDFGFISTESTRFCGLNSL
FT                   SNIDGSSGSLILFEDDQGEDEVTDSSSSLFSNSESNIKTTISNRDLLLTVLIGNISINN
FT                   TRFVLDDHINNKILDSRPLSPEDHPSSRNVLNSFNNLNLSNSCTPNNVEKQFKGLELEI
FT                   SINNQYPKIPPDICYLSHYNMSKSFKEKIKTNIDKFLKNPQIEYRLTQIINIIKGILDC
FT                   ANKFEETKHQTQIVPKNALGNNAENDKEYLRDYECKLNSLNESNHEEDSHYIFSSNRFE
FT                   DNFEVIKILGYGGFGSVFMAREHFGGKCTYAIKQIPLGSKNLHENHMLINEAAMLACLN
FT                   HEKIVRYYHAWVQESVDGNSRCINNDFFDGNIYSSFAPELISQFSAMTAQYISNDLSTL
FT                   AEHKNKGPSQGSFHGEKKKSIYLFIQMEYCSGYSLQNAIDKGLVCNNHKLIWHIFYQIV
FT                   QGLSYLHGKRVIHRDLKPSNIFLQLDENSNEIQDENLYLVKLGDFGLTTFVNIFDRFSY
FT                   SSNSIDGSKANNELSSGVGTMFYMAPEQCKGNFYNQSADMFSLGVILFEMYHPPFNTGM
FT                   ERVQILTQLTKYGTIPNNCNIPNKVRALIKSLLSHNPEERPTSYQLLYNEWILKQTKFY
FT                   LNSEDLVIGATDIDLNGAKGYSSQKICDIISRNPYIHENIQILSTLFSIEKRSLDKQLY
FT                   RSNASFSYFSFQLNNSGYRIYPFQSNNILINHHHYYKKRSELISYIKNIFKTHGATEVG
FT                   IPILFPKSTNKNLIIDEKTQNEINCNERKVNFDLDYLILSTNERCEIESQQKHKKGRKH
FT                   FSKKNSQNSKDDSELSESIAISENPLRVILLDRSGNPLVLCNNILKNMSAQLGDGHGLR
FT                   MGAVIKRFYIDSIYTQDNLINLDTNNNKYATTHGHPKELLFGTYEIVVKINDRVIEEFD
FT                   SISNFIEFPIEVQNISGNLNISPMWYYNIVIYYDIEIIITALDTLKPYERFIGQPILVW
FT                   GDSQLFISLLESWVGIKYEKAKYIQIWLHNLIPIGISRVKLLNFLQKITLISLAEFVNS
FT                   YNFDREIEGSNIIKSELPEPILKYYIGLKILSYPSILEKVVEYILYIINDFKGSIHDFI
FT                   EIINKGTNEVSNLFEIEKKKFIITCKNEFFKELAKVTRYPLFINLVNNKGYNNSLALNF
FT                   KTTDNFSEEKMLNQNEILINPELFTPNLLKVIYRIFLFNNLLNNTNLGITKIFFDPILF
FT                   SNNNFFESGFFFYIFSGETSSDQNNQNAESSFSCSQNIPICKVGCIMDLIFENRYSLNH
FT                   INSSYASLKQSNVELLVKGGRFDNWYISANTNKVIFFKNYSSIKNNDRISAVGFEIVLE
FT                   RIIYKILRNTKFKMIIPLVNVGLTSNCELLLNSGIHVFILNNNTKYQVKSFKLRQLLLL
FT                   KGIKCQRNISLNNVDTIKQKNHIKSRFPLLHWIVQIVRGSFGDNRRHVSMNSSNKSSYL
FT                   PYQANNLALSNLVNNSYLTDNQNNPILYSEIKYKIEWCFSSDSNLTIYAKEFISNYPGS
FT                   SNSNNLEIILDNECRLVQFLIDFYCMND"
FT                   /protein_id="XP_626874.1"
FT   gene            <810153..>810812
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3240"
FT                   /db_xref="GeneID:3373875"
FT                   /locus_tag="cgd3_3240"
FT   mRNA            <810153..>810812
FT                   /db_xref="GI:66359393"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3240"
FT                   /db_xref="GeneID:3373875"
FT                   /locus_tag="cgd3_3240"
FT                   /transcript_id="XM_626875.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        810153..810812
FT                   /locus_tag="cgd3_3240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="similar to 18978232, possible Zn-dependent
FT                   metalloprotease"
FT                   /db_xref="GI:66359394"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3240"
FT                   /db_xref="GeneID:3373875"
FT                   /translation="MIFLSLIGAFEPFISIDNLKFIVKNLQILTGKEIKFIKHAETNIN
FT                   LVMKGRCSVGNISDLKDYADLKEQSNPGNHQQISTNSMLEVLLKMKNKFITENSKNQMD
FT                   SNFFLIGITSLDIFPTNDHEYVFGQSDPEKGIAIISAYRLYQNNKNLMNSRILKVIMHE
FT                   YGHLMKLGHCKHVCLMSVICSISELDNRTLYCCENCLNQIREKSSTSESVKNLFEF"
FT                   /protein_id="XP_626875.1"
FT   gene            complement(<810755..>811948)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3250"
FT                   /db_xref="GeneID:3373873"
FT                   /locus_tag="cgd3_3250"
FT   mRNA            complement(<810755..>811948)
FT                   /db_xref="GI:66359395"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3250"
FT                   /db_xref="GeneID:3373873"
FT                   /locus_tag="cgd3_3250"
FT                   /transcript_id="XM_626876.1"
FT                   /product="CCAAT-binding factor (CBF)/MAK21 family protein"
FT   CDS_pept        complement(810755..811948)
FT                   /locus_tag="cgd3_3250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CCAAT-binding factor (CBF)/MAK21 family protein"
FT                   /db_xref="GI:66359396"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3250"
FT                   /db_xref="GeneID:3373873"
FT                   /translation="MFGSDFDGDLDKIAKFDKNYRVIYQKLWLKYINIVIMNYNDENRN
FT                   IPLPILKDALEYVSEFVIPIISNPLELADIFKNCFDGISNKINPMDKLAISVISLNGLF
FT                   YLIVNNRLNEGFNLNNESEENISSGYYRRLYELLCPPVFSLKVRAKFLKLLSISLFSPL
FT                   IPMTVLSCFIKKLIRISLFTSMNNTVWIIALVNSIIKKHRNILFPVLSLNESDEIYEYV
FT                   NTILKNTQGELWSYDKGINSYKNDQFFNPYKPSVNLSEGQKIDTADSLNNNCEMGTYLS
FT                   SNFGLWELYIHNKSVVPVIRHLSNTLTMNASNAKVNRHLHNLNYEDLIGLSTEEILAHE
FT                   ITSPNGILHNYSACFIKDKKNIVPYNYIEYSKLSSTNLFQNSNKFFTDSDVELFSLI"
FT                   /protein_id="XP_626876.1"
FT   gene            complement(<812076..>812834)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3260"
FT                   /db_xref="GeneID:3373869"
FT                   /locus_tag="cgd3_3260"
FT   mRNA            complement(<812076..>812834)
FT                   /db_xref="GI:66359397"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3260"
FT                   /db_xref="GeneID:3373869"
FT                   /locus_tag="cgd3_3260"
FT                   /transcript_id="XM_626877.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(812076..812834)
FT                   /locus_tag="cgd3_3260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359398"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3260"
FT                   /db_xref="GeneID:3373869"
FT                   /translation="MKSHSQTSKKLNKASKSKKVKLEIVTKMLLDLNKQISEARKATME
FT                   PIPIDILSMGDTDQSFSDFSRELLLDENKDVNESISSLKPLVHQFLKLSSIIMDNQYIG
FT                   TEGIQINNDLGKCISSNRNNLRAVIVQIFMKWLKDDIMIRNYKNMKEKGNFDETGNFPI
FT                   SLSTFIIRSILTSSIQNNEINRIILDSRNNMTNDTFIMENLLLNEYITNFKDLRYFFLK
FT                   NILNFLNKYSEGLIFNFGKKNESMIQWFNQ"
FT                   /protein_id="XP_626877.1"
FT   gene            <813044..>813583
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3270"
FT                   /db_xref="GeneID:3373870"
FT                   /locus_tag="cgd3_3270"
FT   mRNA            <813044..>813583
FT                   /db_xref="GI:66359399"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3270"
FT                   /db_xref="GeneID:3373870"
FT                   /locus_tag="cgd3_3270"
FT                   /transcript_id="XM_626878.1"
FT                   /product="possible nucleotide kinase related to CMP and AMP
FT                   kinases"
FT   CDS_pept        813044..813583
FT                   /locus_tag="cgd3_3270"
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible nucleotide kinase related to CMP and AMP
FT                   kinases"
FT                   /db_xref="GI:66359400"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3270"
FT                   /db_xref="GeneID:3373870"
FT                   /translation="MLGKGRKPNILIIGTPGTGKTSLSKKLEKKLEGYKRIELSKAIKK
FT                   HRLYSEWDDKMGASIFDENLVRRYLKNQLDKYNSKNVGIILDFHSVNFIKRKWFDIVFC
FT                   LNSETHVLFDRLEKRGYSQDKIKENVECEIFKVIRFDATEIFDEEQIIDLQSNNICEQR
FT                   SNIKFILNKISSIENS"
FT                   /protein_id="XP_626878.1"
FT   gene            <813951..>815075
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3280"
FT                   /db_xref="GeneID:3373872"
FT                   /locus_tag="cgd3_3280"
FT   mRNA            <813951..>815075
FT                   /db_xref="GI:66359401"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3280"
FT                   /db_xref="GeneID:3373872"
FT                   /locus_tag="cgd3_3280"
FT                   /transcript_id="XM_626879.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        813951..815075
FT                   /locus_tag="cgd3_3280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359402"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3280"
FT                   /db_xref="GeneID:3373872"
FT                   /translation="MSIGSFVPEVIFMDNIESNIKLLTENENSNNQIECISKENFLNLN
FT                   SQFKQSSDSLSFDMKIRTENINLNSIQEPSKVDHYYKIQPLQGIEQNIGENIQIPVEDE
FT                   VQSYTSYSNFKLEWDHENKALFVVIPSVDSLDHWMMLFLQPLGITCDSLSLNNCCLKRN
FT                   CDFRIRLDDERLLLYPDLLKDISDFLSTQYLNWQYYRENVIMRDCEVMDSEQEKYIGDN
FT                   LINGNHFGPKCYNYWKFPDINVFVNNDSHLNNEINFAEDENSSKFYEKENFSQNNGSFE
FT                   RNIQKSITNYNTDIYGKCLLVPELCSKGDEPLVQNNTLSCLTTNISDLNVLTTDSGVLQ
FT                   VLTSENSNHDDNYFALNTNSSMGTNDKEYFPIET"
FT                   /protein_id="XP_626879.1"
FT   gene            complement(<815170..>815673)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3290"
FT                   /db_xref="GeneID:3373871"
FT                   /locus_tag="cgd3_3290"
FT   mRNA            complement(<815170..>815673)
FT                   /db_xref="GI:66359403"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3290"
FT                   /db_xref="GeneID:3373871"
FT                   /locus_tag="cgd3_3290"
FT                   /transcript_id="XM_626880.1"
FT                   /product="hypothetical protein with possible signal peptide
FT                   and one transmembrane region"
FT   CDS_pept        complement(815170..815673)
FT                   /locus_tag="cgd3_3290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with possible signal peptide
FT                   and one transmembrane region"
FT                   /db_xref="GI:66359404"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3290"
FT                   /db_xref="GeneID:3373871"
FT                   /translation="MRSYIKIIALFFSIIAFNINFEYDLSLNLLSNHAYSFVRTKKNAW
FT                   DIVNENHEIFNSPGRRANGELSLSSYKWNISYDQPFSSQISQVILVILVIVLLICVILS
FT                   LICCRYSVPKEEDFTKKEDGIYYFENEKRPEEFALIYNKNAQNRRYILTGETPKNIEYC
FT                   EDQD"
FT                   /protein_id="XP_626880.1"
FT   gene            <816203..>816562
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3300"
FT                   /db_xref="GeneID:3373868"
FT                   /locus_tag="cgd3_3300"
FT   mRNA            <816203..>816562
FT                   /db_xref="GI:66359405"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3300"
FT                   /db_xref="GeneID:3373868"
FT                   /locus_tag="cgd3_3300"
FT                   /transcript_id="XM_626881.1"
FT                   /product="SOH1 family protein"
FT   CDS_pept        816203..816562
FT                   /locus_tag="cgd3_3300"
FT                   /gene_family="HOG000242147" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SOH1 family protein"
FT                   /db_xref="GI:66359406"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3300"
FT                   /db_xref="GeneID:3373868"
FT                   /translation="MLSEGESELLIEDENPIARFSLELEFVQCLSNPDYLQWLSKEGYF
FT                   EDESFVNYLKYLLYWCEFPYVKYISYPHCIKMLRLLQIEDFRKNLSKEEVIQIIREQQT
FT                   YQWIYSDIKKEHLKL"
FT                   /protein_id="XP_626881.1"
FT   gene            complement(<816979..>819138)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3310"
FT                   /db_xref="GeneID:3373867"
FT                   /locus_tag="cgd3_3310"
FT   mRNA            complement(<816979..>819138)
FT                   /db_xref="GI:66359407"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3310"
FT                   /db_xref="GeneID:3373867"
FT                   /locus_tag="cgd3_3310"
FT                   /transcript_id="XM_626882.1"
FT                   /product="uncharacterized protein with several coiled coil
FT                   regions"
FT   CDS_pept        complement(816979..819138)
FT                   /locus_tag="cgd3_3310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized protein with several coiled coil
FT                   regions"
FT                   /db_xref="GI:66359408"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3310"
FT                   /db_xref="GeneID:3373867"
FT                   /translation="MRAAWGALKGAVQELNDALLEEDDDDHEKSRRNNYPGHIAYSRER
FT                   NDHVVNDYFNSNINLKKSNYGSKNNLRSNDNNEGFISSNKERNILSLSSSLNDSKRIDL
FT                   KGNLPLEYNQYSNQNVIMLQDSESSKESNSFTDEEFDWGLDTERTLKEKLDSKTNQFSQ
FT                   KKEYNEELAQKTYKFDSGETEEKSSDIYTRTNKLNKIVQQSDYSEDDDYKNNDELIVEN
FT                   NFPNNCESESIVVTEDDEGSNMTDTLEDCENKLEEKMGEEVEEKEEKKKAKEEEEEEEE
FT                   EEEEEEEEEEEEDDDDEKEEEEEEEEVKTVSNSSDDEDLEILNLPSKHSKEFSEIFQME
FT                   IGSADYLLEVIQGYYSDWNSIRDSLILDRELLIKLAPPHYESYLKNTILDRSKPFSLGF
FT                   TVLIGQCICSFLQEFKKKASLIDKQEDKINELFQKCTEYTTNVQNIEAENYELSKKISI
FT                   LEDEISFLREKNEELLNKIEDDTKEKDQIFRKRLDDLEIERNNLIEKINLMIEEKCESK
FT                   TEVDKLHEHINNLTSIIEGYQAEEEQINSRYEIELERARSQEKKLQSRLSVLDSCQDEI
FT                   TSLKDNITKLEENRNSLEKQIGELLENNNNLLNSNEQIMKQLHDTKEEQKEFMIDKRFI
FT                   IQIIQKHNEDGSRIKYRNDLFNLLCDAIGLSHDERSNLFISDGRNSGSNSRENVIHDLN
FT                   QGMGFADLFYNFLNSEVEESMQEAK"
FT                   /protein_id="XP_626882.1"
FT   gene            complement(<819429..>819500)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3315"
FT                   /db_xref="GeneID:3373953"
FT                   /locus_tag="cgd3_3315"
FT   tRNA            complement(819429..819500)
FT                   /note="codon recognized: GGA"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3315"
FT                   /db_xref="GeneID:3373953"
FT                   /locus_tag="cgd3_3315"
FT                   /product="tRNA-Gly"
FT   gene            complement(<819628..>821172)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3320"
FT                   /db_xref="GeneID:3373771"
FT                   /locus_tag="cgd3_3320"
FT   mRNA            complement(<819628..>821172)
