(data stored in ACNUC8465 zone)

HOGENOMDNA: CRPAR1_7

ID   CRPAR1_7; SV 1; empty ; DNA; empty ; INV; 1278458 BP.
XX
AC   NC_006986;
XX
DE   Cryptosporidium parvum Iowa II chromosome 7, whole genome shotgun
DE   sequence.
XX
OS   Cryptosporidium parvum Iowa II
OC   Eukaryota; Alveolata; Apicomplexa; Coccidia; Eucoccidiorida; Eimeriorina;
OC   Cryptosporidiidae; Cryptosporidium.
XX
RN   [1]
RP   1-1278458
RX   PUBMED; 15044751.
RA   Abrahamsen,M.S., Templeton,T.J., Enomoto,S., Abrahante,J.E., Zhu,G.,
RA   Lancto,C.A., Deng,M., Liu,C., Widmer,G., Tzipori,S., Buck,G.A., Xu,P.,
RA   Bankier,A.T., Dear,P.H., Konfortov,B.A., Spriggs,H.F., Iyer,L.,
RA   Anantharaman,V., Aravind,L. and Kapur,V.;
RT   "Complete genome sequence of the apicomplexan, Cryptosporidium parvum";
RL   Science 304 (5669), 441-445 (2004)
XX
RN   [2]
RP   1-1278458
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (06-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1278458
RA   Abrahamsen,M.S., Templeton,T.J., Enomoto,S., Abrahante,J.E., Zhu,G.,
RA   Lancto,C.A., Deng,M. and Liu,C.;
RT   "Direct Submission";
RL   Submitted (02-APR-2004) Veterinary Pathobiology, University of Minnesota,
RL   1988 Fitch Ave., St. Paul, MN 55108, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CM000435.
XX
FH   Key             Location/Qualifiers
FT   source          1..1278458
FT                   /isolate="Iowa type II"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cryptosporidium parvum Iowa II"
FT                   /chromosome="7"
FT                   /db_xref="taxon:353152"
FT   gene            <1..421
FT                   /db_xref="ApiDB_CryptoDB:cgd7_5"
FT                   /db_xref="GeneID:3371961"
FT                   /locus_tag="cgd7_5"
FT   rRNA            <1..421
FT                   /db_xref="ApiDB_CryptoDB:cgd7_5"
FT                   /db_xref="GeneID:3371961"
FT                   /locus_tag="cgd7_5"
FT                   /product="25S ribosomal RNA"
FT   gene            920..1071
FT                   /db_xref="ApiDB_CryptoDB:cgd7_6"
FT                   /db_xref="GeneID:3371962"
FT                   /locus_tag="cgd7_6"
FT   rRNA            920..1071
FT                   /db_xref="ApiDB_CryptoDB:cgd7_6"
FT                   /db_xref="GeneID:3371962"
FT                   /locus_tag="cgd7_6"
FT                   /product="5.8S ribosomal RNA"
FT   gene            1582..3330
FT                   /db_xref="ApiDB_CryptoDB:cgd7_7"
FT                   /db_xref="GeneID:3371963"
FT                   /locus_tag="cgd7_7"
FT   rRNA            1582..3330
FT                   /db_xref="ApiDB_CryptoDB:cgd7_7"
FT                   /db_xref="GeneID:3371963"
FT                   /locus_tag="cgd7_7"
FT                   /product="18S ribosomal RNA"
FT   gene            complement(<6844..>9270)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_10"
FT                   /db_xref="GeneID:3372026"
FT                   /locus_tag="cgd7_10"
FT   mRNA            complement(<6844..>9270)
FT                   /db_xref="GI:66362465"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_10"
FT                   /db_xref="GeneID:3372026"
FT                   /locus_tag="cgd7_10"
FT                   /transcript_id="XM_628197.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(6844..9270)
FT                   /locus_tag="cgd7_10"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362466"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_10"
FT                   /db_xref="GeneID:3372026"
FT                   /translation="MSKINLLNLKLVKKFENEDKYYEKGIKISANAIRISMRILLLFLF
FT                   ALIFSISSINGSNLSESPVDTRAKYGIVSHPEERSCKEKLLKTFSCLKLHSLLVKVKYI
FT                   YVKFKTLLTYLFTYFKESDIDLEGIRDIVLNEIAQLSLENQAIVSVYVRKSCEREFPGF
FT                   STPMLKDFDPNASRHHVAPLSESKFEKSYVTQTLEILFRKNSKIKKIIKRADQLTTLKL
FT                   CLSRLTFNLYRLAVFCQTAIKSLIKAILKANPNCKQFLSYAKSRLPLSSGGYDTSSSSS
FT                   DEERYDEYFEKMKTYLPGGSSGGASGGASGGASGGDSGGDSGGASGGASGGASGGDSGG
FT                   DSGGDSGGPTATQSGYNQYQQLRGISKVFRTSDKKETTSSLVCTCTSDKFSSRTCVCRP
FT                   CAMRDNRGSTDSSIQPSCEIELPKKQKKALPKINLPCGYIPNPGDLCPIPLKTNKDFVV
FT                   RKQNLESILSLPLRVTLQELDIEDISTDEELFCTEDFIKRPQEKKKLCLADLKKIREEP
FT                   VEQPCMKSPDKSEMSKTKKIQRPSSPESSKFPLAHQLGLMQLQNFKTKDVPSKRFPRTR
FT                   NTAVSRSHSTKHPRPLQTGDTSDDTKPHVSIPHLCSEARQSIQKPVLYSPTVDGGESKR
FT                   QLGPDPSVRPKTTRPQLKIEDHSSHSTHRPRRRVEVVCRDGDYESRKASNLEEQLASLK
FT                   ISLNDNRSSHFTGGHGGHGGHGGQSSHRERSKNRERSRNRERSRNRERSGNRESGAKMA
FT                   SKVTYDGSGSRCARGGSSKEPMLLNAPTSMGGSSSSGSAASLDKYDLNDILEQSD"
FT                   /protein_id="XP_628199.1"
FT   gene            complement(<12762..>13457)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_20"
FT                   /db_xref="GeneID:3371819"
FT                   /locus_tag="cgd7_20"
FT   mRNA            complement(join(<12762..13259,13305..>13457))
FT                   /db_xref="GI:126651905"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_20"
FT                   /db_xref="GeneID:3371819"
FT                   /locus_tag="cgd7_20"
FT                   /transcript_id="XM_001388323.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(12762..13259,13305..13457))
FT                   /locus_tag="cgd7_20"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126651906"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_20"
FT                   /db_xref="GeneID:3371819"
FT                   /translation="MERNKFFAAIDFEDESLAKSIFESISEAQLNIFDEDERTLLHNAV
FT                   SKNKLFIVELLISKGANVNTFDDNKWSPLHSCCSSGYFEIARLLLESGADCRAKTSSGC
FT                   TPLHYAASKGHEDIVKLIIAKERSVIDIQDIYGRTAIFMSACSGKQECFDLLFQANADL
FT                   NLKENATGDTILHAAINGFHEEIAYKIASKNPEMLMVKNKVSLQSYITQFTSF"
FT                   /protein_id="XP_001388360.1"
FT   gene            <13964..>21388
FT                   /db_xref="ApiDB_CryptoDB:cgd7_30"
FT                   /db_xref="GeneID:3372027"
FT                   /locus_tag="cgd7_30"
FT   mRNA            <13964..>21388
FT                   /db_xref="GI:66362467"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_30"
FT                   /db_xref="GeneID:3372027"
FT                   /locus_tag="cgd7_30"
FT                   /transcript_id="XM_628198.1"