FT                   /db_xref="GI:66359409"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3320"
FT                   /db_xref="GeneID:3373771"
FT                   /locus_tag="cgd3_3320"
FT                   /transcript_id="XM_626883.1"
FT                   /product="putative phenylalanyl-tRNA synthetase"
FT   CDS_pept        complement(819628..>821172)
FT                   /locus_tag="cgd3_3320"
FT                   /gene_family="HOG000230294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative phenylalanyl-tRNA synthetase"
FT                   /db_xref="GI:66359410"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3320"
FT                   /db_xref="GeneID:3373771"
FT                   /translation="SCDQTMEVEPVTILEKLESLNCSLSSISISEELKCEHERVIGVIK
FT                   SLESRNIIKTQFISDNMLSLTDEGKDYLLNGSPEYRLIKIILEKSDHKIKQDEAMTFLG
FT                   GSIFKIGLSKCLQKKLIKLNKELGLIEIPADSNMDLLNTDELGKNLLIVGVNGVKESQL
FT                   TKQDLQIIAELKKRKLAISQKISYFMINKGEDFTVKLKPMITDLTQEMIMNSSWENNEF
FT                   KPYNFNAKGKRLPRGNIHPLTRTSRKFKRILSQMGFEEMPTNRWVESSFWNFDALFQPQ
FT                   KHPARDSHDTFFLETPSTFRNEMELSNDHIDKVKKVHEIGGYGSIGLSYNWSIEEASKN
FT                   LLRTHTTAVSVRMLYKLAQMYLYNENGLSFDNFQRKAYFSIDRVFRNESIDATHLAEFH
FT                   QVEGLIVDKNLTLADLIGTLKTFYEKIGISDLKFKPAFNPYTEPSMEIFGYHTTLKKWI
FT                   EVGNSGLFRPEMLRPLGFPSDIVVIAWGLSLERPTMISYNIPNIRDLFSFKAKIFS"
FT                   /protein_id="XP_626883.1"
FT   gene            <821729..>824620
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3330"
FT                   /db_xref="GeneID:3373866"
FT                   /locus_tag="cgd3_3330"
FT   mRNA            <821729..>824620
FT                   /db_xref="GI:66359411"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3330"
FT                   /db_xref="GeneID:3373866"
FT                   /locus_tag="cgd3_3330"
FT                   /transcript_id="XM_626884.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        821729..824620
FT                   /locus_tag="cgd3_3330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359412"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3330"
FT                   /db_xref="GeneID:3373866"
FT                   /translation="MNDAEEDWQDPLLDVSIPYNSLAPYALTCYQLDEDLQDLISFFST
FT                   LSKEDLAHHINETSFESSLRLLKDVLLVQPNKLVSSNGNALAYELLESKEDLQRDFSSS
FT                   SADILTKFQKNDSAGTDLSILDSPNGIIRVANETKVRTDIVGGDPTLNNSQFLEGSIQA
FT                   SNSSYRIVSNGEENKFVDQSKMLMAFFKELEAAKLFENLESFSGILAAHSIHLKILQDV
FT                   VTDIFRVEELRLRLCSQLAALLNPIILSRLESYNNSLFFTAFTIPSNEGSSIDLRESHC
FT                   SLPNPIIYKWPSNSVCIEDYKLYMSRLPLLCFSEVFKLGSCISQSLKVHDNYQKTIETD
FT                   AEQTVDFSEIYPDECSIRIKSLDSIYNQRNGSQIDHPLFHVDYGSNSNLDANSNFVHHP
FT                   LCTDIAQDSKDIERDVIFVNGKEYSGANGGYERIVYIVANLIENYWLKSSNGFEDSNLN
FT                   TETKEGTLQGSSKTVELCSGSIFNLVNNDPNENYDERNTESVVIATILLHVLSRTFSGG
FT                   ACFDKVSLVYNKPDCIVISPNSKRARPLEMLILPNVALMLSTLRFRLYEVMENLTVNTQ
FT                   PCFLVDTHVVSRLVPDSGLIELLPFYSFHILSRTPVSKIPSSIYQHLLRCANLFLAKNI
FT                   LFTRVKIAKKVEAGTQSVPPVEIECEKLQLNVDQPSEVREEPCGKCNTAQNDSKESDQN
FT                   VAEAFISNSKCLDTDKIIEVTGDDLTIITPGEAALFRMFTNIQDKEAIHNSSIENINLS
FT                   NSEVSTNKEAAEDRDRYDCDSNESIKEEIRDSDPRISNSESKPQHTVVEQDFPMTVVPD
FT                   RSVQIHASVNSHLEEQEGNSYSNYNTFRTQQQSNSGENQISDNTKNSSYSDYISTESKE
FT                   NSEKSCISFGLQSGKNIPKLYLCHNVEIPDSCSLTSNIYIASSENSSNLANDLCNLPAD
FT                   SIGAIDQENQQLALFLQSKRVISQFGIFNIINT"
FT                   /protein_id="XP_626884.1"
FT   gene            complement(<825970..>830307)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3340"
FT                   /db_xref="GeneID:3373865"
FT                   /locus_tag="cgd3_3340"
FT   mRNA            complement(<825970..>830307)
FT                   /db_xref="GI:66359413"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3340"
FT                   /db_xref="GeneID:3373865"
FT                   /locus_tag="cgd3_3340"
FT                   /transcript_id="XM_626885.1"
FT                   /product="SECIS binding protein. pelota RNA binding domain
FT                   containing protein"
FT   CDS_pept        complement(825970..830307)
FT                   /locus_tag="cgd3_3340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SECIS binding protein. pelota RNA binding domain
FT                   containing protein"
FT                   /db_xref="GI:66359414"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3340"
FT                   /db_xref="GeneID:3373865"
FT                   /translation="MENLLDNNFELLASELFDVPRDSGVAYLQIGTSYSGNSNNNNNSN
FT                   SGHNNGNGSARGSQQLVQQQSQHTRNARSDSLIGDIKNSNITVSAVDGSLIDFNSIRNI
FT                   ETPSKIGVSGHIVERSNRIRMEHANNVVDELQGFNITSRHSGNRSFGRPEESYLDLDGS
FT                   MNRRSSDTFSDVCAYQQQNSMGNSKNNNNNNNNNNNNINNSNNSVMHSRCHNGSFSQNS
FT                   HLGSAGGIMKMASCSNNNGNTFHDEQAEFDTDQRIQGLIGRYNSMCMDDQILKMGTYSN
FT                   YINNCNMNNGNVNTNCTTFDTNSINNKSTNNNGANANVDAFLPQIDHCNTGTSGSIIGN
FT                   GFSHEVGSIERDSTECYRAHQSYIQRRFANGDFGTCNMTNTTTVSSEISSLSGVATPGS
FT                   ASLKSANSTDALSQRFRNSSNISLSSYDISDIQGSNGVNFDKLSTGAIGMSSYSKHLNA
FT                   IPLDDNAIPLEDSVSEINSNGKLRFRKSSGSTSNLSNPTSIMGSINASGRRAIGGSVCS
FT                   SGSSSCSTGVGGSTCSLAGNNSSGAYGMKRSSKSNSLIHSNFSSNGANPLIIDEEDIYP
FT                   SIGHFALLGSSNSQLLGVMNNQTEGLVSSFKSRSGSANTDYMCRSGIDTSPSIKGNYIS
FT                   YGDSINGIESRHSSHPALSNSDIGGPFEMDGNGSQFQNMFNRLMDDSNGYRMEGSLQGI
FT                   DEVEFRGDGKSYWQHTSPYKFSSSQGVIDWKPQHQQLSIFEKNEFNDDFGCDVPYNNYL
FT                   INRGQQLRHKYFGQQKLYGFPSNMSNKQQKQLKQRNGVSPNLGNFEANQRAPNTYRSGN
FT                   LPILYNENNMLRCESNMLRHTSRSGKKNSSGSLTGSMPNIPLNSGLNIQNLNDQGYVGV
FT                   NQGQLQYCRKTCPPNCTIPTHINGNMFRRKSGSGVIPFNGNQLGLGVGGGSMGVIGNGV
FT                   SRSLNDLAYSGMSNIPISGLSNQGYSKKTSEDAYYNKNGRKNAINHIKNNSNASHSCNS
FT                   NMTGGMAGFGNMNIHNNFPAGSSSCAGGLSASSIDTSGNDASQNGLTPSSIAALWAKAM
FT                   SKTGGRTGFSNRNKHSNSNSASSNTDVNNNGTNSGSSNLTDSKNGANEIITCARFSSFL
FT                   RNNSGRLHWLRVMYHYLDTVDARKIREVNKGDNLCMVAVDDIALEAVSRSFDPSECAYW
FT                   SEPENGAFVHKNIRLAVAHKVGHRTVASPQNYVNQILTASLDHSVSILLNTLRAIDDRV
FT                   RWMSTVVNSKNGSGLQIDLKSNKISNSCVIPSEGDSNQKISDSKNTIETGYTITVNGSA
FT                   ISISNTGNALGGIEEGTNESNPNLSNSTKNFPGRVFTVGVREAMRCLRHKKLKALIVAP
FT                   DIEGDGVEGSLRHHVIHILLQAQELNIPTIFALNRHRIGRAMGKHMRMSVLGLLSIRGV
FT                   EKQFQAISHTAQLLRKLYHFCIENNLPPTEETFKKLSSSVNIN"
FT                   /protein_id="XP_626885.1"
FT   gene            complement(<831376..>832887)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3350"
FT                   /db_xref="GeneID:3374126"
FT                   /locus_tag="cgd3_3350"
FT   mRNA            complement(<831376..>832887)
FT                   /db_xref="GI:66359415"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3350"
FT                   /db_xref="GeneID:3374126"
FT                   /locus_tag="cgd3_3350"
FT                   /transcript_id="XM_626886.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(831376..832887)
FT                   /locus_tag="cgd3_3350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359416"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3350"
FT                   /db_xref="GeneID:3374126"
FT                   /translation="MIETTISEKTFSPSSSEIMRKATRLVDQLLIKTSNDFSNLEGVAL
FT                   KNNNISDSKLAITEDSINVDSNSITDSETFSALTSARKNIPSIDIIKRLAGRLKNKDSD
FT                   TISEFNFPNKKTVSNGQDAGDYCLQKSENCRSKSASPTSSENREKNNCGLSHDFAQMNA
FT                   KLSEINKRVESLSSNIEDIQDADILEDGGYAKVENKQEPGRFDDEGNTSRRIYERDTED
FT                   NYLSQLNVAVLQQERLRMWARDNAKYTSSISNTSENGNNQESEHIPFSDVYYTHQSLKY
FT                   KNGELTSSNDALNSSVLSTTVSGTAGQFAHSNDTTVYEAKTNCRNTVSDFSRTVKVCAG
FT                   GEYSENKDSEVGGASETISFERISGRFTEPKILRFIRVGNQLRRSITVTPLVEDLQRVL
FT                   NGEAASLGFSFNDSDFDSRTQFNNKLEKLSNSNISPFNPSKSTSRLSNNMVIITIKDNG
FT                   TGFKRSTRSRTMDDTISVDSAESYEKSFFSCRECSWNPTSACSIQ"
FT                   /protein_id="XP_626886.1"
FT   gene            <833446..>835101
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3360"
FT                   /db_xref="GeneID:3374125"
FT                   /locus_tag="cgd3_3360"
FT   mRNA            <833446..>835101
FT                   /db_xref="GI:66359417"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3360"
FT                   /db_xref="GeneID:3374125"
FT                   /locus_tag="cgd3_3360"
FT                   /transcript_id="XM_626887.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        833446..835101
FT                   /locus_tag="cgd3_3360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to putative diphthamide biosynthesis
FT                   protein"
FT                   /db_xref="GI:66359418"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3360"
FT                   /db_xref="GeneID:3374125"
FT                   /translation="MDHNLELGNYSDFDFQTTSKWIAKHSKGKEGLIVALQFSVSDIKY
FT                   APRIQYLIEKQVNCIVSKEDGSKDQCNIRFFVLSDIVNPACCLDVLNIKKSHSDLVIHF
FT                   GYSCYHNIRNFRLPVYFVPSSSDYFYVSESNTLCDITSFLYKQLNNRLLEGNNSLKRMN
FT                   VILSFQGILKNNSQTTLLDKIRSSELNKTSNDVEICIYQLSPINVTDCIQDQHSEFICD
FT                   LLLSKLGHDKELKLDDLEKRFERSKNMTSSESVIFFHFISKDDKYSNLPNSFLERIFLR
FT                   YNQLFEIFLCQVNDSDSSIELNPNALNELSSIISKRFVVIEKAKSIHSENHVAFVITPG
FT                   ITQLEWKLIEFFKRHNYRINADNGKKIKIETHIISLTGVNEVKLRNFPDIDIFCFFGCS
FT                   EYFLSHIIKNLNLKTPIILTPFEYQVFLGITEWSTRYLNTPDLQSHVLSDNDLSFHSSI
FT                   SDSEDSELDQDFSKLSIEDSEILKNNTLSTKTESYSLQSIDKKTKKLLVSLNSIKNKYG
FT                   RSYFGLNPLENTDHIPKITQGRDGIASMYKNEII"
FT                   /protein_id="XP_626887.1"
FT   gene            complement(<836478..>841001)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3370"
FT                   /db_xref="GeneID:3374124"
FT                   /locus_tag="cgd3_3370"
FT   mRNA            complement(<836478..>841001)
FT                   /db_xref="GI:66359419"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3370"
FT                   /db_xref="GeneID:3374124"
FT                   /locus_tag="cgd3_3370"
FT                   /transcript_id="XM_626888.1"
FT                   /product="large hypothetical protein with signal peptide"
FT   CDS_pept        complement(836478..841001)
FT                   /locus_tag="cgd3_3370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large hypothetical protein with signal peptide"
FT                   /db_xref="GI:66359420"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3370"
FT                   /db_xref="GeneID:3374124"
FT                   /translation="MNRLQKYFGVFLAGLFLNTLLGCASVSASSETEIPPAASVPRESC
FT                   SLGFSCQSTSCRGGSVIGLCSNKLSSGYTLRLRGKIPDSINLFASKFNGIPVEQTKLVL
FT                   RIIDDNKKPFIDMVITKETIGFGLVGEVDTKNFVDSKRISKGISIDRTPSNFRVESGDD
FT                   FDYYLYYNNSYLTFLFKHKDGKYYEVGSLYILNKAISSIVPLTGPMDYNIHFEQTMTLT
FT                   APKTFVQHTMPGNPSSQVYSGPFSLRRGTEVVYPGGNIFEDGVKIVINQGEITSNKVKH
FT                   TFIKYNDSKIQLTISITYSGNNKYKFLIQNAHKNENKEVNFDANSLKNHLNSGDIVHLG
FT                   YFFTDGHLLICIGDTCFASTEIKGAQINKIRTTVWFTTSVMLSIPEQTLMGSAVGRYKC
FT                   RVGETSCYGSEFRLQNPLSPGQKVEIQSLYDSGNYFNDYANISQKELFGAIAMGDAENM
FT                   RAAVFLSVNSVSLVLFSESGILTDACSVYLSGNNVFNQKNEIKIIVGLSNNNKLGVSGY
FT                   IGNKVLLFCDLNLGSISITRFRPVKDNVYSGSSKYTLSNDYPAEGYEGISGGSSTSRTQ
FT                   QQAANCYLATNGECNASQIVHMDGSGFVKGTYLTVKSSSVIFPFTFYVKSSDNNSDQFA
FT                   FTVISTGKFSMRNVNTQDIIYAKIPPSCMERILHEGLSVLLSSDQSKIYASICGLLLGS
FT                   VPSTSLNKKLKFIFHKNMSGNSVRVATFPVFGGGSVALEYTSEKYSTNSDNIKKDDDLT
FT                   FHSPCDARKSVSTSLDNCSSLINMSTNRLTNGYSIMITGTVEKPSSNLEQAFNIGIPIE
FT                   NAIQVFNLKASNGRTILQFFITEDQLGLSIHNPLAITRNNGHVGAPIPSSVNLEEGSKY
FT                   RIGIGFKDSAINLLIENPYGSGKFAMLRRNLVSVISAWGETAYNRDFTKYEPINSIVPE
FT                   LLVKSPYSYSLSNNVNTWFPVSKEFYAPRSGDNSCTLSIYGVCTTSKVYMPGNKPVNND
FT                   AKFFIRFYSFQKNTFSLSFKREDGTIVAQLEFSSTSTLWSGSVTIKFTTRFERSTDTYS
FT                   VYNFGSKEFIIQFVGNAIGYHLDGQWKVLLALENKDNFNQVLVSQLDGFVIEYVKTDSS
FT                   NPAPWQYIKYGSTTAKASMVLAYNLCNAQNPTYGYFSTPGVYLPASSIENLCSTSLHPN
FT                   HFSLVFKSRYPNYVKDEVAKTFPNFPGFLHSIVLLYNGSVVYTLVIARKYISFFSSLYS
FT                   GEAGTFSSCSSQVPDEAEFQPGSKYYITFFVDGSDLHVYFHSYVVGKSALLCKLPYNQH
FT                   FNAAKTFGQVFIDSSQTTAAIVYGLKRTLYTPNLNASNLYPMGTVVSKNAILSSGMPFS
FT                   PNESLSIEMTCGKDLIFSGQTGKPQLRLKTNGSSFTLENVPGKINATGTLSGGCVCSTN
FT                   KKIVVNLAYVNNQFRLIACKVSAASIFTTGVSIYQISSEVELSVTYRTDLRLASATSLT
FT                   SSQISKVEEQPDTSKDEENIANSGKYIPESFSVQATLHVIPKYSTS"
FT                   /protein_id="XP_626888.1"
FT   gene            <842264..>844258
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3380"
FT                   /db_xref="GeneID:3373940"
FT                   /locus_tag="cgd3_3380"
FT   mRNA            <842264..>844258
FT                   /db_xref="GI:66359421"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3380"
FT                   /db_xref="GeneID:3373940"
FT                   /locus_tag="cgd3_3380"
FT                   /transcript_id="XM_626889.1"
FT                   /product="Dbp9p, eIF4A-1-family RNA SFII helicase,
FT                   DEXDc+HELICc"
FT   CDS_pept        <842264..844258
FT                   /locus_tag="cgd3_3380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dbp9p, eIF4A-1-family RNA SFII helicase,
FT                   DEXDc+HELICc"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359422"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3380"
FT                   /db_xref="GeneID:3373940"
FT                   /translation="KQTMKNENDSNELLSFSELYGSILDRRIIQSLTNSNYLVPTKVQV
FT                   EVIKKIIEGKDLLINSYTGSGKTLAYAIPICHNLLNISNRLANKVYSLVLVPSRELVIQ
FT                   THEIFEQLLVFCENNVSVGTIFNADDNLLHKGKDLKYGSFRYNILISTPGDILCAKGMG
FT                   SKESIFQNIAHLVIDEADLLFAFGYDKDMSKVLDLLPNSQDRKYQCILLSATLNKEVDS
FT                   LKKMVLHRPIFVDIKPEIKEDYFDQEGNDSKCQTSGLLSEYYTICDSMVDKWLMLYILL
FT                   KMNVIPRKCLIFVSEVDTAYSIKLFLERFGMSCGVLTPIIPAATRRMLIQCFNQGSYDI
FT                   LVTSDTINEKDESVLSILKDNSITYRGVDYKEVASVFNFDCPSSVRSYIHHIGRTARGG
FT                   SSGVSITIVNSNIPNEMEVLDELLNDSNRKMNKLKITSEEVACFRYRIEDCMRILTKGN
FT                   IQRHKLQEIQGLILNNTRLLKSGYFSKHPGDKNVLKSYHKHITNALNISNSGREHIKNI
FT                   PDYLYDMVNNNISNSPDFVLDQSSMPNVSMDSVLSNTNNSSHGGSLTEKVQEAIRRMGA
FT                   KDFQFVKENNLNPTNVNKTGNLNSGKKRIISRKSQLKKEPKSYEGTVPDELPAISGRKL
FT                   WKLKHKKRVKKYKDFIDDNKYRKKRGVRR"
FT                   /protein_id="XP_626889.1"
FT   gene            complement(<844337..>848053)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3390"
FT                   /db_xref="GeneID:3374123"
FT                   /locus_tag="cgd3_3390"
FT   mRNA            complement(<844337..>848053)
FT                   /db_xref="GI:66359423"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3390"
FT                   /db_xref="GeneID:3374123"
FT                   /locus_tag="cgd3_3390"
FT                   /transcript_id="XM_626890.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(844337..848053)
FT                   /locus_tag="cgd3_3390"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="short region conserved in plasmodium, possible wider
FT                   conserved domain, one or two transmembrane domains near
FT                   C-terminus"
FT                   /db_xref="GI:66359424"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3390"
FT                   /db_xref="GeneID:3374123"
FT                   /translation="MQINANTDDFNIVEEEVGSFLASEKLQSKHPNTGFPAVYNRKKLE
FT                   KKGEEGSKETDRANKNPINEGFESKPPLIFNFTQNDILKLRWTNPLGEDVNDWESPGKS
FT                   DMNLHNLRFDFEGCLCDNSNSEEKYKNDNLYFYKGLHHHSEQGEFEGYTIPELMHLSRS
FT                   SNVSQRCIAIRTLGKIFIKIREYHTFDHQFGKTYHKYLLGYLFGIHRWYKYLTGDLSIH
FT                   YLLLNMLFHESYASRTAENSVIALNNLLTGGQFPIRSTKNNLPEACKFKLLSYFLTPSE
FT                   FVFEILDEKLVYFPSYFRNNIISQRLEFFTHLMQKQSLGIRYNDLQDEEHLIRFDLPDG
FT                   RSLELLRDTMQEIFKYVPTKYDNSELSVQKNYLFSFLCRMAQNKYGALESRISSISIIR
FT                   LFIQRECIYDQSICFQSLEDMINALGDEVFDFSSSELASQEYSNSPMAKLLFSFIYLIS
FT                   TYTQSLYCIDNRIESKFVSIQNDFLSNFLIKSVLPILRIVILAVLDPRKLHSSEISEFI
FT                   QLSLVEGVKLIGIMALKDIYLEDLSIFCKDLIHYLTFVDLKDSIQSFIIYHLYGLGCNL
FT                   LLFSKYHEIEHEHLQFIQVLNQLIGKIFEKVKIIRGNLSLGNYENFDFVLLSTSIIRFQ
FT                   VLLIERYNSNSSFANDNFEPHFELISFCESYLKTHSKQDFNIDLLTLESGFLLEIEMGI
FT                   TNSQSILSNNKTYGDFFFIILISTFLKEVSRIHLLTGKEEIISLNFKYMKPSFDLLSEM
FT                   YQILTENYILPNYISTDNSDFYLKSNQLFSYELCYFEALNMNDSQTIITNNNVVKKNSI
FT                   YLQSLNSNLLYIYLLLSTHNEHIKTSDIAILDPSAPKSSKVTISKNDKLIFEIENFNYN
FT                   SKILYEKLFILLFASKNLEEYSITLFWILKLNKQISEPFDNFYGRVLDEYSLCLNNTNL
FT                   LILNPFIYSVNIVYYQITTISQETTSTENPFLFSLMKRVFNKQLLSLESSKSMKELIDF
FT                   LSKYIFECSINQIINISRSKYLETDNSNYNLMGITILDYLKFSLELQNYVHMNKEKSVK
FT                   ENENLQDYLLEMIRTWRQNKSICAKTMYNLNNKTDNECLLKLIDSLISAFCDSNIYFPE
FT                   QLLDCFYFIFIVFIFETISDTGFILKILSNIKIMKFLLYHNKTDISYIFWQFKSNKKMI
FT                   ETSDNEKIINLISEIITSYKDSACKNTLLVFLVVYINYFSGSELELIEEMKKFYKETKL
FT                   EYLKYVLDSLNEN"
FT                   /protein_id="XP_626890.1"
FT   gene            <848597..>848929
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3400"
FT                   /db_xref="GeneID:3373939"
FT                   /locus_tag="cgd3_3400"
FT   mRNA            <848597..>848929
FT                   /db_xref="GI:66359425"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3400"
FT                   /db_xref="GeneID:3373939"
FT                   /locus_tag="cgd3_3400"
FT                   /transcript_id="XM_626891.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <848597..848929
FT                   /locus_tag="cgd3_3400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="domain with limited similarity to a domain RPA14,
FT                   replication protein A (RPA), subunit RPA14"
FT                   /db_xref="GI:66359426"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3400"
FT                   /db_xref="GeneID:3373939"
FT                   /translation="HLTNRRVNKEELQNFVNKQVRFVGKVVSVEGEIVILEAPDGGTVR
FT                   CRTISPPPSTYVEVIAQVMPDLSLTQTDFMFDLGDSLNMDLVNESIKVSFHPKLRQHWE
FT                   PVSNIA"
FT                   /protein_id="XP_626891.1"
FT   gene            <849207..>853817
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3410"
FT                   /db_xref="GeneID:3374122"
FT                   /locus_tag="cgd3_3410"
FT   mRNA            <849207..>853817
FT                   /db_xref="GI:66359427"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3410"
FT                   /db_xref="GeneID:3374122"
FT                   /locus_tag="cgd3_3410"
FT                   /transcript_id="XM_626892.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        849207..853817
FT                   /locus_tag="cgd3_3410"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359428"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3410"
FT                   /db_xref="GeneID:3374122"
FT                   /translation="MDLSISPNSLLKELIANKEFVHIVSTDVLAVTDNCLDFIWDVGIS
FT                   GPRGSESKIFNSNKHLVGLIRRGLSFGIKLSLEKAKKSKKWFEYDPNKIKVWILKRGME
FT                   KFGDLLFDFEKRLDQITPILGENLKGLKIVALEKLDGENSQISYFDTTDQWVIGSKNVT
FT                   ILCRDINDLESTLYAESRYESVKVSAYSWFRTLEQFKACSKGDFVAKINDLKKLLMNNT
FT                   LLCETIGNSNRQHIINYLDITTPQLYFTGLVSKENKRDSCYNPVSLMQFLDPFFFKYTA
FT                   KFVDLPSQSIVSESLEKRIFGNISISFSPICSFNNQSFDFQSIDELCNYLSVIQSIILT
FT                   LRTNTEGIVLYLINSGQKLDQDIVLSAFKIKSLQFSTLRLIRENLKNSIIKNFAINGLD
FT                   EYKEAMTQPYKNHNSIMKYSIDNFWFSVYKYLIISVQNNAENFFNVIDKNFKIIRKQIS
FT                   NVYNIFDIEIVNQIENEFVFFKQLLLYSSIYLIDQIIYLNLNNTKTDSVQLSRYFFDSF
FT                   SSFISDIKSQISCSRKLTGIPPSICSTCNVNSSGSVIVSPSHFGSIPSGSTIEFMVPPF
FT                   NWSWKEIKDMLSSDFSLSHDTWILNKDEYYVTLDQKDSSESFLFPFSKTKYHLFVNLRH
FT                   VFDDCVSRERNQLYSYYKIFVPNKHKLSTDSNNEVIFTRTENSIKLSTFRSSSVRLFWK
FT                   MIGKLDSATKTTIINEIGTKGYNQLNQNQQLVRKLETLPLKFPWVNKSCTYIFPSGYAI
FT                   NIRDFEHLLYAIFGSSDFKYVVNSFYNCETNQDLSETVNIKESPTGNGLKLETTFVLPC
FT                   GIPGSGKSFMLKSFIKKQMSIRKDSYYVSALTSGEHVTKFDMEDESIYSLIVSSNNKSN
FT                   SSKDKRFDLIFYVSKDGCTRSILNGFKWNYNALFSEKIPKTYTNYSLPADSSEDSLSET
FT                   EFRKLSKKSKFCMNFIIESFINLCSEIVKGNYEKGSTKDESFPEWVKHLKSEYNFTRNL
FT                   RILILVDMNHTPDAFVGINEDFSSKFKLTEITLYKVIVLFISQGFIKSSRRPKKWRFIM
FT                   SKEEVIISILKMIKRKNHSTLKGLSRKSVNVLLHFLTLYSQVIKLVNENGQAINSVLSK
FT                   NTFKSLGFNGVIEIKNDYTEFKSILKENSEIFASLKSDLTQILNNNIDLQNTKNSEKIV
FT                   SRFMDNLEILSNSINSIPDSLNHFAVNSFYSFIYSTCNNIPFKESENNSTKLYYSLGNN
FT                   LIIKPFNLNVNPKGDLGDYLSRIRGEHNLTAITFENHKSSIEAITKIWNDHKESLEDTI
FT                   NHDSDSKEDVDHKVIKLEDIPNDKKHVTCCFFGHTTDSNTKDKSNVEFLLISKTISNLQ
FT                   VLLSLPFIGRSYDFQVSYLIFIHGWKLAFLTVSPMSKLFEIPSNETNYDIIINEKLPNN
FT                   SVENESVKEFSSNPEIDEFEGIGNKTSLLLTSLLPFRENGHSHITLISEKFNPVISNVA
FT                   INLLGEDFSKLSSLDANEYGVQTLEVQVNEQPLEGILKKGLSEDDSKLDPVKTLRILAI
FT                   RLWDKRIMLKGDLGYM"
FT                   /protein_id="XP_626892.1"
FT   gene            complement(<853978..>855174)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3420"
FT                   /db_xref="GeneID:3374121"
FT                   /locus_tag="cgd3_3420"
FT   mRNA            complement(<853978..>855174)
FT                   /db_xref="GI:66359429"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3420"
FT                   /db_xref="GeneID:3374121"
FT                   /locus_tag="cgd3_3420"
FT                   /transcript_id="XM_626893.1"
FT                   /product="protein with 2x EF hands and 4 transmembrane
FT                   regions"
FT   CDS_pept        complement(853978..855174)
FT                   /locus_tag="cgd3_3420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 2x EF hands and 4 transmembrane
FT                   regions"
FT                   /db_xref="GI:66359430"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3420"
FT                   /db_xref="GeneID:3374121"
FT                   /translation="MRRNNPDHKTPDSDKKELRSSKDSVVIYEDEYERENNQENENNKA
FT                   NHSEKSRNIDKGSKIKVNLGNTNGKKCDGEIESVSLKENGEPGQGNLSNDESAHLLKKE
FT                   RYEQKIDIQDKTDNELFQNLKKEAVNSFLEVKQDLLEQYLEFRDQVFKGQKSFRVLSQV
FT                   ATANLFLMGTLNCIFGLISINLLAIVISLYIISISSVVLIIEVSKKKRIKHIEIFVRTW
FT                   FKFLELSVGRGSIQILLCTISLYLTQSTYFSLMSLFVGLTGILNIIFGILAASKLRKIL
FT                   NILKYYGSRDLEDLGIYNRDEISHSELGNIKISKDHDPEYKLKKIHRFFNALDEDGNGQ
FT                   INQDELFNGLKSLNFPFSISKSEIEIIFDHLDKDSDNMISIEDFEHWFISNKCPYFIL"
FT                   /protein_id="XP_626893.1"
FT   gene            complement(<855744..>861053)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3430"
FT                   /db_xref="GeneID:3374120"
FT                   /locus_tag="cgd3_3430"
FT   mRNA            complement(<855744..>861053)
FT                   /db_xref="GI:66359431"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3430"
FT                   /db_xref="GeneID:3374120"
FT                   /locus_tag="cgd3_3430"
FT                   /transcript_id="XM_626894.1"
FT                   /product="extracellular protein with a signal peptide
FT                   sequence, MAM domain and a Cu amine oxidase domain"
FT   CDS_pept        complement(855744..861053)
FT                   /locus_tag="cgd3_3430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular protein with a signal peptide
FT                   sequence, MAM domain and a Cu amine oxidase domain"
FT                   /db_xref="GI:66359432"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3430"
FT                   /db_xref="GeneID:3374120"
FT                   /translation="MLHWLKFLLLTFFSLSELICSQINEADASNPLTRNAGILPSMNEP
FT                   SAIEELLFPERQEQSKGRPSLRSLQEKSNNPEKAVSSDKKSEKGCVLYLYTQDSPNPTE
FT                   IIDGASSCPEEGNRGYMLQSGAEDEAVSGPSNSIVEISPIVQEYFCIKRSNCIVAISGV
FT                   GLTQDDSIYLLKNENYSPEKTIKQKNLLLSDILRKCPPNKIGLGPFKGVRSYETSELVI
FT                   GDNMQKSAARQATVIFSINGIKDDADSFTICYSPARSRAFKDTMSPKLHIYSAGLLNTK
FT                   ENSSFNCDFELQGYLGCGFSSLLDYQTKTRFELGVGEETIVGSRPESDTTTGVKGEGHY
FT                   IFFRAPGYMPGASAVLIGNPRVYSFGSHCLTLRYFMAGADVNVLRMYMASGLLNSVQLD
FT                   GKGNRLENKIPKPTLHYGRPNWLVVGQQGPSWQFGGFEFYSDGITPLRMIIEGVGGRSE
FT                   DSLIALDDIIVKSGHCSNEVMRSSEREDQRCVWGEVRLVSSNFTTEKSWEVEGALGCSG
FT                   RTYSFNNINVNSDLVSSTDWIPCCLPGYGNYTVSLHDSYGDGWNSGSYLEFRFFDEVIK
FT                   VGEGFKQGSSLKTELSIGSIQIEKVEADEKTIRATIKSNREGVDVWCGITRAGAITPTV
FT                   SVLKKYGQRAPKSLNIKESHTFVISSFSKGEIRPNTEYDLFCFSEEVSRIIKNKGNTDS
FT                   VSSVDDLSVEYSRIRVTTDSKSPELEIKQFKTLEESVELTLKINESGTIWCMADNNNNF
FT                   SRIRDLANKDHIDEQRLVKLIKSSGVEKNISSKDISGDIKLSIRNLIPSTEYDIVCLAE
FT                   DLALPRSNRISFEKVLANLTKRVTTKDRVPKIEITRIVPELGRFNIVVKSDTPGKITCV
FT                   ATLPEGMYPSPSEIEKYGQNTEVSDPKEEKQLILNGIEGNQKYIIYCMAQSRTGLTMTI
FT                   SDIWATAKDISSFGKFCDIPSYPSEVENGMETPFDPLTYLEEMKVRSYFDSVKESVGSK
FT                   GPYRVTLFVNKTEAYEYLDSLDLHKRTPELYPKPNPPERYARVRFGSCNETENMVDPLG
FT                   LNGLYHQWKVGPIILTKKETENIGLWNVADSNTTSNVSEDEKIIAMKHYPISEPRPVEC
FT                   DGWNPTGPFGRRLEQIIINDEGKTRFSIPMLKLGELLEQNSLDKIVFETCGNYLPRDQV
FT                   FGKDYVKLGPIIYQPHNVTSENEEEQERKDVDEEDEDEDAEPKLWIGLKTKEGNQCPIF
FT                   FELKAPYTTLESIRNGHAKIEFDRMHQMLVNRIWYDGTSFKTLQDLVSTYNEAKASIEE
FT                   SQSSGTPFSNLPLKLVTPNILQERRIQREKHMNELRLRKLQFLEMFSRGGLESRAKPEH
FT                   CEPGGRRFQVFKSPNREAYTVNWIGWELTLTNDRDSGLKIWNLTFLGRRVAFEVAMVDA
FT                   MAHYTVFERQWFFLDSWYGGLGTAARKVHPGLECANTAQTIFWDSSACIFELDTGRPIR
FT                   SHWKSGGIKDAAPLTSLVIRQIITVSNYDYIVDLILYNQGSFEMGVSFTGELYAGLEVP
FT                   YFSAKQKKYGTQITPSGQMAALHSHFAVWKVDFDLGPDYTDNSVAWVKVRRDPEKEGHH
FT                   ILERIIAERETNAYSMLNETHHHPKAYFVVDEKLQTYGNVGGFMIKSIKSIADLMPEHE
FT                   LYSGPASWSKYDLASSVFKYSELDADLPRDNKFASKPAVRFDSFIMDDEVIRHRDVVTW
FT                   VTSGIWHIPTLEDVPQTTALGNTLGWYARPFNWWPMDPSITLHNAVKGDFIEPGTCALQ
FT                   RKGNLFQLIKVVE"
FT                   /protein_id="XP_626894.1"
FT   gene            complement(<861731..>863782)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3440"
FT                   /db_xref="GeneID:3374119"
FT                   /locus_tag="cgd3_3440"
FT   mRNA            complement(<861731..>863782)
FT                   /db_xref="GI:66359433"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3440"
FT                   /db_xref="GeneID:3374119"
FT                   /locus_tag="cgd3_3440"
FT                   /transcript_id="XM_626895.1"
FT                   /product="heat shock protein HSP70, mitochondrial"
FT   CDS_pept        complement(861731..863782)
FT                   /locus_tag="cgd3_3440"
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein HSP70, mitochondrial"
FT                   /db_xref="GI:66359434"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3440"
FT                   /db_xref="GeneID:3374119"
FT                   /translation="MSMIINSSFNGVVNSSGIAARILKRSLPLVFSRYMSSKCEGKKSS
FT                   NRRITGDIIGIDLGTTNSCTAILEGTQPKVLENSEGMRTTPSVVAFSEDGQRLVGEVAK