FT                   /product="large uncharacterized protein"
FT   CDS_pept        13964..21388
FT                   /locus_tag="cgd7_30"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large uncharacterized protein"
FT                   /db_xref="GI:66362468"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_30"
FT                   /db_xref="GeneID:3372027"
FT                   /translation="MWENLDPVWGTGTFEKFYTGVFGVVLSSRPEELDEWWDLNKECVK
FT                   FVDNHIQYLSNPLYSLPRDSALDVRSGGSQLEEFLKGRFTKTAELLSEPQILRICEDMS
FT                   VELSLHQLEVFGFIDLALQDPSLQSDSGQVELVNLSSTVLELYCRELKFLLLIIRELAN
FT                   NSHPCVVLGVLCDSESEFGNREEQVSSDSTGESKAGSVFTSQCPPICIYGCSMILESGF
FT                   VRNAVNSIFQSIQEVIKLGQANIKTDSQSMVDLPSNSETSDCLRDHYRNVIIQLTDTVA
FT                   ILLSRFSPNLDEVEALMELIPNAARMQPSFLTNRPTAADFDSWDGFGAHFSDYGGKSSV
FT                   SDSQEPKQVTIGSDTRLSLSAKILLIIIICFDTMPNRWKRTKNIPTAPNSIHEAHSWFR
FT                   SSNRLPISSKSNFFSTKHSLITKLSQDTTASTSGSLSIQEEQSRTLSGEFWDIDAPLGR
FT                   FAAFSINGAFGQNSKKRFMGLTHWCTLRFIQDELLPRLDPQDPVGLAFIQAIYDICSVA
FT                   LSPTQDPIQWSRILQLQRRILMERDSKIYSSERDSTPSSTIRAQAKGSIQTSNSEPVIS
FT                   ILSPLVRCLDSLCRRYPLASWGASKVLSSCIEMFPTLSMYSSFGETEDGASISVPLPPV
FT                   LSELFVDLLDLAATIMAVGHYSLGQQVAHFLQNQPSNFWFHLPSILIFISRTLLRKEDI
FT                   LSLPEEHPRLGVWSGAGFDNPRSFRPIFRAVLRVLSAGFSSRLCISCPPPPPLLSPSLN
FT                   LHDCRSIPDFLILLLRDCFENKMFEDPKLLYTLLIGSLDVFSQGILHNQSSEVLALLSS
FT                   KIPLLSKVLQHSITQNDSGIFLIKLFSSIISLQFRISSINNSTYYLDNETNSVEVNNKE
FT                   FTHYGKADLNAKASSFNNANEGLSKSQLPLIRWVMLEILPILHKLNSIPNVRKWTVSAL
FT                   VLKFIRLTLSNPLPESQEDFTEDSDATIWLFRCLLSIDSPSFHQLMALVIPPEDPFLTF
FT                   LQPQSRDISSRPKLLAAKTGLEIIRILFQRDKLFLSWVNYHKGSLRRLCTGSLSRTGAP
FT                   INIQEILLDTEALDAVTSSDSSLIYFHEQLALPVQEDFSPAQFELLNLKKNEYYRVSLL
FT                   RYIIIGTDSDLLKSSTYIACQFLHRDPETLTALLTSSPALLLQLRSSFSRIFSSPDLDK
FT                   FPTSIHGFILDSEDSFNYIWNNPNSFISAESESGTKSTSLVTDQQAVYWDEITEADPTS
FT                   SLYSCENNLLGMSYKTLLPIHNELELNYIIYIDSLVESADLSLWCSLKTTLLGELPLSS
FT                   KLEITRTNETILNGYLHLLPPTFIPNKSSLYNKISRFHLTSTRSLIAFALSKGIEDRFL
FT                   ISSSLTDSLSIPNIAIWTQSKSQDTASSAVPLLLGLGLGMATDVPTIKEYLIFSTSNDE
FT                   NYSAKTYEEIYIPDASSSSDESTFPLLTIMDILSTPPQIPLSHPNDQRPCFPSIDFAIL
FT                   SQLEFYYLTLRLTVNLLKIPQLLDFSLRLLNERLNSRFAILKERILLPVTWIPPEYRWL
FT                   HFLHLALIVHLISSEIFVVSQVSSALKEIQCLDFHNSLLRDPFWLSCIQNLHALFRLFL
FT                   TPPKTSSSSHDQLDILSPILNIAYSFLENDSSPDMELLIQQNPNCKFLFCSFIPYLTVQ
FT                   SQVCGIYRTSLQSIVPDNYGSQKLIKDRFPITLAPSISSISCRLFINEYVQLLGLLLNK
FT                   FSKVSPLNHTELESRDLDANSFSTLQAIIELCRPFINFSFFKKTPVPLSSAILSIFSQT
FT                   LLTTLRHVHESFSTGTSTYNYDELSLRLYLPNSSISEIQRQKICFTTIQDCCEDLVRLL
FT                   VDLEKVHSFNYSSNQYFPPGWKNTLLLLLSNCIAIDSIQFSNKSNQDASEAFTSSFLRQ
FT                   IWPEVWASNRNKAYSSSKSSSGKPISTFVDFVSLLISNLRIPNKQNENEILKSLHDFLP
FT                   CKLDPRNASWVLKPQEVILLTQLNQFRKLKDFDDGEIENEKYRISEPCHWIPFNCDLSY
FT                   CTKSQQNHSFLSLYLLFLIYNKIHVSNQLILTDPSCLVPSINGDEHIQNLYALIENSKF
FT                   SIQCCHGSLIFWNYITINWIRISPSFLRKIIESDYISCLLSQEVILTALQDCHQLFLDL
FT                   QFVGSQIYFNLQLEKAFDRIELIISIFSLLLEIINRGILPKNTLAGYGSIDNFEVIVCW
FT                   IVKLEAFFSSLFEFFLKHLLFCQQKKSDWQFHTEGQQILNSGRFGSILVVEKFSPILCS
FT                   VYSLFSKILITGYHISHIKSRMNTGKENKVDMNSMNHGNAKELDTNFIIINILHSRTGQ
FT                   ILESASQMISLVPKIDQLNSLIFSCISWFESEVEFLSHYKSTKSGFETSSTIHNSPSLS
FT                   PFKLKLEIARWLSNCISCLTSSLKDGIESKPPHILQNLVSILARASLTILLCDSQFPGQ
FT                   PLTSTSILSAEDPFQEAIRTCISSINLMLSSEIKNNFLNSKLSESSRNCKSELELLKQI
FT                   RLKLESIHYF"
FT                   /protein_id="XP_628200.1"
FT   gene            complement(<21516..>23990)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_40"
FT                   /db_xref="GeneID:3371759"
FT                   /locus_tag="cgd7_40"
FT   mRNA            complement(<21516..>23990)
FT                   /db_xref="GI:66362469"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_40"
FT                   /db_xref="GeneID:3371759"
FT                   /locus_tag="cgd7_40"
FT                   /transcript_id="XM_628199.1"
FT                   /product="calcium/calmodulin-dependent protein kinase with
FT                   a kinase domain and 2 calmodulin-like EF hands"
FT   CDS_pept        complement(21516..>23990)
FT                   /locus_tag="cgd7_40"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calcium/calmodulin-dependent protein kinase with
FT                   a kinase domain and 2 calmodulin-like EF hands"
FT                   /db_xref="GI:66362470"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_40"
FT                   /db_xref="GeneID:3371759"
FT                   /translation="IRQGHIVNNNKMEKNRGKTRTPVSRQGSKPASGLRSAQNLHSSER
FT                   KGVSIGFDKLRDGVTSSIENTPVRQTSSRKVDQNSSCNRKCQSTESYRTRTKLESSERD
FT                   KAMCFSPAFKLKFSHNAFVSLGSLLELQKKYHLKGAIGQGSYGVVRVAIENQTRAIRAI
FT                   KIMNKNKIRQINPKDVERIKTEVRLMKKLHHPNIARLYEVYEDEQYICLVMELCHGGHL
FT                   LDKLNVFIDDSTGKCAMDVVKTQICPCPECNEEAINGSIHGFRESLDFVQREKLISNIM
FT                   RQIFSALHYLHNQGICHRDIKPENFLFSTNKSFEIKLVDFGLSKEFYKLNNGEYYGMTT
FT                   KAGTPYFVAPEVLNTTNESYGPKCDAWSAGVLLHLLLMGAVPFPGVNDADTISQVLNKK
FT                   LCFENPNYNVLSPLARDLLSNLLNRNVDERFDAMRALQHPWISQFSDKIYKMSPIAGIE
FT                   AHESHSSRRNIFGATEHSPVQISMLKSLRRYYVSPLLKKIALTVIARYCPDKWIENLRN
FT                   VFYKLDTRQIGKINLYDLRVATQQLVAQQKLKVPQHHIDLLLDAVDSDGNGEIDYIEFV
FT                   AAVISPKLSCRKDVLTMAFKMLDQDEDGLISTRDIKKLVSSEKIRLSSATVLEAEEDSI
FT                   LEDLNVEVTKVIGKGNENVTGISFQAFEKLLNTSYDKVCRCYHGPREGETKGRLPVCGE
FT                   DSMDTWYDDLLSCNTENENLTQLFAGSEPRRLQKNSLYVCRRTGFRDLLALSQGAGQKD
FT                   KFQVEMNRKRSLGNHQEREAYSTKGAKDEGQSSGEMNREYGLGIVGFIGNGLGVRMGGN
FT                   TKNPSKVLLCDS"
FT                   /protein_id="XP_628201.1"
FT   gene            <24420..>24800
FT                   /db_xref="ApiDB_CryptoDB:cgd7_50"
FT                   /db_xref="GeneID:3372028"
FT                   /locus_tag="cgd7_50"
FT   mRNA            <24420..>24800
FT                   /db_xref="GI:66362471"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_50"
FT                   /db_xref="GeneID:3372028"
FT                   /locus_tag="cgd7_50"
FT                   /transcript_id="XM_628200.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        24420..24800
FT                   /locus_tag="cgd7_50"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362472"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_50"
FT                   /db_xref="GeneID:3372028"
FT                   /translation="MAQQYIYNTDYINEINEEVYKEIGISHELEQFARKGIIPNKNNNL
FT                   SIHNNTTYVSRPIKSVTSENAANGKLNSVAGFGVVALTLLIIYLLNKILFWFIVISIFA
FT                   FCISVATRSLGNIEASGKKLPF"
FT                   /protein_id="XP_628202.1"
FT   gene            complement(<25118..>26389)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_60"
FT                   /db_xref="GeneID:3372029"
FT                   /locus_tag="cgd7_60"
FT   mRNA            complement(<25118..>26389)
FT                   /db_xref="GI:66362473"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_60"
FT                   /db_xref="GeneID:3372029"
FT                   /locus_tag="cgd7_60"
FT                   /transcript_id="XM_628201.1"
FT                   /product="Hat1-like acetyltransferase (histone
FT                   acetyltransferase-like)"
FT   CDS_pept        complement(25118..26389)
FT                   /locus_tag="cgd7_60"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hat1-like acetyltransferase (histone
FT                   acetyltransferase-like)"
FT                   /db_xref="GI:66362474"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_60"
FT                   /db_xref="GeneID:3372029"
FT                   /translation="MDDINPNKRVKLNEEPNSQLSIPIKIDNVLNKILLHPCETLNDFI
FT                   ENKVGSYAPYYAHHFFHNEEIALLDGYNTLIHIYFSCNWFDVYVEVDLTAIKSKSKEHI
FT                   ELSEEDKNYYIENIIKQLKTIPLEGGFCSKEEFMERLKIPLLWVPGTSAGIFKAGLRDE
FT                   GIEEVDLRKIDLSETENLTSCLNKESNSSKPHPDVKNFQILHRRIEWFLHWYIESASSI
FT                   DQEDRWAVWLPTVKREQSLIILGLITTYLFFSIPKSRIRISQVLIFPQYQGKGLGCSFL
FT                   DIIYSFAIKDEDIMEITVEDPALSMMQLRDILTIEILLRNHVIKKDSLKPLKTDELLKI
FT                   LQNPNGSVNILKDVAMTCFPSQTWEEVKEKIHKYTKESPRQIARLLVLISFFRYLPNPL
FT                   PKIESNIEDEIRGFRVRKGKLKII"
FT                   /protein_id="XP_628203.1"
FT   gene            <27135..>28367
FT                   /db_xref="ApiDB_CryptoDB:cgd7_70"
FT                   /db_xref="GeneID:3372030"
FT                   /locus_tag="cgd7_70"
FT   mRNA            <27135..>28367
FT                   /db_xref="GI:66362475"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_70"
FT                   /db_xref="GeneID:3372030"
FT                   /locus_tag="cgd7_70"
FT                   /transcript_id="XM_628202.1"
FT                   /product="integral membrane protein with 6 transmembrane
FT                   domains and possible ring domain"
FT   CDS_pept        27135..28367
FT                   /locus_tag="cgd7_70"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein with 6 transmembrane
FT                   domains and possible ring domain"
FT                   /db_xref="GI:66362476"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_70"
FT                   /db_xref="GeneID:3372030"
FT                   /translation="MGVGVLRLTVSWCLLSDVVIRIVHIIGLLSRGISLVMLISYAIIG
FT                   IPDLEIPLALITGAVIFQVLFASLSSSLRCPWVILRFLFIDIWIGLLLFQIFLRISSES
FT                   KYYREISKDHFTWETSSQFHGNLTSIAEKFQQIPSWWVVFWPCWFWCGVIFSFSTVFCV
FT                   LGVADRMLAIFGVFLGCLSTTILITCLDLADFLNDTIYLKENKYAVSYHVYEQNSHIRL
FT                   WHICIICTQTMIAVMSAVISQGLIQESDEGFSLSSTDDHFITSNIKQFKKMISPYKIGS
FT                   EVILTKMGTGVFHKIENQSNNTLSQGYSDSKELLSCEAISTHTLSTVNSPTSTNSLSPI
FT                   LSHTPKSKRESFSDSNCTLTPYDDNHEQVCIICCDNNCESVFLPCGHGGLCSNCALREF
FT                   YRVSYFFNTIF"
FT                   /protein_id="XP_628204.1"
FT   gene            <28702..>29496
FT                   /db_xref="ApiDB_CryptoDB:cgd7_80"
FT                   /db_xref="GeneID:3372031"
FT                   /locus_tag="cgd7_80"
FT   mRNA            <28702..>29496
FT                   /db_xref="GI:66362477"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_80"
FT                   /db_xref="GeneID:3372031"
FT                   /locus_tag="cgd7_80"
FT                   /transcript_id="XM_628203.1"
FT                   /product="XPA1 binding protein-like GTpase"
FT   CDS_pept        28702..29496
FT                   /locus_tag="cgd7_80"
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XPA1 binding protein-like GTpase"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362478"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_80"
FT                   /db_xref="GeneID:3372031"
FT                   /translation="MTLFGQVLIGPPGSGKTTFVHGMHQMCTALNRPNIIVNLDPANEN
FT                   VPYIPDVDVRDLINFENVMNEHKLGPNGALVYCMEYLQVNIDWLIDGIRAKRKNSSYIL
FT                   IDIPGQVELYTHNYVLREILSVLAKDLDTRLTAVHLIDSTLLSSPTNYISALLVSLSAQ
FT                   MSIELPYLNVFSKIDLLEHFKDDLPFKLEYFSQLEDLNQLLTFWKHESNMGDHPLFLKY
FT                   KGFQSELVDLVEDSSIMQFIPVDINDKDSVLQILQLIDKSNG"
FT                   /protein_id="XP_628205.1"
FT   gene            complement(<29891..>32629)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_90"
FT                   /db_xref="GeneID:3371820"
FT                   /locus_tag="cgd7_90"
FT   mRNA            complement(<29891..>32629)
FT                   /db_xref="GI:126651907"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_90"
FT                   /db_xref="GeneID:3371820"
FT                   /locus_tag="cgd7_90"
FT                   /transcript_id="XM_001388324.1"
FT                   /product="high affinity sulfate transporter-related"
FT   CDS_pept        complement(29891..32629)
FT                   /locus_tag="cgd7_90"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="high affinity sulfate transporter-related"
FT                   /db_xref="GI:126651908"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_90"
FT                   /db_xref="GeneID:3371820"
FT                   /translation="MDENNKKIINDTETKHKSGLTKEWDEFLTLYQHRNEEINNDFKLH
FT                   NRFHRRSKSGWRSFLSIIIKSIRSFFQNESLIGIKYLKQVKWTWSNVICDFFCGLAEAA