FT                   RQAITNPENTVYATKRLIGRRYEEEAIKKEQGILPYKIVRADNGDAWVEARGERYSPSQ
FT                   IGAFILEKMKETAETYLGRGVKHAVITVPAYFNDSQRQATKDAGSIAGLNVTRIINEPT
FT                   AAALAYGMEKADGKTIAVYDLGGGTFDISILEILGGVFEVKATNGNTSLGGEDFDQRIL
FT                   NYLIQEFKKTQGIDLSRDKLALQRLREASETAKKELSSKTQVEINLPFITADARGPKHL
FT                   QIKLSRAKYEELVDDLLKKTISPSEKCIRDSGIPKEKINDVILVGGMTRMPKVSETVKK
FT                   IFGREPSKGVNPDEAVAMGAAIQAGVLKGEIKDLLLLDVTPLSLGIETLGGVFTRLINR
FT                   NTTIPTKKSQVFSTAADNQTQVGIKVFQGEREFAADNKLLGQFEMMGIPPAPRGVPQIE
FT                   VTFDIDANGIMNVGAIDKSTGKKHEITIQSSGGLSGAEIEKMIREAEEYRANDQAKKEL
FT                   IDLKNDAEAFIYSVQNQISSLADQINTQEKDSLESKISKLQSILQESTQSSDYESAIQS
FT                   IKSQLEELKQASWAITQKAYKPGNSDNQSSENYANHEDNSCESQDSDS"
FT                   /protein_id="XP_626895.1"
FT   gene            <864443..>865057
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3450"
FT                   /db_xref="GeneID:3374116"
FT                   /locus_tag="cgd3_3450"
FT   mRNA            <864443..>865057
FT                   /db_xref="GI:66359435"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3450"
FT                   /db_xref="GeneID:3374116"
FT                   /locus_tag="cgd3_3450"
FT                   /transcript_id="XM_626896.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        864443..865057
FT                   /locus_tag="cgd3_3450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359436"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3450"
FT                   /db_xref="GeneID:3374116"
FT                   /translation="MKRYYKNESSGLSSVLSIPRTNTDFEVETAATKRESREFPSLPST
FT                   SIEIDSDEYCNISSASLDSVCIKDLSRLESNSLIKKGDRLKYKTVWMGPGGGYSLMEEY
FT                   TEPRKCMEREVPKESEMELKRYRQPGSCKNSKSMNNLASNSSVQVIEEAGILKEDSYIF
FT                   KSSRSLANVDWNKQEFVGPLPFQNKVAIGNRSCLGRNLIPL"
FT                   /protein_id="XP_626896.1"
FT   gene            complement(<865133..>866887)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3460"
FT                   /db_xref="GeneID:3374117"
FT                   /locus_tag="cgd3_3460"
FT   mRNA            complement(<865133..>866887)
FT                   /db_xref="GI:66359437"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3460"
FT                   /db_xref="GeneID:3374117"
FT                   /locus_tag="cgd3_3460"
FT                   /transcript_id="XM_626897.1"
FT                   /product="hypothetical protein with cysteine rich regions"
FT   CDS_pept        complement(865133..866887)
FT                   /locus_tag="cgd3_3460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with cysteine rich regions"
FT                   /db_xref="GI:66359438"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3460"
FT                   /db_xref="GeneID:3374117"
FT                   /translation="MSVYYRFLHEKSDSYRAIELNVTSVRTSDLKMLVAEHAGLGKEYM
FT                   KLFDLKVFDNDEKEAFPDDKLLPIYSRVVIQRIPWRELKEIHHDAQRSIAEGEETEVVE
FT                   ETKLTLPSEYICKLCGFPLLNPVLIKCAGSCGASACRDCVKNYLEQNKAVAVKPCPSCG
FT                   QRFRGSVPNKSLANMLSTIDWDKFNYPVRNSEADVSKDSDHLLKNQDTSISGEALTHDS
FT                   VSVAKTDPELDEVKISMEVNTLAQNLNQDSSSVPVGESLQKDLCVVENNTNESSEHKLA
FT                   IPQAPNVDSTYRNEGNLASINVQNTTDESLNATSSAIATNLNAELKQLSPPNITNLNEQ
FT                   SIETSIPIIPKAKAAAPSYSGLPAPVLPPHHAPPLIATHQLPPHPGIHAPPPFMDPWNM
FT                   QGHPYPAYAPDGASHHFHPGYPGAPFPQTGPTHPYGYVIQPPNMINPGIYGAHAHFQPF
FT                   VEPILPICGPYLTEEQQIQLAMSFPMLSKENFELIKQAQQSVKDIWGLLPKSIRSSLLQ
FT                   ETQDFGNSNEKKSKLFKKRKDYNYNTQNNIINNNGVNPINNHHNSNNSSSNSAHSYSKH
FT                   PSLKKRSV"
FT                   /protein_id="XP_626897.1"
FT   gene            <867619..>868404
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3470"
FT                   /db_xref="GeneID:3374118"
FT                   /locus_tag="cgd3_3470"
FT   mRNA            <867619..>868404
FT                   /db_xref="GI:66359439"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3470"
FT                   /db_xref="GeneID:3374118"
FT                   /locus_tag="cgd3_3470"
FT                   /transcript_id="XM_626898.1"
FT                   /product="proliferating cell nuclear antigen"
FT   CDS_pept        867619..868404
FT                   /locus_tag="cgd3_3470"
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proliferating cell nuclear antigen"
FT                   /db_xref="GI:66359440"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3470"
FT                   /db_xref="GeneID:3374118"
FT                   /translation="MFEARLQNAMLFKKIAEALKELCHDINIDCDSDGLHLQAMDSSHV
FT                   ALVSLNIQPDAFEHYRCDRPVVLGLDMQQLSKFMKFCDKDTSMTLKKYDDNEDNRITMC
FT                   FEDNSGILSSKECTLRLMDIEQEHISIPEEEYECNVTMPSNLFQSIVRDMSGIGDEVSL
FT                   EISGKNIKFCVDGDDGKIDLNFPLNDSPDITKAVQIHADDTISQKYALRYLSYFTKASP
FT                   LSTTVNISISKGVPLRLQFPLNDKYEHGNMQFYLAPKLR"
FT                   /protein_id="XP_626898.1"
FT   gene            complement(<868396..>876132)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3480"
FT                   /db_xref="GeneID:3374115"
FT                   /locus_tag="cgd3_3480"
FT   mRNA            complement(<868396..>876132)
FT                   /db_xref="GI:66359441"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3480"
FT                   /db_xref="GeneID:3374115"
FT                   /locus_tag="cgd3_3480"
FT                   /transcript_id="XM_626899.1"
FT                   /product="large Sec7 domain containing protein"
FT   CDS_pept        complement(868396..876132)
FT                   /locus_tag="cgd3_3480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large Sec7 domain containing protein"
FT                   /db_xref="GI:66359442"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3480"
FT                   /db_xref="GeneID:3374115"
FT                   /translation="MIINTIKSIQKFSSTSRKYKDLEVVASHCIDKLKFFIGYTQLQNE
FT                   KEFQDLILEFDNNFDLKDYLSGAVTSDLKNLIYYADKKKLKDLSFDEYGKHLDLLYPYI
FT                   LGPIFKACRQYTNPKLTLISLEGINKLLSFEALARTLIEEEKLYGCEDIIENKEPVNGL
FT                   EFLFTLLFNIYDSKIDDESILTQIIKTSIPLIGKNIDCFSCQMLYSTFLVLFNIYSNTI
FT                   DNGIRATTYSILIHFVSLFFDDSFEKRNEYSEKYFVLIIEILYTFTMTNSMIHIKKHET
FT                   QKGRFNQIKLISPLDFELSSKDFIEVENNFFIFSQVRELDPRILRIRNLSLEMLHAIYA
FT                   KIKLREYQNTNFGDYVRRLYKLHFFSIIKNIVLNDFQARKNSIQLWSNALQIHDLSQTI
FT                   RLHGIFISKCIRGLFENGIFENSEKNVIIESIFGTLTENISFLTYLFIEFDLDINSENL
FT                   VLNTINFLINQIMEGGSIKTQNKSLNIDIFTLITNLIINIKEELKRIHKLNSFSHIEFD
FT                   LNTAPIRKYLIDEYIKNFNEGNYEKGIDLLSEIEVIDKENCISIARFLAQNRAINKKAI
FT                   GDYISLPNPRNKEILNHYCNQFSFKNKSLDFSLYLFLSNFHLPGEAQKIDRIIEEFSLR
FT                   YFLDNPEIFPNKDKIYIIAFSLIMLHTDAHSKEIKNYYRMSKSDFIKNHNDLILSSPKL
FT                   VDSLEAFYDNITLNEWIFENSKERCKVYFPYIDYLINLIQNLEFTNTCLTNNSKNACYY
FT                   NSSSSYSSNFQIKIISNEIIHKIANLLSFQTDPEIIANQKDLFKFIYQSIKKKFETIYF
FT                   NGIYSEDIVYWKFIPNTPIQWIIGLSECLKGRNLPIKSEIQQESIYFQYDGLSFNKNTK
FT                   VVHSNNILQTSSVIGNNQNLSKWITNNKNSDIKVRDINSIFQITISDLIKEMHPNWSNR
FT                   KYKRTESMNQKRIEIEESYIILLGKMICCYFTTMLSNVDFWMCFGKETMISWIPILKYS
FT                   TELGIILGLESSFTINLTVLSYLTNTLTLPLNLNDLFFCNSNITEEIRVILKNDHHSFE
FT                   DEKYSKSLKFPELEKSGILEQYSDLIIRSFQTSMNFYNSFESKQECKVKDENEKSISHS
FT                   FAHSTNQESEVLLSYLISNESFSTHSSLNYLNIEAIKAIFEISQDYGDQVPFILWVIMI
FT                   GIVSQVDRYFYVKTILKGNNTDISDYFDHNKFINNKSKAFGNDLTKFLTLSKISLNLTK
FT                   SNTLNSRHFNQFFNRKLIKSTKNIFNSTKSIINSGLSNNNSRDNSRSISRASSSRETSP
FT                   DYSNKDTEIIQSKDENEIISSNTYFQNKIIYGSNSQNIQIYTNLKNSISFNNLWFKDEE
FT                   IIEQNSTVENNGEMLIINDEKYSLILNQVSLINLRRTEMFNSKLITNELEFYQVMERIF
FT                   TRIAMDPIKNKRVITDLFLALIFNARNQIVLSGRKSIELFLFRKVFEFMNLILEYNFQE
FT                   FFELILWDKYFIPIYYSEIIQILSGKAYLEVLDSIKSFTIKFIESQDMFIRSKYLNNIK
FT                   DENKVNNYPEEIKMIIISSSLDFILEKSSNQLSTNFKYFHSKELNLTQLSIFILFKKLV
FT                   EKIINYESYNEYIVTVELLLEILKNIQNLYQNLKLLNFLDVNDIIEIYYCFIIGIQKGI
FT                   EKTEEKNINNHHNSKKKKLINILNSNSHSNKEELNKDKENEILARILLCLTTIPRLSFI
FT                   LDDDIFSKLLDTFFILIKVFVQKNVSKLICKILDYILYMFYIKIKYINNQDIEEIQNLD
FT                   EDNINGLQLLNIRKTNNIRKNVYNKNQYKLILCYFNEFSQLITKSLIFEKKYLDLYYYY
FT                   LVNISKLINYWLGICPIELIIHEVFLIQNIIPDIINLISFNNKKNIINQTNISLTADYM
FT                   KTKGVKFLDKLTTEEKNHETSLLLEEESMIKNNRLEDDSGTEEYHDENDFENDDDDDDE
FT                   DNCFVNDEADLDIIRYISYNSTRNEKSTFEVTNKNSHLDNTQLTLSSKEDLKMKTNYKN
FT                   NLTIFNKKFKEINRVLTNKTEDKDHLISDEILENLNYDDINNIKIDKEYGDLKAIKIIH
FT                   NVYKIIEFYIFRTSIKYYRFLLKDWLILTNQILLSQTMSIFCKDDIKIQYKMLIVYINF
FT                   LYNNKSLFGYKEWHQIFQYYSNFVGEFTKSIQIDPNKYIIEDVRSRYSIDDLGVAYGER
FT                   EFENQINEKKKSKDDEIVDTRKRRQHNQFEIFFRSKFFNKRYFGLIENKKNHKNDQNGI
FT                   DPNKIGKYKNKGRRISLKHCLEKNWKCYSHKNIKNTNDQEMYDSFIRLRLSIEELIFKD
FT                   IKYKSNYDEEKTMITINRPDCVHDLYSALLVIYNILFDWYMIDLRSIERELDMGINKMI
FT                   YDTIINSLNKLYFELLNGLNLVKFDLFQYNIYLVLWIQLHVRKEFSLQFKDNLQYYKNE
FT                   LLSQCEDILEKYVKIEKSKNNTLERREKGLHSDDYYEKKRLSSIISPNIHFNHHFNSSY
FT                   DRILKNKVDITYSYKAVLNSLLSDLKEMKQSEYIMKSSRFYKVLLDITLLEDQNLRILS
FT                   RDILIEFARKEKDTIKSSSLSSPSPSPLPLSPSSLILSLPSEEQILPMINDYSSS"
FT                   /protein_id="XP_626899.1"
FT   gene            complement(<876908..>879043)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3490"
FT                   /db_xref="GeneID:3374114"
FT                   /locus_tag="cgd3_3490"
FT   mRNA            complement(<876908..>879043)
FT                   /db_xref="GI:66359443"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3490"
FT                   /db_xref="GeneID:3374114"
FT                   /locus_tag="cgd3_3490"
FT                   /transcript_id="XM_626900.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(876908..879043)
FT                   /locus_tag="cgd3_3490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359444"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3490"
FT                   /db_xref="GeneID:3374114"
FT                   /translation="MKGSLIMELNHNRLVEVALNEENELLILRNKLMEVNESNVTSTES
FT                   IDSLYLTYITLLGYGKEMELGLSYKLLSDKIVGISKMMDNTPFSIGKYLGFTLILSIWI
FT                   LKSQDWYNLDDLSSTDICNVIIKLLVECCNGENVISNEFRGKKECENLVTSDKNWIEEW
FT                   GEPTNSYFGTRINGEEETVGLIEMNDEIDMNIINLQSHQDFKMNKRRRLNGMISGEYED
FT                   GFKYIIFEITKINTESLNLLFDKEFSDDLFTAFQNINFQDITQKNIFFNKIFFLNSMIC
FT                   FYRCSGSFLTTALLFKLPRGRYLLESGVEMVADHLLKDIIYSYQGNTSDKTKRMEDHAI
FT                   LALDNISTILWFKTFEAKISIILEGKIQELSNESLEKQEVDKEYQKLELLNDHSELINK
FT                   VFSKFIDHNLNQSNQIEFLPKIFNRIRVKQVKSILEVINTTFSIPFLSRNHFMAHFHAS
FT                   NISNKQILNLFFNIGYFAQLSIQNCFSEMDIIIPILKTYNSTIFLISRFGESSTKQLFI
FT                   EELTNGLNHKLTSVDLIQKRIRDLLFSDGKIELCNKSNSLHYSLFKFAYCIILDIKSII
FT                   LKFNYKQKSPNSKMTKSSLVFNRINTSSQNTFNFEKVIYYKIASFFYTINFINIILDRY
FT                   SMDPKSPKKPLSIFIENFFLNFLSQDEIKQIYHFINNEINLYNAERKFFDPNLKFEIDF
FT                   IKKYLSKFSNKNCSLEY"
FT                   /protein_id="XP_626900.1"
FT   gene            <879363..>880412
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3500"
FT                   /db_xref="GeneID:3374113"
FT                   /locus_tag="cgd3_3500"
FT   mRNA            <879363..>880412
FT                   /db_xref="GI:66359445"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3500"
FT                   /db_xref="GeneID:3374113"
FT                   /locus_tag="cgd3_3500"
FT                   /transcript_id="XM_626901.1"
FT                   /product="Nop12p nucleolar protein, RRM domain"
FT   CDS_pept        879363..880412
FT                   /locus_tag="cgd3_3500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Nop12p nucleolar protein, RRM domain"
FT                   /db_xref="GI:66359446"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3500"
FT                   /db_xref="GeneID:3374113"
FT                   /translation="MEKAEKVTSITDIIARNSRSKGATEEINPNIEKLLSECSDNPRIL
FT                   APKNQEKNRSENVAKEEKPKEFTKVKYDKNNDPRIENTLFVGNVALHISEKELLSKLEI
FT                   KQGEVESMRFRSLPIHPKFASKKKVGAALECFSGNSSTKNAYIVLKEKERMKPIIDKFS
FT                   GIVLAGNILRLTPASKGNQFSTFDRKRTVFIGGLPKFCTEDELRRFVTMSLNEDCVHSV
FT                   RIIKSATTGKPKGFGFVLFNDRKFVISSVKMLSGAQFKDSKISVTRALSEEEAKSKANS
FT                   NNSRRRMINNGTQSKNKEGDDSMRENRFISKKNAKNKVNKIKKKLKKVVKKAPNIKKAS
FT                   KSKKSKSKA"
FT                   /protein_id="XP_626901.1"
FT   gene            <880672..>881037
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3510"
FT                   /db_xref="GeneID:3374112"
FT                   /locus_tag="cgd3_3510"
FT   mRNA            <880672..>881037
FT                   /db_xref="GI:66359447"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3510"
FT                   /db_xref="GeneID:3374112"
FT                   /locus_tag="cgd3_3510"
FT                   /transcript_id="XM_626902.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        880672..881037
FT                   /locus_tag="cgd3_3510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359448"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3510"
FT                   /db_xref="GeneID:3374112"
FT                   /translation="MAELILNRISEALGFGTKCCSKCIFEGEKETLQCYDLDPPQIVNE
FT                   ISKINNKNTVIGLDCNQKEHEEDLARDAARKVFGTDLENSPTVKREERIIQEESSVPKL
FT                   DLLKEENQRTIKFEDCN"
FT                   /protein_id="XP_626902.1"
FT   gene            complement(<881241..>884060)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3520"