FT                   LSIPQGLSYSSLANVVPSMGLCNGILQPIIYLFIGSSLYISIGVNSVESIVAGTAIDTL
FT                   IGNRAPLDVRSEVCSVVIFFHGISCCLLRIFGLAHFVDFLSDSVLQGFLSGVACSIIIK
FT                   ELPFMLAIEPPSTNCVPIKAFFLLLDKLSNTNWHATIFSISTIFFLEAILWVKNIFKTN
FT                   FPFPSQLVVIIMANVASAFASPDIPIIGKIPKSSLLIPNNIIWTQPPGTLPQPSGISSL
FT                   PFFARAWIAALPLTFISFFTHYSAAQSMEIRAHKLPETPKESESNLKEMNVQNEKDGAR
FT                   LINDRKQNIERNINTVSTSFQFSGQVISETKTSPETDQRKCTQSSLEISKGDLDSVDNL
FT                   NSSLSPSSFQSLASPTSSKSSSIIWDKERRVSLSIRFDSKSSIPNPITTINSKPHSHDS
FT                   ENEDCQGFMLNTNSSSNVSETLHKFSFENSSLDENNVEKIKETEAIIKNYQPSKKKHIE
FT                   PRSLFSVGTEILVLGVINIVGAFFNCLPGAASLARTNLNFTLGVKSPLHNIAYSMGVLL
FT                   VAMFLLEYIRFLPEAVLGAIISQAMIRMVNIKYFIKLLKMRSIDSIFWMIAFIGTVTAG
FT                   ITYGIIFALTSSVIYLIKFLYRPKFEILGKLPGTLIFKSLDKFPQAVQLPYVRIARFEG
FT                   PLTFINAERFVKNLEEMVEVWLDEDLRISNKNYQEDSIDEYLTKSQYFPNFTNSINFGE
FT                   RIPTIIQDLNENHVERIIIIDACMINEIDYSALQVLQRFNNKTKKLNIQLWFASFSHPN
FT                   SSFLLRSGFYDIIPLVHCFVDLSEAVAAAQICIGQRYSNSI"
FT                   /protein_id="XP_001388361.1"
FT   gene            complement(<33467..>34501)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_100"
FT                   /db_xref="GeneID:3371760"
FT                   /locus_tag="cgd7_100"
FT   mRNA            complement(<33467..>34501)
FT                   /db_xref="GI:66362479"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_100"
FT                   /db_xref="GeneID:3371760"
FT                   /locus_tag="cgd7_100"
FT                   /transcript_id="XM_628204.1"
FT                   /product="ring domain-containing protein"
FT   CDS_pept        complement(33467..>34501)
FT                   /locus_tag="cgd7_100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ring domain-containing protein"
FT                   /db_xref="GI:66362480"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_100"
FT                   /db_xref="GeneID:3371760"
FT                   /translation="EVECGGAFEIEMFEWTNIFSSFSRPSDLALDTDKNDVSKDFIEIP
FT                   EQFMCPICLGAFVDPCTLSCSHSFCISCVRGSHECPICRSLLKEELWLSKSDQLVDQSI
FT                   LRSMNETKTKCHCGAEISISEANSHASKCSYCKEDDSPTSESKLIASLSKQSFVNNDLQ
FT                   AQSSNGPSNTRTTSNTTGPTFVCPLCLMNSKIPNSSCLKYNVESLISHCETMHKDEYSE
FT                   TQQESNHMTTMCPICVHIGDENAEVECKRFLQHLKSKHLLISTFLAAARASLNSGSPES
FT                   RFQLLEDILFQYALSRSRYESCMNPGNDNSQSFGSSVIEIIGLDDEQDNSEMFQDDDEI
FT                   QEIS"
FT                   /protein_id="XP_628206.1"
FT   gene            <35119..>38139
FT                   /db_xref="ApiDB_CryptoDB:cgd7_110"
FT                   /db_xref="GeneID:3372032"
FT                   /locus_tag="cgd7_110"
FT   mRNA            <35119..>38139
FT                   /db_xref="GI:66362481"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_110"
FT                   /db_xref="GeneID:3372032"
FT                   /locus_tag="cgd7_110"
FT                   /transcript_id="XM_628205.1"
FT                   /product="putative sortilin, SMART_VSP10 domain, possible
FT                   signal peptide"
FT   CDS_pept        35119..38139
FT                   /locus_tag="cgd7_110"
FT                   /gene_family="HOG000282051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative sortilin, SMART_VSP10 domain, possible
FT                   signal peptide"
FT                   /db_xref="GI:66362482"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_110"
FT                   /db_xref="GeneID:3372032"
FT                   /translation="MKLRIAAFKVLVVVKLLSILGFGTNYGLVNADKKVSVSEIVFESP
FT                   IETLEWAGTDHNVVIAKTQKGHVYRSTNRGKNWRDITDVFAKMTSHSSSSSHSNLNGFS
FT                   VKSITINPVDKNVILIVGSKHTHFISSNAGETFRRISHSGTIHTWIFHPNKAKLALFSS
FT                   WTEGCNKSFLQTLKKSSSAGNKCIHQLFVTKDLGATYHKVIDYVVQFHWDGNNKSNQNR
FT                   IFFTHHRKKQGDQPRYGGWMKTIDFSYTDDFGSHIETPVKGGNKFLASNGYIFVARILD
FT                   YERQTVSLLVSTNDANSFTQVQLPHTLTEKSYTILDTSEKTVMLHVNHGEDSLKGTGNI
FT                   YISNYLGTRFALSLLNNVRTATGECEFDRVMSLEGVYIANVKDDELENDLDHISTTLHE
FT                   FTESETEDEDVETLKTEHKTKIGKVDQPVRTVITFDKGGEWNYLKAPTIDSRGNRINCD
FT                   ESDGCYLHLHGVSNYQSLAPFYSVENAVGIILGTGNVGSYLSFDHDDINTYMSRDGGLT
FT                   WQEVHKGAFIYELGDFGGLIVMANDLKHTNQVIFSWNEGLSWYDFELGSKTLQVDNILI
FT                   EPNSSSMEFLLYGSRGKSGVLYHLDFNTLGQVQCVGATTPDRPDSDYETWSPYDGRNSE
FT                   KCMLGKQLVYTRKKQTAECYNGQDFRRPVEKKRCACSEEDFTCEFGFSRQIGSFECRPE
FT                   SLDIVFDDVKFGQCTSSGIFYVTAYRKLPGDDCIGGWLPPPVAIPCPSHAPTSSHARIV
FT                   LVIALFIIIFMLKQGMFGDWTRFGELGYDAYRNVQYKVLGVAKRRSSSLQGILSAISAY
FT                   INGDSSKVVFGSSNIPGSPPGTKKNNYTTLNNFNTDNMFMEDDEDEDDHAIGNMTKISG
FT                   NINNIKSNNYNSRIGSGSNLSQRQRSNSNNYISAGQDNVSVDPIFDDLDVFEEDLDSHA
FT                   IFNQNNGLGNLNPNHDIISSEAPISFDNFNPTELEINLSSIPNTSFPKITPPPTNNNKS
FT                   NIGNNFNQDNSSGIELL"
FT                   /protein_id="XP_628207.1"
FT   gene            complement(<38545..>39582)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_120"
FT                   /db_xref="GeneID:3371821"
FT                   /locus_tag="cgd7_120"
FT   mRNA            complement(<38545..>39582)
FT                   /db_xref="GI:126651909"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_120"
FT                   /db_xref="GeneID:3371821"
FT                   /locus_tag="cgd7_120"
FT                   /transcript_id="XM_001388325.1"
FT                   /product="cAMP-dependent protein kinase regulatory subunit"
FT   CDS_pept        complement(38545..>39582)
FT                   /locus_tag="cgd7_120"
FT                   /gene_family="HOG000281065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cAMP-dependent protein kinase regulatory subunit"
FT                   /db_xref="GI:126651910"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_120"
FT                   /db_xref="GeneID:3371821"
FT                   /translation="NFYSASSVDAVHPKKSSGKEDKRKKTSGTSSGSESESDSDDVRDN
FT                   IEIPKNFLARGPRTSVSAEAYGAWNKMKDFTPPSYPKTKEQEKRIREKLLESFMFTSLD
FT                   DDELKTVILACVETSVKKDTEIITQGDNGDKLYIIDQGVVECYKKTSTEPRKHLCDLNP
FT                   GDAFGELALLYNCPRAASVVAKTDCLLWALDRETFNHIVKGSASKRISTYETFLKEVEI
FT                   LKTMDVYELNKLTMVLKSSIFEDGQEIIKQGEQGDTFYLIITGNAVALKDNVEVMSYKR
FT                   GDYFGELALLRNAPRAATVKARGRCKVAYLDRKAFKRVLGPIEDILKRNTDKYKTVIKK
FT                   ITTKV"
FT                   /protein_id="XP_001388362.1"
FT   gene            complement(<40572..>40967)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_130"
FT                   /db_xref="GeneID:3371761"
FT                   /locus_tag="cgd7_130"
FT   mRNA            complement(<40572..>40967)
FT                   /db_xref="GI:66362483"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_130"
FT                   /db_xref="GeneID:3371761"
FT                   /locus_tag="cgd7_130"
FT                   /transcript_id="XM_628206.1"
FT                   /product="40S ribosomal protein S14"
FT   CDS_pept        complement(40572..>40967)
FT                   /locus_tag="cgd7_130"
FT                   /gene_family="HOG000111598" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S14"
FT                   /db_xref="GI:66362484"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_130"
FT                   /db_xref="GeneID:3371761"
FT                   /translation="VREGQTNFAVAHIFASFNDTFIHVTDLSGRETIVRVTGGMKVKAD
FT                   RDENSPYAAMMAAVDVAQKCKEFGIHALHIKLRAVGGVKSKTMGPGAQSALRALARAGM
FT                   KIGRIEDVTPIPTDSTRRKGGRRGRRL"
FT                   /protein_id="XP_628208.1"
FT   gene            <43047..>44843
FT                   /db_xref="ApiDB_CryptoDB:cgd7_140"
FT                   /db_xref="GeneID:3372033"
FT                   /locus_tag="cgd7_140"
FT   mRNA            <43047..>44843
FT                   /db_xref="GI:66362485"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_140"
FT                   /db_xref="GeneID:3372033"
FT                   /locus_tag="cgd7_140"
FT                   /transcript_id="XM_628207.1"
FT                   /product="SprT family metallopeptidase"
FT   CDS_pept        43047..44843
FT                   /locus_tag="cgd7_140"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SprT family metallopeptidase"
FT                   /db_xref="GI:66362486"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_140"
FT                   /db_xref="GeneID:3372033"
FT                   /translation="MRPSLLLGSSVRRKNCIKNYLVSSDTEIEDENNNINTPVKNLTIK
FT                   LKEEHYYSDNSNINECSSRPSISLATSVRRKVYHIDSSEDSYTEDVNLSYLNSNPSTFT
FT                   SDILENLHESPTQPCIHYKSEFEPNNNPSSNYSSIGSRRRNCIFSSEEEDIIPLSSRPS
FT                   IKYQSSVRRKNNSRKIFTIIDSDSEDELSNNAASKRSSFCLGPELICEPNILNCTPEQH
FT                   NIWRSFDSDLEIDETNVSIDTLQELEWKTAISSSDFEDEEVERKHLTGYQSEEIEYEDK
FT                   TGEYQNTPRMDEKEVLPEKYSLFSDEDIEDQKSDLEEIKENVSSKDLNSNQVTNLTKEI
FT                   PLKNKSEKFGAFIRQRSSIAKYWYQKFNKQVFHNRLPEEVPIKWTGRLQRTAAQTLFIT
FT                   NIDGSKRVVIKLSKYVLDCEFRLKKTLLHECCHVAQFLLDSCIRPPHGQIFMKWGKVAT
FT                   KVFPDLKVEIYHNYEIIYKYRYQCLRCFQMFGRQTKINDETKIVCSVCNGTVIFIGRGT
FT                   LSNSRKEFQVKAQNPPNTQKSKSNPYSEFVKEKFAEFKKDIRDGRTPSRRAPSIMKEIA
FT                   KLWKQKKSEDLIQDFEKLSINN"
FT                   /protein_id="XP_628209.1"
FT   gene            complement(<44866..>45528)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_150"
FT                   /db_xref="GeneID:3372034"
FT                   /locus_tag="cgd7_150"
FT   mRNA            complement(<44866..>45528)
FT                   /db_xref="GI:66362487"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_150"
FT                   /db_xref="GeneID:3372034"
FT                   /locus_tag="cgd7_150"
FT                   /transcript_id="XM_628208.1"
FT                   /product="hypothetical protein with signal peptide and
FT                   transmembrane domain near C-terminus"
FT   CDS_pept        complement(44866..45528)
FT                   /locus_tag="cgd7_150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide and
FT                   transmembrane domain near C-terminus"
FT                   /db_xref="GI:66362488"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_150"
FT                   /db_xref="GeneID:3372034"
FT                   /translation="MKKVKYCLLIYILLFEIIYGWLLNFDIVPNSISEKNDISLENCRL
FT                   NYWTQHNTECMDGCSMLGELRYGPNYLSSNALQELPNSIGINCRIQSFGTLFGKKLQKE
FT                   DYWIKMDVCTSMIQSLADFVITELKYDSRKFFENSIPINNNKNMINSAYIGAYHMNSIG
FT                   NIIRYKYTFYKYVKYSLIIDLILICLFVINSLIYKYRLVKINRIREQCKTSMKQADK"
FT                   /protein_id="XP_628210.1"
FT   gene            complement(<45716..>46562)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_160"
FT                   /db_xref="GeneID:3371862"
FT                   /locus_tag="cgd7_160"
FT   mRNA            complement(join(<45716..45980,46072..>46562))
FT                   /db_xref="GI:126651911"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_160"
FT                   /db_xref="GeneID:3371862"
FT                   /locus_tag="cgd7_160"
FT                   /transcript_id="XM_001388326.1"
FT                   /product="putative methyltransferase-related"
FT   CDS_pept        complement(join(45716..45980,46072..>46562))
FT                   /locus_tag="cgd7_160"
FT                   /gene_family="HOG000260965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative methyltransferase-related"
FT                   /db_xref="GI:126651912"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_160"
FT                   /db_xref="GeneID:3371862"
FT                   /translation="HCNPLADNFMIHPLSPDYIDWELHYPNYYSDQEGFKKELHLNTKK
FT                   YPIKYSENKILSEKSVAISKHLKILDIGCGYGGLLVWLSEHFKDKLALGLEIREKVTNY
FT                   VGERILSMQQNGTGKNISVVKTNAMKYLPNYITKHQLEMIFICFPDPHFKKRNWRRRIV
FT                   SYSTVPLYWYLLQEGGLIYIVTDVYDYYVWAVKVMDTYKTLFERIPDDELSSDPCVTAI
FT                   KTSTEEAKKVERSNSPAYSCVYKTIPVEF"
FT                   /protein_id="XP_001388363.1"
FT   gene            <48042..>48326
FT                   /db_xref="ApiDB_CryptoDB:cgd7_170"
FT                   /db_xref="GeneID:3371762"
FT                   /locus_tag="cgd7_170"
FT   mRNA            <48042..>48326
FT                   /db_xref="GI:66362489"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_170"
FT                   /db_xref="GeneID:3371762"