FT                   /db_xref="GeneID:3374111"
FT                   /locus_tag="cgd3_3520"
FT   mRNA            complement(<881241..>884060)
FT                   /db_xref="GI:66359449"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3520"
FT                   /db_xref="GeneID:3374111"
FT                   /locus_tag="cgd3_3520"
FT                   /transcript_id="XM_626903.1"
FT                   /product="putative sodium/calcium cation exchanger having
FT                   12 transmembrane domains and signal peptide"
FT   CDS_pept        complement(881241..884060)
FT                   /locus_tag="cgd3_3520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative sodium/calcium cation exchanger having
FT                   12 transmembrane domains and signal peptide"
FT                   /db_xref="GI:66359450"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3520"
FT                   /db_xref="GeneID:3374111"
FT                   /translation="MKTIFVVLLFFIYLSNEKYQTGGFSFPDECESYSSCSADDHGSEL
FT                   NIMDQSHWISEISQQSTLIPYSKIFYTYIFEPLFDNDQPNERNSAFFGFLLNKVTFAIC
FT                   LLVWSCILFIACGTVADTYISSLMIKLAECLSLSDTFAGSTLLAFSNAASDVILGIISV
FT                   SIGEKDAVDVFLGDVIGACLFIILVVFGCVMVFSKSSENSNYINIPIFNHLRDTIALTI
FT                   GLIQLLIIHHLGFISSKMSVIPLIAYGFYVLLLQWSEKYTSLSMPVNLTIKEEYVGPVY
FT                   EQVTDSDEVRGGSKLSLRNVAITSDIPNYRYSNTIPSVLPIPFTPPDSIRDVQKADNGN
FT                   TPDLEIPPIKLSFSNLQFSYDEKSQLLEKGTVINSDVYWDRIGSKSRSIKKTLLLLTPT
FT                   HSPSPSLTNDDLSGKVLTPSSNYGFGRDKDNEDFEKAYGVNNAQSCRIPFPQRNSSKNL
FT                   LNRERNYANTLELPNPWNFQSQRSKSPVCSQLSASHLKGDQSSQIGNSNSISISDAYQS
FT                   NNFSATSSSYSSNLGSITISNYETKRSGSHSQLVLLSDDYAVRLSRNLSMSEVVYQTES
FT                   LHNSLLPPPAHEENVLKLQKRGRQRLREDRCIIDDRTNFPTLQLKIPQSNERSEGFFQG
FT                   MSFNTDFEGLLDGFFEFCDFFRQLLMTPIMFILYLTVPSPSLRRSVQIMQPLFIVLAVG
FT                   FEKKIYVSYPLFYLIALLLSSIISLVLFFIYTCILNTRKDDQTGEDDLKDDPQNYRLYR
FT                   VRSFSNIKLPEVQLSFKTRKFITDILMYCDMFFGIIMSIYWNGVLVNELVECIKVIGLT
FT                   LGIKPAILGLTIVAMGNSIADLFANVAVSRAGHAHMGLAGCYGACVFLLLFGFGSSVFV
FT                   RAIQLGFSKDIHLHFESQIITATYQLLYFLPISALVVVLSKGRVHRIWGLAFILYFIVC
FT                   MSYVLKGVI"
FT                   /protein_id="XP_626903.1"
FT   gene            <885038..>885696
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3530"
FT                   /db_xref="GeneID:3373822"
FT                   /locus_tag="cgd3_3530"
FT   mRNA            join(<885038..885250,885331..>885696)
FT                   /db_xref="GI:126644814"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3530"
FT                   /db_xref="GeneID:3373822"
FT                   /locus_tag="cgd3_3530"
FT                   /transcript_id="XM_001388087.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(<885038..885250,885331..885696)
FT                   /locus_tag="cgd3_3530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644815"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3530"
FT                   /db_xref="GeneID:3373822"
FT                   /translation="MRSIRISDIQFQQKKGNKKNKKNNISGYDNKISDSNIGADSSVLV
FT                   ECGCYAKLHAIYITCIQCGKLRIKISFLGRISCELEKDIIELNNECIFCKSKLVKDESG
FT                   DFISEGNNEDEEIAHYFQALERRDRLLEYAKNSTSRTRVIDEETDWFSEFENPWNTKDE
FT                   RLLALKMSKECAESAAKSRFSKYIFVIRI"
FT                   /protein_id="XP_001388124.1"
FT   gene            <885718..>886023
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3540"
FT                   /db_xref="GeneID:3374110"
FT                   /locus_tag="cgd3_3540"
FT   mRNA            <885718..>886023
FT                   /db_xref="GI:66359451"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3540"
FT                   /db_xref="GeneID:3374110"
FT                   /locus_tag="cgd3_3540"
FT                   /transcript_id="XM_626904.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        885718..886023
FT                   /locus_tag="cgd3_3540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359452"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3540"
FT                   /db_xref="GeneID:3374110"
FT                   /translation="MINIDIENKQITMDEGYNTRNALHYAKLLEEFEHRREKKTDISTG
FT                   KTETNVENVLSMLGQRLRFEEESKIEGSFKLPNKDTIINEFLPLSVNDPVWSDQDD"
FT                   /protein_id="XP_626904.1"
FT   gene            <886403..>889750
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3550"
FT                   /db_xref="GeneID:3373863"
FT                   /locus_tag="cgd3_3550"
FT   mRNA            <886403..>889750
FT                   /db_xref="GI:66359453"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3550"
FT                   /db_xref="GeneID:3373863"
FT                   /locus_tag="cgd3_3550"
FT                   /transcript_id="XM_626905.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        886403..889750
FT                   /locus_tag="cgd3_3550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66359454"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3550"
FT                   /db_xref="GeneID:3373863"
FT                   /translation="MMWLFRTLLFLLSLLCLGVTTVFGDLEENSKATNGNETLEDLAKK
FT                   LLGKFESMEYPGMQNITDPLTKIVYGPFFYEINNVSLPLNITSLTGGAFNPPSSHESAQ
FT                   YYYESFVTEPFTPDQSDAIASFEARKVIRGGVGAPNGTYVFFQEEIQLLPNSSSGGTNG
FT                   GIGGGNNGNNGNNNGNTIPNIKLPEGSFAVNGTRLPVGTTSFGPVTFPNGAILPLGALL
FT                   PNGTLLQAGTKLGQMTTLPGGTLFPGGATFLEDSSYKPVLTLNMNCNFIGSQTYGYRCS
FT                   NKAELKPEASCCITNTLCYSVSGFSNMTSVSIPAGGILPSGSNLPNNSLLLGPLTISTN
FT                   TIFGGGAILPNGEIISPNTTVPYGTILPTGTFIADTIYLETGCVLMGGLIAFGSSPFMI
FT                   NLPAGSKLGLGTSLGGGAILKGISYLTGGAIFPNGTILQPGTILQPPLHPDNVITETSL
FT                   LFNYHLGIQDNLSSWVLPSGTLLPGGFSNRVALAVLQGGFYQFNAPFGYKNAVYKSSID
FT                   NQQEKNAGFSSVSNIFNDLSTNQNNLHPYFDDNSDLYGTTTTYSSNSNYGSQSGSSNLI
FT                   GFRVLNYQIPSSSSYMELPQQMLLIDNAYFPNGLSSNGPILFSNGTILPSPVIIKSSVT
FT                   LPPGTFIFGALLTPNVQLGGPSLVLGTAVLPPSIRLSSSTSLPSKAILPGGAFLPLGGV
FT                   LTGDILYPSGKTIQSGTSLPSNSYIKPNALLTNGLVLPGGGIFPGGILIPNGQFVQPMS
FT                   VPPGTMFPPTSTLLGTIHMTKGGALLPGGAVFSGNSTVPSGSQLLIGAVLSQGTILPGG
FT                   IVFQSETIISGGIQISPLNSLSDLDINQDDFNPDNYPPFFPQDPSNPGGNSPNNNTYIT
FT                   AQVNITNFYYKDQSQDSFSFFKNLFSSSLALSMGFETNSILINSLSPAENPYNISGYDG
FT                   SFLSTSLSSPSSFSYLDNFYSSDQKGISVTFEIHPKLENSSLEDIIEVLLNNVIQNPSS
FT                   SFNRIFSWVGFMILADKSPNFWTRHLRGGNRKIIKIPYLANITDFSTIQNAFDGNEIHN
FT                   LLGIIQSRNHNESSVLIDHIDADKNVENVSLWGNSFKEKTQYQSQEQNQNQYLYQEQSQ
FT                   YQNQLGYM"
FT                   /protein_id="XP_626905.1"
FT   gene            complement(<890115..>891932)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3560"
FT                   /db_xref="GeneID:3373864"
FT                   /locus_tag="cgd3_3560"
FT   mRNA            complement(<890115..>891932)
FT                   /db_xref="GI:66359455"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3560"
FT                   /db_xref="GeneID:3373864"
FT                   /locus_tag="cgd3_3560"
FT                   /transcript_id="XM_626906.1"
FT                   /product="CorA family mitochondrial membrane protein with 2
FT                   transmembrane domains at C-terminus"
FT   CDS_pept        complement(890115..891932)
FT                   /locus_tag="cgd3_3560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CorA family mitochondrial membrane protein with 2
FT                   transmembrane domains at C-terminus"
FT                   /db_xref="GI:66359456"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3560"
FT                   /db_xref="GeneID:3373864"
FT                   /translation="MSYNSSEYLYGDQEYIQISPGYSSKNYEEDEYIPEDNEVDIDMEG
FT                   EEYGRILNSRIPNRRKKKKEYEIVNMELEMKKELQGSNQHFKEKENHSKDLSSRYFGSS
FT                   SKIHTIGSSYLEGSGNRRIQHWVEKYSQKQRKIPVVCIKDGKISQKYMQTAELLRKVHM
FT                   HNERQILEERASGALTLRDLRQVVGLHSFERPSIEIRRNCILVNMPGVRCLILHDKVYY
FT                   LPVSPIVFSPGRDESETFEIETETEPQLLSHGINKKIDMSNSKLIGFHLKSKTKTQRYI
FT                   KDSNPRDLSIIEKLIFITRKINVEEAIISEELKQNTLNSELRSNIEAKAPIKDLYNITV
FT                   SAPEYLKPETKTKPESLHKSNHCSPVKLNLLEIPPSGTTKHNEYQHKASLELNALEICL
FT                   IEVCKQLWDSYYIIDDTAQDFLLHIENNPTSTQKVYEINDLRKRLDSLRDRIKGVYEAI
FT                   KEILDDDDLLIRIEISKFWNNPENWDNKAILESTFFDSEILLECYEQEVEGLIRTVNRL
FT                   NAQLDDAIEVMQIHLATIRNNFLKGEISLDIVGVCVGFVSAIASIFGMNIQSGLEKNVD
FT                   IFWFMAYTMITLCVFAGIVVILMFRRLQL"
FT                   /protein_id="XP_626906.1"
FT   gene            <892814..>897439
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3570"
FT                   /db_xref="GeneID:3374109"
FT                   /locus_tag="cgd3_3570"
FT   mRNA            <892814..>897439
FT                   /db_xref="GI:66359457"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3570"
FT                   /db_xref="GeneID:3374109"
FT                   /locus_tag="cgd3_3570"
FT                   /transcript_id="XM_626907.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        892814..897439
FT                   /locus_tag="cgd3_3570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to 80 kDa MCM3-associated protein; similar
FT                   to gi:19744967"
FT                   /db_xref="GI:66359458"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3570"
FT                   /db_xref="GeneID:3374109"
FT                   /translation="MADSFGGKNKAGREFIYNVRDELKPPIENAYSNYHPLLRREIFED
FT                   QRNDLARLYFRIQDPIQLSSSGQNEGAQNVFVGELFGMCTREEMINKQQTSTANDFERL
FT                   SGVTLNDDLEARIVNEFLTMKSFQRSDASRVFHKELVRPVVWCRMVVRRLLVYFIEADR
FT                   IFLNYLYRKPQGQGYKYIDIYNFLRDRLRAVWQDLTVQHATRHRASIDSFEVSFRFLLF
FT                   SEEYLCNLKEFNSVQNGSLMSTCLDKLMSGYLDVLYYRKKSSSYLCDSELSRILVYDSP
FT                   FQPEFWSYRILTSMSIKIKDANDNRIMDIINLISPEMIEHPLIKLSLGIHCSFRFVNIV
FT                   RYFRYFRKCFGIISNLIKDENNSIESFQNKDGQDPEQYRQFGHALILICILIKKYSNII
FT                   RLKYLNILLSSNMSKRQLMPLNSFIEIFGFYIESIESLKLFTERFDIKIFNKDNPNVFL
FT                   FQGSNIGQFQSIQQICNLTTKFVVSFKDCINFSTMESLSILNSLNWPSEILTSLLEKIP
FT                   RIDILDPILGKISKVDFKNKTHTEDLNKNKIADSNSNQFSFTSLSSSNRDVINNNYKNN
FT                   NLSNTLIQNLKEIDINKATAYRNFITNSTKQNKRKGFFMEEEVPSIFSNPNITYDVHTD
FT                   STSNMNTNSSNKRRSITENITLLSENTTNKPYNLQTKNKLANFQIDSPKFPFQTTNSHN
FT                   LLNNLIPNERQTPDPGHCAPIGHELTEIKETEERKQSEKDDVYDYKKEVVNVVESIPKD
FT                   YLDLSVQKNGQVLKFGKEISVNYVGEGDLGKTEANILGLENQIIEDGLVGLSGWKRFRV
FT                   FFNKYQGSEMELKEEVENDRILENDKESQKRINILLSRINLPENENGINQWLNLSVSGI
FT                   LEQIKTDIISRVIKSLKFSFVFFYNQLLNIEGVSRSHISQLNTFYTKLELILSNLTNGD
FT                   FLDKKTVQTTDQLKTTENHDYVFPWNSVMVKSEILSGSKKEKDQMIIDIYEIDFSHENF
FT                   ERFQGNKQSQIPVHVEMLSIWQNNSRTCLRSQLFSNDDISLLKEKERENIKEAENLTLE
FT                   RLLYEYLINNGDVIVWTLPFLVRSCENFINISLNSSFYDSEDTSNEYMKRSLDSFAFPI
FT                   TSEKGKKQLIAEFESCCKVLNIKSYPIEVKSKIPILKTITVVLSFVTYIPINHLILASG
FT                   NEIFQQKLKDEILNLENTIEEIILKEYLQECQSLVISDESILEAGDRRQSFNYGNNESA
FT                   LISNYSGVSCNLKFKCIGIAPLEVLSDSTIKQDKISIYVPGLNSLINTKLNNKSFPNNL
FT                   VVSNHYQEDLEINSISFLSTMWLQNFHKGLNIKDRIGNNIKGCNGNIELSLFKEAIRIG
FT                   FIDCFRLFTNGNIDWILVSGNCSYTEIKEIIIWIYDLYINSMACFDNGLLASLTPRVSS
FT                   FPGSLSWDSRDSYKIRDLSGGILKQYERYIKAISDSLNNKYKISASSINIPKVIWNVIF
FT                   DHLQPINTLNSVLSDSTLFEQFSNLILIRQNLQEDHQELVKNLKREQILDSMDLLSKMD
FT                   KELFNYRAFNYSNRFKLGRDG"
FT                   /protein_id="XP_626907.1"
FT   gene            complement(<897679..>898785)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3580"
FT                   /db_xref="GeneID:3374108"
FT                   /locus_tag="cgd3_3580"
FT   mRNA            complement(<897679..>898785)
FT                   /db_xref="GI:66359459"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3580"
FT                   /db_xref="GeneID:3374108"
FT                   /locus_tag="cgd3_3580"
FT                   /transcript_id="XM_626908.1"
FT                   /product="DRG-like OBG family GTpase fused to an RNA
FT                   binding domain TGS domain, Fun11p"
FT   CDS_pept        complement(897679..898785)
FT                   /locus_tag="cgd3_3580"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DRG-like OBG family GTpase fused to an RNA
FT                   binding domain TGS domain, Fun11p"
FT                   /db_xref="GI:66359460"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3580"
FT                   /db_xref="GeneID:3374108"
FT                   /translation="MSLLQKIAEIEAEMARTQKNKATNFHLGLLKAKLAKLRAQVISGG
FT                   DGRGGGGGGNEGWDVSKTGEARVGLIGFPSVGKSTLLNKLTGTFSEVAAYEFTTLTCVP
FT                   GVFNYKGAKIQLLDLPGIIEGAKDGKGRGRQVIGVGRTCSLILIVLDALKPLTHKRIIE
FT                   RELEGFGIRLNKQPPNISFTRKDRGGITITSTVQLKNIDEETIKSICSEYRINNANFVI
FT                   RCDATADDIIDIIEGNRIYLPCIYILNKIDQITIEELDVLSQCPHYVPVSAHHEWNLDG
FT                   LIEKIWQYLDLIRIYTKPKGQIPDYAAPVILKRDKSTIADFCRRIHKQLLPQMKYALVW
FT                   GQSVRHNPQRVGKDHVLIDEDVVQIIKK"
FT                   /protein_id="XP_626908.1"
FT   gene            complement(<900048..>901961)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3590"
FT                   /db_xref="GeneID:3373938"
FT                   /locus_tag="cgd3_3590"
FT   mRNA            complement(<900048..>901961)
FT                   /db_xref="GI:66359461"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3590"
FT                   /db_xref="GeneID:3373938"
FT                   /locus_tag="cgd3_3590"
FT                   /transcript_id="XM_626909.1"
FT                   /product="dolichyl-phosphate-mannose-glycolipid