FT                   /locus_tag="cgd7_170"
FT                   /transcript_id="XM_628209.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <48042..48326
FT                   /locus_tag="cgd7_170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362490"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_170"
FT                   /db_xref="GeneID:3371762"
FT                   /translation="FILFSFFKKASTNKLFQNNSKIVCGTDEGNLLFFSWDNFGDCTDR
FT                   MLIPFVDGFENDNSVEHIQIYQDQFAIISTSDGILKVVEFFPNEILGKF"
FT                   /protein_id="XP_628211.1"
FT   gene            complement(<48787..>49227)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_180"
FT                   /db_xref="GeneID:3372035"
FT                   /locus_tag="cgd7_180"
FT   mRNA            complement(<48787..>49227)
FT                   /db_xref="GI:66362491"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_180"
FT                   /db_xref="GeneID:3372035"
FT                   /locus_tag="cgd7_180"
FT                   /transcript_id="XM_628210.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(48787..49227)
FT                   /locus_tag="cgd7_180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362492"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_180"
FT                   /db_xref="GeneID:3372035"
FT                   /translation="MIGNMRLIFIIVGLLIGLISCEERENISIENSINETSIPNEETNL
FT                   RRLYGKGQYNTVYEPVYMQKVQYVPAKSYKKVMYTVPEKSTYVVPQKQQMRYVPVGYAK
FT                   GNPSPPQMYVPVTKSEPNVYVPVTYSKGMRYLEESPEELIHE"
FT                   /protein_id="XP_628212.1"
FT   gene            complement(<50028..>50396)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_190"
FT                   /db_xref="GeneID:3371763"
FT                   /locus_tag="cgd7_190"
FT   mRNA            complement(<50028..>50396)
FT                   /db_xref="GI:66362493"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_190"
FT                   /db_xref="GeneID:3371763"
FT                   /locus_tag="cgd7_190"
FT                   /transcript_id="XM_628211.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(50028..>50396)
FT                   /locus_tag="cgd7_190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362494"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_190"
FT                   /db_xref="GeneID:3371763"
FT                   /translation="FDDQSKKHKFFQYINSVGKSTSGEGVEDKEQEIEISIECMKDNSE
FT                   SILDLKNLLELERRVYEVESRIGVDRLSEMPYSDIQSAIHNISQRLSLLDTNRLEGIFR
FT                   RVQVGFDLNNQRSERIYS"
FT                   /protein_id="XP_628213.1"
FT   gene            <51252..>52310
FT                   /db_xref="ApiDB_CryptoDB:cgd7_200"
FT                   /db_xref="GeneID:3372037"
FT                   /locus_tag="cgd7_200"
FT   mRNA            <51252..>52310
FT                   /db_xref="GI:66362495"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_200"
FT                   /db_xref="GeneID:3372037"
FT                   /locus_tag="cgd7_200"
FT                   /transcript_id="XM_628212.1"
FT                   /product="hypothetical protein with signal peptide"
FT   CDS_pept        51252..52310
FT                   /locus_tag="cgd7_200"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide"
FT                   /db_xref="GI:66362496"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_200"
FT                   /db_xref="GeneID:3372037"
FT                   /translation="MLLRVLFLVVFLTCLYDLRVFSAHPYKSIVIHEVEESVIEEQIRA
FT                   ANRIASVSTDSVSLPSKLSAYNYCKTLSKLVGSKYHWGDVSYTWQKRFRRFGYWVCFRD
FT                   CGGGGDCLYNSIISSLNLSNTSVSMLRRLVADQFVGINTTSLYSSDGNTKTSNIENIID
FT                   ASGEILNTLNYNNTAHPNSNSNSNYTDLLSNWNETTYLERMEVLATTEAFGDWKDLWSP
FT                   SSILNSNFQYGTDISTNIKKALLVHKFLSKPGNTHWGAQWDVNYIEKIYNVKVIILWKN
FT                   RGIFYPTLGDQVDFTKIVLIYYDDAIGHFQVIGLKKMNSPPKSDLISVFSKEKIPTSLK
FT                   KLYKDDTNNDLD"
FT                   /protein_id="XP_628214.1"
FT   gene            complement(<52332..>53270)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_210"
FT                   /db_xref="GeneID:3372036"
FT                   /locus_tag="cgd7_210"
FT   mRNA            complement(<52332..>53270)
FT                   /db_xref="GI:66362497"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_210"
FT                   /db_xref="GeneID:3372036"
FT                   /locus_tag="cgd7_210"
FT                   /transcript_id="XM_628213.1"
FT                   /product="fkbp'fkbp"
FT   CDS_pept        complement(52332..53270)
FT                   /locus_tag="cgd7_210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fkbp"
FT                   /db_xref="GI:66362498"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_210"
FT                   /db_xref="GeneID:3372036"
FT                   /translation="MFKLIGFTLSTKGSKNNNKFEFSEFGLTLSHITLTEGTQVSVYVK
FT                   FPTDQGYPQDDLIVATVTKSQPNACIHQQEFPTGSTLYCKGSGVVDCIANLPVQDCCED
FT                   GCCEANHSDDEESEISSLEGDESEKQVEDIEMKNFDSESESDSLSTASEKEPQKGGKKV
FT                   IKTIEKVKAEDKKKASALTKDIKNVQNDIISPGFKKEFPNGLKYEVLSISKNVKSDIPQ
FT                   IALVGSKVNVKYEGRLAKTGKKFDSGNLSFTIGSGQVVPGFDQGVKGMIVTETRRVFIP
FT                   SKLGYGARGCPPVIPKNADLVFEITLLSTKH"
FT                   /protein_id="XP_628215.1"
FT   gene            complement(<53704..>54342)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_220"
FT                   /db_xref="GeneID:3371863"
FT                   /locus_tag="cgd7_220"
FT   mRNA            complement(<53704..>54342)
FT                   /db_xref="GI:126652002"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_220"
FT                   /db_xref="GeneID:3371863"
FT                   /locus_tag="cgd7_220"
FT                   /transcript_id="XM_001388327.1"
FT                   /product="GTP-binding nuclear protein ran/tc4"
FT   CDS_pept        complement(53704..54342)
FT                   /locus_tag="cgd7_220"
FT                   /gene_family="HOG000216664" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding nuclear protein ran/tc4"
FT                   /db_xref="GI:126652003"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_220"
FT                   /db_xref="GeneID:3371863"
FT                   /translation="MAAQAPEFKLALVGDGGVGKTTLVKRHLTGEFEKKYIPTIGVEVH
FT                   PLKFNTDFGPLIFNVWDTAGQEKFGGLRDGYYIKGQCAIIMFDVTSRITYKNVPNWHRD
FT                   IVRVCENIPIVLVGNKVDVKDRQVKARQIQYHRKRNLQYYDISARSNYNFEKPFLWLAR
FT                   RLTNQPALQLVGQHAKAPEVNIDPTLVAQAERELSEAANAPIEDDDEDL"
FT                   /protein_id="XP_001388364.1"
FT   gene            complement(<54664..>55539)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_230"
FT                   /db_xref="GeneID:3372038"
FT                   /locus_tag="cgd7_230"
FT   mRNA            complement(<54664..>55539)
FT                   /db_xref="GI:66362499"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_230"
FT                   /db_xref="GeneID:3372038"
FT                   /locus_tag="cgd7_230"
FT                   /transcript_id="XM_628214.1"
FT                   /product="RPR45-like archaeo-eukaryotic exosomal RNAse PH"
FT   CDS_pept        complement(54664..55539)
FT                   /locus_tag="cgd7_230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RPR45-like archaeo-eukaryotic exosomal RNAse PH"
FT                   /db_xref="GI:66362500"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_230"
FT                   /db_xref="GeneID:3372038"
FT                   /translation="MNKSSLWYLRPDEYLNRFLEQGVRCDGRKPEVCRNFKLELNELSS
FT                   SNYGAVSVRIGNSSYIACCSPQIIHTGLDQESNNAITNTRINVSLELPTICGFTGNPNH
FT                   SNFVSNSITECLNDSRIINKEAFITKFQGKELHWLIDIKVVCLSYDGNPLDYTLIASIA
FT                   SLRNTILPKNLVWDDDYNWFRISSDPISKDEVKREQMMQDSSSFFLKKVPIFVSFSYLN
FT                   DSIWVCDPNYMEDSIGSSVTICCVDNQINTLQTQCISKYTPGKLKSNLSQLIDVASKRA
FT                   DEIRACLLGQ"
FT                   /protein_id="XP_628216.1"
FT   gene            <55790..>56701
FT                   /db_xref="ApiDB_CryptoDB:cgd7_240"
FT                   /db_xref="GeneID:3372039"
FT                   /locus_tag="cgd7_240"
FT   mRNA            <55790..>56701
FT                   /db_xref="GI:66362501"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_240"
FT                   /db_xref="GeneID:3372039"
FT                   /locus_tag="cgd7_240"
FT                   /transcript_id="XM_628215.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        55790..56701
FT                   /locus_tag="cgd7_240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362502"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_240"
FT                   /db_xref="GeneID:3372039"
FT                   /translation="MQSSKTITDQFEELIKKAKTLNKTHPVVQEENVDDKNKKNELNSA
FT                   KLEISMLQKRHEMCVVQKNAIKDLINLHKEELQLLESALRTIESEEKKVLEIILRETLD
FT                   GDSLTRATSVEMVERDNDSAYTKSILPSEDLSTQTTYENLEHDASKSYTSSNNRDPEYS
FT                   NDEYSYKDELESDESNDYSDNTSEQEDFSSRYSTSRVNTERKVRFSIDDLGVSSETKSN
FT                   NVSKSNSSYSVTNAARPSNSIRTTISIPQRYNYIRNRNSSLMKEISIKKILEGNRKLDM
FT                   EEKDQGQRELVRKLHTLYSSKR"
FT                   /protein_id="XP_628217.1"
FT   gene            complement(<56707..>58965)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_250"
FT                   /db_xref="GeneID:3372040"
FT                   /locus_tag="cgd7_250"
FT   mRNA            complement(<56707..>58965)
FT                   /db_xref="GI:66362503"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_250"
FT                   /db_xref="GeneID:3372040"
FT                   /locus_tag="cgd7_250"
FT                   /transcript_id="XM_628216.1"
FT                   /product="conserved protein"
FT   CDS_pept        complement(56707..58965)
FT                   /locus_tag="cgd7_250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved protein"
FT                   /db_xref="GI:66362504"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_250"
FT                   /db_xref="GeneID:3372040"
FT                   /translation="MTLRSKRRSLKSKNGNSRPIGTTSKKIRTDTRKFDSDSTLSDLDG
FT                   EINGMISNSSDVYSKWMQFVRNDFQNNLKESSKKKETESNGTEEVTNSIDTHNGALEGN
FT                   VGTEITFTKKHGEYFADYTNEGMQQIPEINCKVTAESKEKTEKEIVNLPGFSPFKLESS
FT                   QMSDRIRDIQKLILETPKFKKGKLNLANFQMDSKFRQNWGKHIESFEILESHELDELNT
FT                   FYGIVNGYIDVEYSNLKAITSPWAMSLCMLHISRHIYNSRQLVMNNNSKLQEAIKDKVN
FT                   SNIDNLGDDRFRDQGFNRCRVLILCPFKGVAKKLVDTLVTILPHGKVLRGYDRFEEEFG
FT                   LPDNSSENEEATNEGNEKIKKDQKAESVENQSKTNVLESKLGRNDELYRYLFEGKDHDD
FT                   EFKLGIQLTKSGMNLYSSFDNSDIIIASPLGIRRVMGMSEGGKGSDISFCSSIEVCLVF
FT                   GADIIFMQNWDHILDVFKVMNKLPKKSLGNCDIRRVYQAFLDGNSKEFRQTIMISACRI
FT                   EDINSLFRNHTQNRRGFIRLWKPLEKIIGYMEKNLPLYIAPKLVEGIQQMFIKTGDTGT
FT                   PEECLLNYFGSTLYPDILAALDGKTERVLIVLSNYVIYLRIRKYLLQQNAIFASCNEST
FT                   SNASLSRNRFAFYKGELPILITTERFLFFRRYLLKGATKVIFCGPPIYPSIYLDCIQSI
FT                   NFSQGPDKSNPKSTAPLAVTLFHWQNSLALERIVGTSKCSSLIQNAKASKPVVFKIPK"
FT                   /protein_id="XP_628218.1"
FT   gene            complement(<59148..>60086)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_260"
FT                   /db_xref="GeneID:3371764"
FT                   /locus_tag="cgd7_260"
FT   mRNA            complement(<59148..>60086)
FT                   /db_xref="GI:66362505"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_260"
FT                   /db_xref="GeneID:3371764"
FT                   /locus_tag="cgd7_260"
FT                   /transcript_id="XM_628217.1"
FT                   /product="conserved integral membrane protein with 4
FT                   transmembrane domains, possible plant or bacterial origin"
FT   CDS_pept        complement(59148..>60086)
FT                   /locus_tag="cgd7_260"
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved integral membrane protein with 4
FT                   transmembrane domains, possible plant or bacterial origin"
FT                   /db_xref="GI:66362506"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_260"
FT                   /db_xref="GeneID:3371764"
FT                   /translation="LKDFIIAYLNEVKDWRKQEKLIGSVISRGQRKFNNFICLETRLIN
FT                   NEFFKQKYVLFSLVHKRYPHKEEHLGTQSELLKVIVFGGLDGIITIFSLVSGCVAAGFT
FT                   TIQLFTICMGSLLADAFAMSVGEYVSSKAEKEFVHSEQEREKWEVENCPEEEISEMYNL
FT                   YQLKYGFSEEDAQKMVDLTFKYKDFFISNMMFEELGLIIEQGDSSQPSPLKTATFMFFS
FT                   FALFGLIPMLSFVSFKYIFSLSDLLNEFSQALSFSTACICCAVTLYVLGYVKGKFCNMP