FT                   alpha-mannosyltransferase involved in GPI anchor
FT                   biosynthesis"
FT   CDS_pept        complement(900048..>901961)
FT                   /locus_tag="cgd3_3590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dolichyl-phosphate-mannose-glycolipid
FT                   alpha-mannosyltransferase involved in GPI anchor
FT                   biosynthesis"
FT                   /db_xref="GI:66359462"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3590"
FT                   /db_xref="GeneID:3373938"
FT                   /translation="KFLKVKKNLFLIMVYIIIIVFRILNSLFIRTTYNPDEYWQSLEVA
FT                   HKIVNKFGYLTWEWEPCVSLRSIIHPLIFTICYIIINFFKKIVKFFCKNNYQCLYHTNY
FT                   YFIIPRLYQSIFAILTDIGTSKVAYSIFHKNYYARMETKIEDSDNKSKSNLKDSIFFKI
FT                   SFYQKICNKYKLDFVALFISLFSWYNFYTLCRTYAQTVENCINIWSIYFIIKSEELING
FT                   SYSDNQSLIIGIFLSSLSVLVRHSSVQFWLILYLTLIIFQIKDIINKGSKYSIFTIMKL
FT                   LKICIVVVFITIPVMFYLDYLFYKKFTIPMINFVKFNLMGDPGQIYGSNSRLYYFTEMP
FT                   IVTLLSYLPFMILGIIESFNLKNQIFKISQISTLITMILLSTTSHKEHRFIIPYFPILL
FT                   ITTSLGIYKLILEIHKLFKMDNNNCMGLLFSSISIFRIYLNNKYLLVTLLAQIIPAFFF
FT                   TTIFQRGGESAIRYLSNLNLQKNGSIFFVSQCHMYPAYSFLNQDVKFGFFDCSPNINQS
FT                   IKHKNMNEILWTHPNTTQLLEEIFVINPLLNTSYPSPYISSNITKLNTSNFDNCLNYRF
FT                   NRKLSGELPKFFVINSYFNENLQEWLHKHNYKLIRRVFDSFFLETPIGLVFWSYLYIYE
FT                   KI"
FT                   /protein_id="XP_626909.1"
FT   gene            complement(<902328..>903908)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3600"
FT                   /db_xref="GeneID:3373821"
FT                   /locus_tag="cgd3_3600"
FT   mRNA            complement(<902328..>903908)
FT                   /db_xref="GI:126644816"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3600"
FT                   /db_xref="GeneID:3373821"
FT                   /locus_tag="cgd3_3600"
FT                   /transcript_id="XM_001388088.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(902328..903908)
FT                   /locus_tag="cgd3_3600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126644817"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3600"
FT                   /db_xref="GeneID:3373821"
FT                   /translation="MSLTPWMSGEFRGKLPSPRAAHTCNIIEDKLYLFGGWNGFQALND
FT                   FYVLYTSSEVMFWQKLIPSEKRPKNRNNHASAVYGNSLYIHGGHNGEFWLSDLYEFTVK
FT                   GTDHLNSDNLNAFNYTEEVNEELLGSWKRVKVSNKLKKPSARACHSLTRIFGRLYLFGG
FT                   FDGIQCFNDLWVYDIAKMTWNEIEFENYIPRYRNGHCAISSSKGIIFFGGNTGKEYIGD
FT                   VSLYNPEKKEFQTPKVFGVCPSARKGHSLALLDDVSAVMFGGYDGKNRCNDLFILDISE
FT                   LPSIVRWERIIEKNSPSPRQRNSLTTIPGGKCLLFGGYDGNCWKSDTYLLDIRKFSCSM
FT                   HSKNISLPMLSNLESLVDNPEFSDIIFILENEETLYAHKCILVAQSQYFKSMFKNGMAE
FT                   TNSKEIRLEHIPKKEFKVIIRFLYTSYLDETDLQTLCNVLLIADSYNLSALSDLCIKTV
FT                   KQLVEVNNVCEILIIAHRCKIDQLVKFCVDFASCHVDVLINSPKFVQLSNEFPKLALSI
FT                   SNSVISKLI"
FT                   /protein_id="XP_001388125.1"
FT   gene            <904632..>906038
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3610"
FT                   /db_xref="GeneID:3373936"
FT                   /locus_tag="cgd3_3610"
FT   mRNA            <904632..>906038
FT                   /db_xref="GI:66359463"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3610"
FT                   /db_xref="GeneID:3373936"
FT                   /locus_tag="cgd3_3610"
FT                   /transcript_id="XM_626910.1"
FT                   /product="possible aspartyl aminopeptidase"
FT   CDS_pept        <904632..906038
FT                   /locus_tag="cgd3_3610"
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible aspartyl aminopeptidase"
FT                   /db_xref="GI:66359464"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3610"
FT                   /db_xref="GeneID:3373936"
FT                   /translation="VSKMTKEFSDKFLEFLNNTGSPYHSVDETIKILKGSGFVKLDDNE
FT                   EIKKGGKYYITLNYSTILAFKVGEEFDLEDERSMVVITGSHTDSPCLRVRPSSITCNEG
FT                   YTQLSVSTYGGGLWHTWFDRGLGIAGKVVDNACNEYLIKIKRPICAIPNLAIHLTTSEE
FT                   RSSFVYDKEKHLQPIISKTDTNDKYGEQLLSLPRSLLDEICREINVQPQNISSFDLCLM
FT                   DSVDSRYVGINDEFIDSPRLDNLGGVFSCFTALIDASESNSSDLLISVAFDHEEVGSVS
FT                   FSGAHSDFLKQSLKLILAGLENSNLNKSTPKGVVNANRNSDLEFCKIMKRSIFLSVDMA
FT                   HSIHPNYPERHQSKHKPSPNNGIVIKTNFNQAYTTDCTTRTFLKTIANNFNIKTQDFLV
FT                   KNSSPCGSTIGPIVASNLGIRTADIGACMLAMHSCREFMYYSDIYDLQNFIKVFYMTWS
FT                   KVKLESKLLE"
FT                   /protein_id="XP_626910.1"
FT   gene            <906689..>911434
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3620"
FT                   /db_xref="GeneID:3373937"
FT                   /locus_tag="cgd3_3620"
FT   mRNA            <906689..>911434
FT                   /db_xref="GI:66359465"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3620"
FT                   /db_xref="GeneID:3373937"
FT                   /locus_tag="cgd3_3620"
FT                   /transcript_id="XM_626911.1"
FT                   /product="hypothetical protein with 4 or more possible
FT                   transmembrane domains"
FT   CDS_pept        <906689..911434
FT                   /locus_tag="cgd3_3620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 4 or more possible
FT                   transmembrane domains"
FT                   /db_xref="GI:66359466"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3620"
FT                   /db_xref="GeneID:3373937"
FT                   /translation="FLKKLTFLSCETYFYFHFFFTTNSKPLTFFFNEKMNINKELIREL
FT                   KLEDIPINLILDATCKSPPGIKNKLNSRRNDLNGFDENSSMDEPGLRIMTEGGISRESY
FT                   YYKDQSIIENISKIGNLKESKKIYESSVNNESNSEIYSKIKKSTTNYESKKNRNIPRLH
FT                   LPIKTLNNDIKEEQLSRQDKSSDNNDFINDDSCHNSKYDVFNNNRKVNLSENELEIGYS
FT                   PLHSNNLSMYLNNYYSNRDDTKFDKEVNHLQEKLPNTLNTFEISDNSSKFKDHQLKSIF
FT                   ENYNYSKSDPSETNFELNHINRTLSETSSSLQTKHYQEYKYDSIKKFDYNEEKSNITNS
FT                   ILNREKDKDKDKDKDKDKDKESDKNLSNRLDRLIPVSKLLKHEDSEIKLKEITNREKYS
FT                   NIFKNDDEFTSIFQKCWDDAGNELRNRNENHLNEGNTEESDKDLYLNHVPFQSDLIMVN
FT                   SKRKIKTTIPIEAMNNSNNKVLAYNSSYYSDSINPMGLLKYVKKQNQKDELYVNMNNKI
FT                   NQQTDRGTYVLLAEDMSTRASTFNNLASFGVNSNIALETHSSGGNHNDSNLNYNIIEKA
FT                   KNNKEDFDDLTELDYKEDIISVDKVSHSIVNGDYYRQEIKSYEGKNRLINETELHRINN
FT                   SDLESNLDLESGSNTNNNRIITYNKDDDIKSIVENFLKIEKNNESKYKNKKMVRLYKDD
FT                   PKVSIQKLRDNLKNIENKRLGNISNNLLSEENIHKSIYEEFNEVRNKLPKNKEFIIDMV
FT                   DENKYDYGFSFEVFKKDDNMKITDMGMKIQEFYAPITSSLDSKKREKVEGLDKSHFINI
FT                   PNIEIEEISVSDQNEVNGSLNVHELKMVENIQEVFKDEKVKGKGKGRMKEEEEEEEEEE
FT                   EEEGEEEEEKEEEEEEEEEGKEKEGDDEEDDGEKGETEEDIDFVEGKEGYFNTSTRYYN
FT                   SLGLTEDFLLVFMNFSLVRILSSNSYGNTFKEMKELKLLERAKEDRKNINRNWKQTIMN
FT                   YEKLGMFAEKRNLILVFAILVNIILISMANIIIPIVYSIKNTLFPILTVNAVINFLIFY
FT                   LINGTLIYIFTRKMNSFNKSILNDYLLLLQRINQMRKERRKLEYEEVEEEEEEEEEEEE
FT                   EKEKEEGEEVYNYDINHKGIKDSSEIEELEKREIEEDIMEYIYSELLYCYIQTMQDLNT
FT                   ESNKKYKKSMWLFFGIGIVQMTLSLFLDTFVINKFNFNGSFVNIFNVINLLISATLNLI
FT                   YISKKIGRWDLLDIFNKNLLIIMDGVIQENQLKFLTYSSSIVEHILYWNYIFNHSNDNN
FT                   VNWRNFVSNISLLEMDQHKLQNIKNNKNKNINVLCRIHLDINKILKTPNSNNNINELWP
FT                   FFYLHYNYIQKKLIISSHNLILYKQENKVHQKNNHLMSIPVNLISIESIQSSVFPWAFI
FT                   YNNSGKMIEKDNHLVTNINMENNNLNFKNQIQQYIEILENFIFSSENQSLTINSLLEFT
FT                   DTFKKKYQTNNFQMSKEFQNKLSQIFYNYNFISLYDNNNSGAKTHYKEESDNWRLDESL
FT                   EIIKLKDDPLYILNCTIPIEYLLNMDINISFEDLVAKDEVMKLQIACFSFADLLSIYTA
FT                   IS"
FT                   /protein_id="XP_626911.1"
FT   gene            <912082..>913554
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3630"
FT                   /db_xref="GeneID:3373861"
FT                   /locus_tag="cgd3_3630"
FT   mRNA            <912082..>913554
FT                   /db_xref="GI:66359467"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3630"
FT                   /db_xref="GeneID:3373861"
FT                   /locus_tag="cgd3_3630"
FT                   /transcript_id="XM_626912.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        912082..913554
FT                   /locus_tag="cgd3_3630"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359468"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3630"
FT                   /db_xref="GeneID:3373861"
FT                   /translation="MSRKHSILNNTKIIMNLFSFLEISDLVKMRNLNSCCKLISDHYIK
FT                   MSIHRDKSKYKNIEIENNDESNSSNNNNMNNIANYFCPSKINNNNNISQLRMKFLQLWN
FT                   IYSNKNLIEKVNYYDYNLCFIIKILIYLISNVKDGLDLSLIFATNNFYLQQIYGYGLDD
FT                   SNSLSSNINNHSKNSHIFNIERDLDIDIEQDEYIDFQSNSSTIGLNHNHESIPIYIQEF
FT                   FRNEGIWKVIAKLSGYNLSNAELSSESNGIFEYYLWPEKMEDPKYSIIDQNIIENIFST
FT                   ILKMKTLDPNIRKQVTILMNKNLKAELTFYSNTGNIINRSNINIVKDQFNPSYYSSIDN
FT                   NNNNNHHHHHHHHNCNTDFQRDNSHNINSNYPSEMIYSLLQPCTFINSQLSSIILLWII
FT                   NFLKLQKQLPCLKQIPKNDKFLFNANNNNNNKYRLQHRNHQFLHNHNYNYNKIPLNSKF
FT                   SSTSRFSKLNNINNQNQRSNPKSKPKPKSKPK"
FT                   /protein_id="XP_626912.1"
FT   gene            complement(<913771..>916077)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3640"
FT                   /db_xref="GeneID:3373860"
FT                   /locus_tag="cgd3_3640"
FT   mRNA            complement(<913771..>916077)
FT                   /db_xref="GI:66359469"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3640"
FT                   /db_xref="GeneID:3373860"
FT                   /locus_tag="cgd3_3640"
FT                   /transcript_id="XM_626913.1"
FT                   /product="hypothetical protein having a signal peptide"
FT   CDS_pept        complement(913771..916077)
FT                   /locus_tag="cgd3_3640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein having a signal peptide"
FT                   /db_xref="GI:66359470"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3640"
FT                   /db_xref="GeneID:3373860"
FT                   /translation="MNGLMDISFKNWSFLAILNILLFITKFQSGATSATDELFNEINNI
FT                   YSPCEFENSPFTGCVSLNPIRTGKKSGKEIRIHASLLYLANYRTKKVVLKKPVKFHTLK
FT                   TFQSLDENNDEIKSEYNYGYDQNEIDDEIMKEDKLIGLNDIINDEEGRIMEYLHDQVKF
FT                   SSMPKLISSNWENTGWIVMEYYDGISLQEFYQAIYKDIDDIKVQNNHKFQDRMILKKGI
FT                   IYKELHEFIKDKVNNNKDIDNHIENGEIPYEHKKSNDSLDYLELNGDYKRNNWFFKLLI
FT                   SQYNAISQVYLELLKKGVIHCNPSPSSIMIKKGKLGIHPSEIIFLDYSQSIKWNIETSQ
FT                   IFYSDIKQSCIPDLRPILSFLLADFGVYIPLSSIDVSFFGTISLAPINIITKMDDSTAT
FT                   GQCIDYNILLKEYYNTNFSCKDLLADYTLKYYHSIDCNTPLPNNSALPYNFRLFHFCQK
FT                   TCQVCNKECEGLVSLMNTELYEESLKDGNNNILKDSFVERLFRACRPNTDLLSYENLSN
FT                   YLFINDDWGQINNDGHTNIDHNDHLKNEKNDKSILGCKWCIVHQNILKNVLIYFELPQI
FT                   ILYPNIDLFIGNINILIDSHQIIQNNLRNYLINMNFHTFNDILSGNISGKEYLGPKKTF
FT                   LSRFKDFLLRRTINSYLFIGDEIGQVQRNNNNNNNNNNNIQFSNSNIGFFEFSFKDEFK
FT                   EEIPSGLLYYKILENEYLFINIKIIKQAFVRYMFKGFSSRYRERIFEMFKTYSLRLLPN
FT                   SLRAFPIFETSLQEK"
FT                   /protein_id="XP_626913.1"
FT   gene            complement(<916427..>917842)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3650"
FT                   /db_xref="GeneID:3373858"
FT                   /locus_tag="cgd3_3650"
FT   mRNA            complement(<916427..>917842)
FT                   /db_xref="GI:66359471"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3650"
FT                   /db_xref="GeneID:3373858"
FT                   /locus_tag="cgd3_3650"
FT                   /transcript_id="XM_626914.1"
FT                   /product="centrin like EF hand protein"
FT   CDS_pept        complement(916427..917842)
FT                   /locus_tag="cgd3_3650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centrin like EF hand protein"
FT                   /db_xref="GI:66359472"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3650"
FT                   /db_xref="GeneID:3373858"
FT                   /translation="MEIQFSFLNEFLLGKKLVPRNWGILLKDIEKDLNELVKSNIGSND
FT                   QLSEEVKIYLNNIKDDEKNYKFLNKLIEFLISSKEGEMKTIFGNYKSKLINELLNIKKR
FT                   YQDKNLYLSEAAKEANYILKFGLSHLEKEQREIVSKIKNTRKKVQELNTTKDKNIELIN
FT                   SELSSFGLENIITYSKVGLNTDYFPRDKISDGLQNFYDKKLKHFSSELFEEINELLKDD
FT                   VLFNLYLELIKEANVDLVDSDKYIMEHLINFPTLKMLIGNLEKIGSESELSDNEKENKY
FT                   SIELIDDSTIENSVSDENFKNFVILEESPLLIRLFEDRQLFGKLLMELYEIESFIKRSL
FT                   VESFGMEWKAKINMNTDTKYKTIIEFYNLVKKIIGKLTESENYEIITFKRNKYVVIEKK
FT                   VEVFFSIFNNIINQQNLINNLENRIKQYHQDLSESQQRYTESTQKLKENVILLQNELKN
FT                   LLKKEYIIKGINK"
FT                   /protein_id="XP_626914.1"
FT   gene            complement(<918736..>919011)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3660"
FT                   /db_xref="GeneID:3373935"
FT                   /locus_tag="cgd3_3660"
FT   mRNA            complement(<918736..>919011)
FT                   /db_xref="GI:66359473"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3660"
FT                   /db_xref="GeneID:3373935"
FT                   /locus_tag="cgd3_3660"
FT                   /transcript_id="XM_626915.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(918736..>919011)
FT                   /locus_tag="cgd3_3660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="small conserved protein, similar to bacterial BolA"
FT                   /db_xref="GI:66359474"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3660"
FT                   /db_xref="GeneID:3373935"
FT                   /translation="FKLSQMSIQETINERISKSLNPTLLDVVDVSNCNCGYMFKVIVVS