FT                   PIRSAITMLVSGLIPGTVSYSVAAFVTYLTS"
FT                   /protein_id="XP_628219.1"
FT   gene            <60927..>64424
FT                   /db_xref="ApiDB_CryptoDB:cgd7_270"
FT                   /db_xref="GeneID:3372041"
FT                   /locus_tag="cgd7_270"
FT   mRNA            <60927..>64424
FT                   /db_xref="GI:66362507"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_270"
FT                   /db_xref="GeneID:3372041"
FT                   /locus_tag="cgd7_270"
FT                   /transcript_id="XM_628218.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        60927..64424
FT                   /locus_tag="cgd7_270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="protein with two motifs similar to flavin containing
FT                   amine oxidases, no plasmodium ortholog"
FT                   /db_xref="GI:66362508"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_270"
FT                   /db_xref="GeneID:3372041"
FT                   /translation="MMNNIFGEPRNEFWYRINEQAAIRRNHPENDLLQISDSYNTPGIK
FT                   NRFEGLISSYYQENNGSKNLLMNTGYHKNVTDKNSTMDKKNIGSTSIIRFHSHFLNMMK
FT                   KGLICFSCGSILRSNFGSKINSDINSIQTCPSNSDVTGFTCVVETCGRSICNPCLQFSR
FT                   VHDVSLFNSELSTCIICEYQNEYNQRNPINPRAPIEWHWTFHTPEDLTFLRKVRSGLIN
FT                   GNGLHIELSGKRQGCWRRRKDGKRKHFSFKQHGGFFESRAVALEFKAVQIKAGGQDYQS
FT                   APLMITAIGESYSEIVPRRIHRGNQELHNHQRLILSSINDGSCAICFQKQTNLCQNAST
FT                   NTTIESRFSSCVACGRFFCHLCILYIRSSNPCSPIAAHFLSEKLICALCQHLSVQPTDK
FT                   FAQFIHDFCSLLPSNTPLIKFDKYNMKWKTPYGSVSVVESGGILESRREAYCQLETGQS
FT                   LEVTCSYDRNIFYGEIGNKLGYYTQFAKNGMLRVYGPFETYDEAGRRWDLDALKYYGAE
FT                   KAMRKAFFPKLLTWLSLPQTLQRYFLAPWIVWSMDKDESCQKSQKKVGLTNNPITKTYD
FT                   VIIIGAGVSGLKSAEALLNKGLSVLVLEAQNIPFGRISSYSQWTNHKRRLSSEICFYRE
FT                   KRDTRESSREADRKKNNDENAEELVSQLSEETVSIANELIRLSLELLEEVVIDMFHPLS
FT                   TVLEPPIKEFMCKSGNDYFERVNPAKLVLQRIKEFGETVNWRWILINYCLPLSLKRLNI
FT                   KNLSSFSKKYIEKATCGDYGENLFKNIEQFYWERLPRFVGFEELPWREYWCYPKNNLER
FT                   LKFSASIFHHIQLQKESIIERSFDECDLIDCELQKLIQNNEILNNTHFNSPVSDILYNN
FT                   ETDQVNVRISNGTWFSSSCVICTLPIGVLKKSVQSSENNPGNSNKVQGAQCQLSNISSF
FT                   KNSIKFIPPLPYETIRSIKLLEMNSYTELFLKLNINPILSNSGSTPSTNCNAISSSPSS
FT                   IITTSNSVKCEKESDIYFSRLADKIHHLDHPCITMYTHKDIPNTIMCGITPPLAEKICP
FT                   QMESESDSTLNPEFLSPQQLANICFGILKEISPKDLEIELLDFYVKSWKDDPYYLGSIP
FT                   IHSSNSKESNINQLIKPHFEGHLYFAGDGTTVDGFGSIQGALLSAKRVTTQVSQFLSN"
FT                   /protein_id="XP_628220.1"
FT   gene            complement(<64781..>65959)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_280"
FT                   /db_xref="GeneID:3371864"
FT                   /locus_tag="cgd7_280"
FT   mRNA            complement(<64781..>65959)
FT                   /db_xref="GI:126652092"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_280"
FT                   /db_xref="GeneID:3371864"
FT                   /locus_tag="cgd7_280"
FT                   /transcript_id="XM_001388328.1"
FT                   /product="cell division control protein 28, putative"
FT   CDS_pept        complement(64781..65959)
FT                   /locus_tag="cgd7_280"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell division control protein 28, putative"
FT                   /db_xref="GI:126652093"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_280"
FT                   /db_xref="GeneID:3371864"
FT                   /translation="MQQTTVIKSKTTSYVVLQDLGSGTYGRVVKAYDQNNPTHLVAIKL
FT                   FHLEEHEDEGVPATSIRELDILRTLNHPNIVDLYEVHYSRPTDGSPLLMGVFELCANDL
FT                   KKHCKVHTQQLRDRYPDLKNPIAEHTAWAKELMFQLLNGMAYCHSHNIMHRDLKPQNVL
FT                   MGMDGVLKIGDFGLARACRLPIPEYTHDVLTMWYRAPEILLGIDKYSPSVDVWSVGCIM
FT                   AELLRGGHALLPGECEIDMVWRIFRYFGTPTEESWPEIGKLKYFDKNFPVWTCNVQENL
FT                   KNLCKLADASAIDLLSKLLVCNPNKRISCKNALLHPWFDDIDRSKYVMWDSRVVLPSPR
FT                   NLHSRFNEMINDENVQQNNRASRRSLTKGVSSDKRRRDSDKRNAKPTVGAVL"
FT                   /protein_id="XP_001388365.1"
FT   gene            <66995..>68935
FT                   /db_xref="ApiDB_CryptoDB:cgd7_290"
FT                   /db_xref="GeneID:3371898"
FT                   /locus_tag="cgd7_290"
FT   mRNA            <66995..>68935
FT                   /db_xref="GI:66362509"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_290"
FT                   /db_xref="GeneID:3371898"
FT                   /locus_tag="cgd7_290"
FT                   /transcript_id="XM_628219.1"
FT                   /product="RAD21-N-terminal like protein"
FT   CDS_pept        66995..68935
FT                   /locus_tag="cgd7_290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RAD21-N-terminal like protein"
FT                   /db_xref="GI:66362510"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_290"
FT                   /db_xref="GeneID:3371898"
FT                   /translation="MSLENTHLAESSVGEFSILKYVKSETLVNLWLTAYFEKRIKKKQL
FT                   MSINIDESVQEIIKITNSENQWIPLRISCGLLTGVVKLFCHKVEYLDNKCTTVFTRMQN
FT                   FSKNLHNNPNNLNSSKFINKEGSNPKIDRPQNHSKQLKSVIDIEDINLTLNINENSIEQ
FT                   LEMVPLSQVTERSENQNLELTLSQRSDQNLYQAGSMPILLDMEFDDFINNEENEDADVE
FT                   MMIEDRLIVNESGVEIDLEANIEKRRGASVDFGEILANGLEEIGSIERGKLSEHGSNGD
FT                   LLDIDNSHEYRGSINTFRASPISGSNRDSIGGFSAVLDTLEDSGNRLSISGITESILDK
FT                   NSILNNISALNLPEISKSVKVSEAYSGRVGTKRMKVIEIAQDIVLSSRPLENRDKSLSI
FT                   AFSNSKSDVKILKNLINLSKNSEMGVLGLNKTLPIRLSDGFLMSFISNEGHRVKNIKKK
FT                   TIQKNNKSLFISESVKRTSNPSIEAYSSFESLEDHAEQEIYTNSVYEELNPDEEFQINT
FT                   PVRGKKSQSQEDFDEKDELTFTPWTNYFGTAQRNIINLSPNTYYDDEKKIQSLFSSREV
FT                   KTMEYLNSKFSKSDNLTFDELVKGSDASVVAPIFVQILHLKSKSMIDIQQEEPFGKISI
FT                   FPVVNNAHKIM"
FT                   /protein_id="XP_628221.1"
FT   gene            <69239..>74263
FT                   /db_xref="ApiDB_CryptoDB:cgd7_300"
FT                   /db_xref="GeneID:3372042"
FT                   /locus_tag="cgd7_300"
FT   mRNA            <69239..>74263
FT                   /db_xref="GI:66362511"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_300"
FT                   