FT                   DCFVGKRILERQRLVNEAIGEVYNEIHSVTMKCYTSEEYSKSQNSA"
FT                   /protein_id="XP_626915.1"
FT   gene            <919484..>920242
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3670"
FT                   /db_xref="GeneID:3373859"
FT                   /locus_tag="cgd3_3670"
FT   mRNA            <919484..>920242
FT                   /db_xref="GI:66359475"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3670"
FT                   /db_xref="GeneID:3373859"
FT                   /locus_tag="cgd3_3670"
FT                   /transcript_id="XM_626916.1"
FT                   /product="putative protein kinase CK2 regulatory subunit
FT                   CK2B1"
FT   CDS_pept        919484..920242
FT                   /locus_tag="cgd3_3670"
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative protein kinase CK2 regulatory subunit
FT                   CK2B1"
FT                   /db_xref="GI:66359476"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3670"
FT                   /db_xref="GeneID:3373859"
FT                   /translation="MDNTSEPGDSMEYSFSGNELDYEEEASWIEWFCSLKRSEFFIEVD
FT                   DEYIMDDFNLTGLNEHVIYYDDALDMILDRIDDDFSEDEISAIESSAQLLYGLIHARYI
FT                   LTSKGMHLLFEKYQTQKYGLCPNVSCNNFPLLPIGLSDLPNVNSCKVYCATCNEVYNPK
FT                   STRLASIDGAFFGTSFAPLFALQYGLVTSKNKSPQYYVPRIYGFAVYRNKRDLLAEEAE
FT                   AELEAETESNEFKKDFKGESRLLIQKKNSR"
FT                   /protein_id="XP_626916.1"
FT   gene            <920684..>922669
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3680"
FT                   /db_xref="GeneID:3373934"
FT                   /locus_tag="cgd3_3680"
FT   mRNA            <920684..>922669
FT                   /db_xref="GI:66359477"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3680"
FT                   /db_xref="GeneID:3373934"
FT                   /locus_tag="cgd3_3680"
FT                   /transcript_id="XM_626917.1"
FT                   /product="UIM domain and EF hand containing protein that
FT                   also has a conserved domain between"
FT   CDS_pept        <920684..922669
FT                   /locus_tag="cgd3_3680"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UIM domain and EF hand containing protein that
FT                   also has a conserved domain between"
FT                   /db_xref="GI:66359478"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3680"
FT                   /db_xref="GeneID:3373934"
FT                   /translation="FLNTRMNSFGAINGQGEDDDDLELQRALSESLREFNNTNNILKNN
FT                   GIQTLDENKKQSKDNNDIEFINNSVTFDDLINYSESMQNELVNILNLNNNNCNNCKKKN
FT                   DIDSLTQIITGKKVIIDNKLHEHFNETYDPYKDKELKPLPIDNVNEIIEIIFGINGNLL
FT                   AQDEDIKRWIYHSIEFTCNSIPKIEDDNKTDFFKENRSIFTFKENFKSMNYCLIQQGGG
FT                   PCGVLASLNGFIISQLIFNPLRLKMIKEKYQEDLVEYLNSISEEDCWEALIQSICMIFF
FT                   QSSPESKYRVIQYKPYEKMETLQQNRHFDLISNCLIGNGNNLYYYVEYDDIMEVYKFYW
FT                   RRLKSGIFSNIGSLFSILVSIVGSRTPNQIRLDMDDFTNPLVGMFGHCSQELVNLFITG
FT                   SAVSNVFDGVKILNDNGGGTVTGAGDTNESLSLKGIYKKSILGYLTEHEALQYCKVGLN
FT                   YKYPLYPIWIIVNKNHYKCSFSFNFNECILTISQEFIQVMQKAFEKFDTENSGFIFDNQ
FT                   LEKFLNEINLKDCMFELKKFSENGIILWNDLKKCILNLVGIENEEDNQLRGSRTGDNSL
FT                   ISQYKLWTSVYIFDGQNHIGKKLIISTIFPLENYSKTKKLYDKFSSNHKQNDNDKRKSI
FT                   EELDLISILQTRWGGETVIETKILNL"
FT                   /protein_id="XP_626917.1"
FT   gene            complement(<922671..>924260)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3690"
FT                   /db_xref="GeneID:3373820"
FT                   /locus_tag="cgd3_3690"
FT   mRNA            complement(<922671..>924260)
FT                   /db_xref="GI:126644818"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3690"
FT                   /db_xref="GeneID:3373820"
FT                   /locus_tag="cgd3_3690"
FT                   /transcript_id="XM_001388089.1"
FT                   /product="U5 snRNP 100 kD protein, putative"
FT   CDS_pept        complement(922671..924260)
FT                   /locus_tag="cgd3_3690"
FT                   /gene_family="HOG000268796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="U5 snRNP 100 kD protein, putative"
FT                   /db_xref="GI:126644819"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3690"
FT                   /db_xref="GeneID:3373820"
FT                   /translation="MLKIPGLERLDRYENDQSILANKANSDEKDNVVNYDLISSNVEDG
FT                   KSKKRHRGMLQFEWSNNEDTFSLGSNELYMNRLNIEKMLSERKKKGIRKEDSNGKNDEF
FT                   LDEKSDLGYFDMTERDWKIFREDYSINVRGKDVPNPIRNWKDCHVLEIQTELIRNIGYE
FT                   KPTPIQMQCIPIGLKLRDMIGIAETGSGKTIAFLIPLISYVGNKPILDYKTSQEGPYGL
FT                   ILAPARELALQIEDEAQKLLNKTHELKRIRTLSIVGGRNIDQQAFSLRKGVEIIIATPG
FT                   RMQDCLEKTLTVLVQCSYVILDEADRMIDLGFQDSLNFILDQIPPEIQRTTHMFSATMQ
FT                   KELENIAKRYLNSPINVTIGDIGAGKKSIQQILNFISENKKKSTLINTLNNKELAVPPI
FT                   IVFLNQKKMVDIVCREIVSHGFKATSLHGGKMQEVRENSLNLFKSGVFDILVSTDVAGR
FT                   GIDINNINLVINYDFPKSIDTYTHRIGRTGRAGKNGIAISFITPEDSGLFPELKKILLT
FT                   SNNPIPNELKNF"
FT                   /protein_id="XP_001388126.1"
FT   gene            <925770..>928115
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3700"
FT                   /db_xref="GeneID:3373857"
FT                   /locus_tag="cgd3_3700"
FT   mRNA            <925770..>928115
FT                   /db_xref="GI:66359479"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3700"
FT                   /db_xref="GeneID:3373857"
FT                   /locus_tag="cgd3_3700"
FT                   /transcript_id="XM_626918.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        925770..928115
FT                   /locus_tag="cgd3_3700"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359480"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3700"
FT                   /db_xref="GeneID:3373857"
FT                   /translation="MENVIKRTNPGCVIKTVHPWFKSTATVECYNSNNGYIVGITEDDW
FT                   VNVIPPTIKCPRDFEIIFPTYPTEDTIKGNFTFPPVCLARRYFPRSISCPGILLRNGLI
FT                   VTDRYIVDNELNPTPFKQKIDVSHYSCQVQSRVKPNIVCPIINMDYYSRLRYVFPNNEY
FT                   YLNSHFNTEEVINYQSGLFDFTSYSNFLNENPNIINELKENQLSQLSNVSDTNSTISNS
FT                   SISNSNLNDSIVSTSNDNDNDNDNSTLKSSPYYNYKAYKNEFHEYKYYYNDTLNKHLKS
FT                   MNDYNNHEYSYYPFRLNTTLDNPWNTKTSNNISNNLRREDHRKVHSIHSKGSQIEKVVG
FT                   AKQFDKEYDNFLQGLKIDLSKQSEYFNDYQWDFLSKFYRVYISDQYKFVSNIPVSSISH
FT                   KALTIDGGYQLNINLDPTYQSFVNYTLENMKMMDSELKINNLMDNLNDTMINNNDNVTD
FT                   SNSSNDNNTDSNNNNITEINMNINNPQLIEKLLILNDTNTTNNLNFTRDHEYNAWEKSA
FT                   RIYFMDLDLMKKNQIIYSSISNYKHKRKFPFLYYYGRQPSINNDYGHIRRPAISDHKYR
FT                   YGSPAEDYHKYSGRHENSDLLYYINKHLNQTKPYRHSPGPQTYHNCISINETTPIIECP
FT                   NSNIIIPKCFILDIIYGIFTANSQKNINDTLIKDIDEMNLNNSISETNGNIQEEEKKKR
FT                   EEKKKREEEEKIKKEKEEEEKAFMDNYINSRPISIQEGLNDLGDLEAIESMEDYGNILN
FT                   ELGYFGNIGELQNLEMLENLQGLGQIAV"
FT                   /protein_id="XP_626918.1"
FT   gene            <928941..>930581
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3710"
FT                   /db_xref="GeneID:3373854"
FT                   /locus_tag="cgd3_3710"
FT   mRNA            <928941..>930581
FT                   /db_xref="GI:66359481"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3710"
FT                   /db_xref="GeneID:3373854"
FT                   /locus_tag="cgd3_3710"
FT                   /transcript_id="XM_626919.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        928941..930581
FT                   /locus_tag="cgd3_3710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359482"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3710"
FT                   /db_xref="GeneID:3373854"
FT                   /translation="MSTFLRGQSQIMGIKPLFPVKPLLSISSPDFEQIWKEVKWDTKRV
FT                   NSTLDLFSRFCKDDLDILPYDSTSNDINSNSGGGINHSQLMSNHRLMALLKSIAIVGTD
FT                   SDDFNNMDFFTRNDLCVIMTGIPYIDKKNFLRLMCLLDRSTPHTTTSPAGISRLKLVFS
FT                   YYDWGWKGYLDEFDWKRLRSDILNLTYYGKLYDTNNNSHDLKSRLNGTNKKGGPMPETL
FT                   EEGLKQLSQEISIRSLKSTNSGSKLLKNDSIHISINASSTSNMNSNGGHSEYSYFDNNH
FT                   NFTASVPYSVQNNDLIIDFPLFIKLVEYRIIKGTSQILRIELPGRDQEEFIARSILING
FT                   GSIFLDNYKNDNAHYSPDKSSKASIYNPISSSAQNIKSEMNSPSKINNVENEELDNIEK
FT                   KKQIITEQIQELDNELNSLKISIKNSHLPSNSLGIDISNLNGDTTSKSAMESIFGPPPE
FT                   DLHGIFCDQPNDQQDLAFSSIVVPSSSTPIRKSRSIRSNAIPITPITKNDSISEHAHDS
FT                   NSFIAERSSTNDFPNNVNNTELAGPPILL"
FT                   /protein_id="XP_626919.1"
FT   gene            <931097..>931417
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3720"
FT                   /db_xref="GeneID:3373856"
FT                   /locus_tag="cgd3_3720"
FT   mRNA            <931097..>931417
FT                   /db_xref="GI:66359483"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3720"
FT                   /db_xref="GeneID:3373856"
FT                   /locus_tag="cgd3_3720"
FT                   /transcript_id="XM_626920.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        931097..931417
FT                   /locus_tag="cgd3_3720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359484"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3720"
FT                   /db_xref="GeneID:3373856"
FT                   /translation="MNESIGELTTIPIIYSKQHKERLVLLEFQGSLSISKLNTETGEMI
FT                   NSENNDDFNDTVIGQLINFDKISQSLNNPEIVNPLESAIQYSKNNPIELKVGYHKLIGK
FT                   VS"
FT                   /protein_id="XP_626920.1"
FT   gene            complement(<931639..>932007)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3730"
FT                   /db_xref="GeneID:3373855"
FT                   /locus_tag="cgd3_3730"
FT   mRNA            complement(<931639..>932007)
FT                   /db_xref="GI:66359485"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3730"
FT                   /db_xref="GeneID:3373855"
FT                   /locus_tag="cgd3_3730"
FT                   /transcript_id="XM_626921.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(931639..932007)
FT                   /locus_tag="cgd3_3730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359486"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3730"
FT                   /db_xref="GeneID:3373855"
FT                   /translation="MKRERNYDYENETNFNTIKKSERVIDKDNKQKHTVWCLTQSQKNL
FT                   NQIIKEYCSLCNRRSLNKSNLNIEKVKCGYCDRSTCDNANCKLSECSNCELVICNLCGN
FT                   YNYGNNTYNNSIYCPNCI"
FT                   /protein_id="XP_626921.1"
FT   gene            <932693..>936079
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3740"
FT                   /db_xref="GeneID:3373819"
FT                   /locus_tag="cgd3_3740"
FT   mRNA            <932693..>936079
FT                   /db_xref="GI:126644820"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3740"
FT                   /db_xref="GeneID:3373819"
FT                   /locus_tag="cgd3_3740"
FT                   /transcript_id="XM_001388090.1"
FT                   /product="P-type ATPase 2"
FT   CDS_pept        932693..936079
FT                   /locus_tag="cgd3_3740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="P-type ATPase 2"
FT                   /db_xref="GI:126644821"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3740"
FT                   /db_xref="GeneID:3373819"
FT                   /translation="MNSLDLQVNGMTCTSCATTIKNLLLHYKFVKDVEINIILNSVRVI
FT                   LNKKITLDERKKICDTINNAGFICLLKSSTIMNDMLTLSIDDLKLEERSLESEIIYGSS
FT                   KDIAEQILNSKGIKFLKLHQIPTEEMKLIVKALENKAGIITIISYLKWGQLCILFDENQ
FT                   ITITQIQEILEKSDIWMLSYMKFYCLFGKEKLSCVNNLKIKCIFRLNSDREGISIIQKI
FT                   YNCLRRRNANIEFNKDFTASIGCIVSGIFGIYNVSVERMNENNLERNLVLMICIDYNPY
FT                   FISGRNLLKYMNDEVLKNYVNEPILDEQINENKLRKQYSHRLVNSMQIITKCNLDESVN
FT                   YSSLQKIKDKESRYYVICFTISLILTIMVLLYNFLGDKPFMSKFTRIISFNTIKSLQDQ
FT                   TGLSGISWKYLINLILVTVVVYLCGYTFHKKGIKSMLYLNPNMYSLISLGTNTCYLYSL
FT                   YMMIYIAIISSKGPENTKIYSDKLPNFFDIACMLITISLFGRILDVHSNLLILRIINNN
FT                   SNKNEVGENGDSMRYNIKDNFQLLGETKFESLEKVYYHFSNSENCQVLPLASPKDLKKN
FT                   KEFRSKYKNTEIGQKMNTMSIDSICLDDISPQSMEMKEQSSIINNIVNVDLIDLGDVII
FT                   LKKDEIVPYDGIVISNDIAVLDESMITGESRIIEKLYGNFISSGSRVLSDNVFIFVTEV
FT                   GTESTLGKIQKLKIKARESQIELPGIIDIFSRYFVPSIILLSLLAFVVWFLLAYYDKVD
FT                   PARMFNIDRINFNTEFDNIFKEFPISSRVMFALHFSLSILAISCPCVIGITVPIAVLIS
FT                   TSLTSKKNILVQNTNIFNNIGFIDNIVFDKTGTLTNGRPTVKSIIIDHEHIQEIISTTF
FT                   NNGYSSKWEKSTDIDFSNSSIETFYINKNSNIQEKNIVFEELFESYLKFWWIIGSCEYY
FT                   NNHPAGNVLRSFSIRLFNNKEQYKFTQPIDCKYIPGVGMTCIINSMKVLITNQYKHLDQ
FT                   DFSLVSVNSKDYNHYLKSPSNTLEISLDSPENKSTEYSSLYLQNWLKYWSKKGSMIIYI
FT                   FIGDINNFSDNEHGLINAKNMKLVGAVSMIDEPMFGVESTINYMKKYVTDQIWLCSGDS
FT                   FYTSNSIASMVSLLKEKFNNF"
FT                   /protein_id="XP_001388127.1"
FT   gene            complement(<937360..>937836)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3750"
FT                   /db_xref="GeneID:3373933"
FT                   /locus_tag="cgd3_3750"
FT   mRNA            complement(<937360..>937836)
FT                   /db_xref="GI:66359487"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3750"
FT                   /db_xref="GeneID:3373933"
FT                   /locus_tag="cgd3_3750"
FT                   /transcript_id="XM_626922.1"
FT                   /product="multiprotein bridging factor type 1 like
FT                   transcriptional co-activator"
FT   CDS_pept        complement(937360..>937836)
FT                   /locus_tag="cgd3_3750"
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multiprotein bridging factor type 1 like
FT                   transcriptional co-activator"
FT                   /db_xref="GI:66359488"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3750"
FT                   /db_xref="GeneID:3373933"
FT                   /translation="QKITLLNHISKMSQDWNQVVWKKGGSRPKGISKEQDLNQARRKGE
FT                   EIITEKKFLGGRNASTKQNIPQNAAKLDEDTGDYRIFRVSGEFSRALQQARVAKKLTQA
FT                   QLAQMINEKASVVNDYESGKAIPNPILVQKMSRCLGVNLPKPAPKKKPDNNNND"
FT                   /protein_id="XP_626922.1"
FT   gene            <938560..>938991
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3760"
FT                   /db_xref="GeneID:3373932"
FT                   /locus_tag="cgd3_3760"
FT   mRNA            <938560..>938991
FT                   /db_xref="GI:66359489"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3760"
FT                   /db_xref="GeneID:3373932"
FT                   /locus_tag="cgd3_3760"
FT                   /transcript_id="XM_626923.1"
FT                   /product="small protein with possible EF hand domains,
FT                   calmodulin like"
FT   CDS_pept        <938560..938991
FT                   /locus_tag="cgd3_3760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small protein with possible EF hand domains,
FT                   calmodulin like"
FT                   /db_xref="GI:66359490"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3760"
FT                   /db_xref="GeneID:3373932"
FT                   /translation="ACILFRVLGQTITDRDLKTALLEGWPGLDIQSDETKDKGFKKIDT
FT                   SSLAPIEFDAFIKIFRAKYKIPFDEDTIIEAFQVFDPENTGLMPANSFVKLMTTTGEPV
FT                   PANDVEDLLLLANVDKDGKFDYTQLAKRLVEGPKNVRVL"
FT                   /protein_id="XP_626923.1"
FT   gene            <940090..>942225
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3770"
FT                   /db_xref="GeneID:3373931"
FT                   /locus_tag="cgd3_3770"
FT   mRNA            <940090..>942225
FT                   /db_xref="GI:66359491"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3770"
FT                   /db_xref="GeneID:3373931"
FT                   /locus_tag="cgd3_3770"
FT                   /transcript_id="XM_626924.1"
FT                   /product="Hsp90"
FT   CDS_pept        <940090..942225
FT                   /locus_tag="cgd3_3770"
FT                   /gene_family="HOG000031988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hsp90"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66359492"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3770"
FT                   /db_xref="GeneID:3373931"
FT                   /translation="RFFISIKQITIKMVETFAFNADIQQLMSLIINTFYSNKEIFLREL
FT                   ISNASDALDKIRYESLTDPEQLKSNEEMHIRIIPDKVNNTLTIEDSGIGMTKNELINNL
FT                   GTIARSGTKAFMEAIQAGGDVSMIGQFGVGFYSAYLVADKVTVITKHNGDEQYIWESSA
FT                   GGSFTITNDTSDNKLQRGTRIILHLKEDQLDYLEERTLRDLVKKHSEFISFPIELSVEK
FT                   TTEKEITDSDVDEEEEKKEGEDGEDAPKIEEVKEKEPKKKKITEVTQSWDLLNKNKPIW
FT                   MRKPEEVTFEEYSSFYKSISNDWEDPLAVKHFSVEGQLEFKAILFIPRRAPFDLFETRK
FT                   KRNNIKLYVRRVFIMDDCEELIPEFLGFVRGVVDSEDLPLNISRESLQQNKILKVIKKN
FT                   IVKKCLELITEITEKPDDYKKFYEQFSKNLKLGIHEDTTNRNKISELLRYQTSKSGEEL
FT                   ISLREYVDRMKENQKEIYYITGESIQAVQNSPFLEKLRKLDYEVIYMVDPIDEYCVQQM
FT                   KEFDGKKLRCCTKEGLTLEETAEEKEAFEALQKEYEPLCQLIKEVLHDKVDKVITSQRI
FT                   SDSPCVLVTSEFGWSANMERIMKAQALRDTSMTSYMMSKKTMEINPYNSIITELKTKIA
FT                   NDKSDKTVKDLIWLLYDTSLLTSGFSLEDPTQFSSRINRMIKLGLSIDEEDIVDDLPPL
FT                   EPVNDAELQASKMEEVD"
FT                   /protein_id="XP_626924.1"
FT   gene            complement(<942690..>945116)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3780"
FT                   /db_xref="GeneID:3373853"
FT                   /locus_tag="cgd3_3780"
FT   mRNA            complement(<942690..>945116)
FT                   /db_xref="GI:66359493"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3780"
FT                   /db_xref="GeneID:3373853"
FT                   /locus_tag="cgd3_3780"
FT                   /transcript_id="XM_626925.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(942690..945116)
FT                   /locus_tag="cgd3_3780"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359494"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3780"
FT                   /db_xref="GeneID:3373853"
FT                   /translation="MKRYIIPCNIEVREDLKDGISLISRELVNKLTNNDFDDIKNDRII
FT                   LLELNLENLKFLIFFKINNDINPCKEDIVYIHSGLSCISHFNKGYIKYIKNENCLNITN
FT                   RTIISDIVFSGPLFSQLTTQSDIFLLNYKNLLVEGLKRQFYYYLKFISTEYNLKDILNN
FT                   LILPFLINEKYYFFQIQYIKENKLISEEFQNTYMKFISNLLIIPNVNQLNFNSNTNNNT
FT                   SKNLEIESFMVKNINNIKNIINNNNIALSYFYLDTTYILNKYVMENNISIKVLKNIRNN
FT                   IIERVKDILEEITRFNISNLENIISINIFMYNYITSFSNLSINDNLIDQLEEHFSKFTC
FT                   IKKLILIEYNDSQKPELVNIFKKNNISSKPSFHNTYHLKCLMTRNNFHTFGAKCSHVNV
FT                   KLLLLEQINNETELDEKELLCRYLRLKKELNEYISILLLDKNYDTFLELMYYQSLNKHS
FT                   FEQLKEDLLKNGDDLTGINMVNWIIRVCFGVSDKKLIYKVVEILFRNLVIDNTLYNNYL
FT                   QEKEMLLFKNRAVEKFDGKINTLNTGDFSFKDESIKSILQQVNDQLIIYKLFENEYSKI
FT                   NQIMNQQFTPRILIYNSRNNLNGSKLSIVKQELIKYIQKQYINYKLVQKHILTLLSPYV
FT                   GQSEENIRQLFNTNIPTILILEGIDVISNNFIIQNNKTDTFSFQENMDLSLTNDSKESK
FT                   LNQNFINYSPNLFNDISFRINSHKEKIKNMFNLNWTSQNLIQSNIFLENNQNDDQFSSK
FT                   NSNDSRTLLTTLLLCLDNVEKKNQNVIVIAFSNKHILELDESITRAGRLDIHIPV"
FT                   /protein_id="XP_626925.1"
FT   gene            complement(<945712..>946239)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3790"
FT                   /db_xref="GeneID:3373930"
FT                   /locus_tag="cgd3_3790"
FT   mRNA            complement(<945712..>946239)
FT                   /db_xref="GI:66359495"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3790"
FT                   /db_xref="GeneID:3373930"
FT                   /locus_tag="cgd3_3790"
FT                   /transcript_id="XM_626926.1"
FT                   /product="60S ribosomal protein L19"
FT   CDS_pept        complement(945712..>946239)
FT                   /locus_tag="cgd3_3790"
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L19"
FT                   /db_xref="GI:66359496"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3790"
FT                   /db_xref="GeneID:3373930"
FT                   /translation="PLILQKRLAKEVLKCGANRVWLDPTEMDTISTANSRQSIRKLYKD
FT                   GLILKKAVATHSRARISRVHEAKRKGRSMGLGKRRGTKDARRPEKVLWMRRQRVLRRLL
FT                   RKYRESGKINKTMYKQFYLKSKGNQYKNKRVLIEAIHIAKAEHLKEKALQDQLDARKAR
FT                   AANLKQKRKVLQ"
FT                   /protein_id="XP_626926.1"
FT   gene            <947306..>948691
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3800"
FT                   /db_xref="GeneID:3373852"
FT                   /locus_tag="cgd3_3800"
FT   mRNA            <947306..>948691
FT                   /db_xref="GI:66359497"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3800"
FT                   /db_xref="GeneID:3373852"
FT                   /locus_tag="cgd3_3800"
FT                   /transcript_id="XM_626927.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        947306..948691
FT                   /locus_tag="cgd3_3800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359498"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3800"
FT                   /db_xref="GeneID:3373852"
FT                   /translation="MDGIQENFSKTLDIDCNSSISSVVLTEFYAFVGLIGEESNVNVYC
FT                   YKDHEDNKDKNYKPKYILENNHGGISKLVLSPCKNLLMGLTCYGWIYIWNIEQLGNNTN
FT                   NDVEMSIEENNNKSNIKSNINELTEEIPVIKPDIFFMNGHPGDSICVEFINSKIIIAAG
FT                   INPGSSITFISVKTGKRVGQYISRKNEISGLAWPMYYKFDEKEIKEQNFELAVFSFTNI
FT                   AIERSSSSGGCWIALGGSNGLITLIYLPFATISKFEKLYETINIENEDINLSNTEFLWK
FT                   CHQVSELSTEIKSLIWRPRNNNNTGLCLVYGTDDSLLRYCFIEAENKNIMIKKVNLVKI
FT                   TDGTSTCSEINSISFPMDGQNNSILAVGFNRFSSAKRHPIFATSENLTKKSQSFSSFKV
FT                   YIQDVITYSNNSNNATSSTYTHFYCIGNHYDIITSVHISPCCRYIASSSIDGHVHIYKK
FT                   SKV"
FT                   /protein_id="XP_626927.1"
FT   gene            complement(<948772..>949191)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3810"
FT                   /db_xref="GeneID:3373929"
FT                   /locus_tag="cgd3_3810"
FT   mRNA            complement(<948772..>949191)
FT                   /db_xref="GI:66359499"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3810"
FT                   /db_xref="GeneID:3373929"
FT                   /locus_tag="cgd3_3810"
FT                   /transcript_id="XM_626928.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(948772..>949191)
FT                   /locus_tag="cgd3_3810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to clathrin adaptor complex, small subunit"
FT                   /db_xref="GI:66359500"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3810"
FT                   /db_xref="GeneID:3373929"
FT                   /translation="TKKMIHFFIIQNLSGSTIFSKWYNSENIENRNRLQEAIKERLSCL
FT                   EEKHLSYFTLGDTRIIFKKYKKIFMITGVDFDENILLMLATIQLINEAFGSHSRDISDV
FT                   DVIYNNKKYMKIIDEIILGGEVIGTSMKNIKGLIK"
FT                   /protein_id="XP_626928.1"
FT   gene            <949723..>952200
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3820"
FT                   /db_xref="GeneID:3373851"
FT                   /locus_tag="cgd3_3820"
FT   mRNA            <949723..>952200
FT                   /db_xref="GI:66359501"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3820"
FT                   /db_xref="GeneID:3373851"
FT                   /locus_tag="cgd3_3820"
FT                   /transcript_id="XM_626929.1"
FT                   /product="DNA LIGASE I"
FT   CDS_pept        949723..952200
FT                   /locus_tag="cgd3_3820"
FT                   /gene_family="HOG000036006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA LIGASE I"
FT                   /db_xref="GI:66359502"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3820"
FT                   /db_xref="GeneID:3373851"
FT                   /translation="MTGKCLDSLFNEEDDMNEIIETEDSIIDSKETIINEKISLDSILG
FT                   RELMSNVKKDEKRSKKIKLDSNIQQKLSFNFGTGNTPSSVNKSKPTKLEKVPENEESGD
FT                   SCTKNGSESLSKKIKPSNAGLFSPFSINITTGDEDIQSPMFDPCNISKEKIMAKGKSNS
FT                   ILFSVLTDAFSRIEQLKGSGSGSKKGCIVILANLFRLIIHHNPSDLIDAVYICMNKVAP
FT                   DYEGKESGVGDSILIKCISESSDKSEKRIKEDQISGKFEDLGEIAAICKKQMRLLFEPQ
FT                   RLTIHDVYSDLYSLTEITGKQSQQLKKDKIKKLLVSGKQDEVKYIVRFLQGRLRIGIQQ
FT                   TTVYQALASAFVLTKNIPGDNLASFSDYRLAKNEKKYKNLQELDCEILEMETSLRSSLC
FT                   QLPNIEKIINVAIQGASSDEISAKCKLTTGIPCEPMLARPTKGIQDVLNRFENFLFTAE
FT                   YKYDGERAQIHVYKDKSNKRVIKIFTRNLESATDRYPDLIQYLNQSLNSSVEDCILDSE
FT                   VVAYSKSEDKILPFQVLSTRKRKNVAFDDIQIQICLMLFDCMGFNGESLLKKSLFERRQ
FT                   YLRKCINEGQSEYIKFTTSTETNKLDHLDSFLSESIENNCEGLMVKTLHDNASYEPSKR
FT                   SLNWLKIKKDYVDGLTDSIDVVPIAACYGKGKRNGVFGTFLLAVYNTEEEVYETVCKAG
FT                   TGFSDEILQSLYTSLKDHIIAEGAPKSYYKFDSSGQLSSLKQDVWFEPKFVWEVKGADL
FT                   SLSPVHTAAIGTIDENRGIGLRFPRFIRIRDDKSPEQATSSIQIMEMYNSQLITNNTKN
FT                   ETNFSDDQFQEDD"
FT                   /protein_id="XP_626929.1"
FT   gene            complement(<952626..>954404)
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3830"
FT                   /db_xref="GeneID:3373850"
FT                   /locus_tag="cgd3_3830"
FT   mRNA            complement(<952626..>954404)
FT                   /db_xref="GI:66359503"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3830"
FT                   /db_xref="GeneID:3373850"
FT                   /locus_tag="cgd3_3830"
FT                   /transcript_id="XM_626930.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(952626..954404)
FT                   /locus_tag="cgd3_3830"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66359504"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3830"
FT                   /db_xref="GeneID:3373850"
FT                   /translation="MGSNCSKSKLDSRNDVSLRNDSIIKEKVPENDDNSEINKKNAKSN
FT                   DGCEKIKHKKEKVLEIPSFNSKSVKERIPRPWKSLEDLTFQWKEIEVENSWFKVRYITP
FT                   NMFFNLWAQSKNSNPLGNCGITFVDSQSFYFDVKVLEANSEEEEAMARLASKGALMKRT
FT                   VIGALQPFRSFSRQSTTIYESSNELAFKKINSSKYSDAILRYSRTINSWLLEQINNKVI
FT                   VLFDHLWEGNASIRGDRVSHESQTFLDIMNCCSCKPERIFILAGGFASLSPRYEGCIDE
FT                   NPICSEFSDNNLPSRFACESIPLFPILTHFCVLTCDIGILVHNDWDKYKDKFNISKIVN
FT                   LTNQPEIFNFPKNSKIKYYSVPCYNTETPDYWGVVNIIRQTHHLRKSVLLVDNTGDYHS
FT                   LNIVALFLIELGYKPSEVIQFITERKFGFTFDGFILDLFEEVYYKTKSTPEKLRPVRPI
FT                   IQFPIDKVVDLEFEEKVIKIIQSIFSERASKNKEKIYECLKNIVIILKNVISFPNNPFY
FT                   RIVSLENEIFKNSIGQFSQGIEILQLSGFEVFEKENQKKLKLPIEADVKICKMTLSYLY
FT                   QEIAKYSFRFNDHHIL"
FT                   /protein_id="XP_626930.1"
FT   gene            <955858..>959160
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3840"
FT                   /db_xref="GeneID:3373818"
FT                   /locus_tag="cgd3_3840"
FT   mRNA            <955858..>959160
FT                   /db_xref="GI:126644822"
FT                   /db_xref="ApiDB_CryptoDB:cgd3_3840"
FT                   /db_xref="GeneID:3373818"
FT                   /locus_tag="cgd3_3840"
FT                   /transcript_id="XM_001388091.1"
FT                   /product="isoleucine-tRNA synthetase"
FT   CDS_pept        955858..959160
FT                   /locus_tag="cgd3_3840"
FT                   /gene_family="HOG000246403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isoleucine-tRNA synthetase"
FT                   /db_xref="GI: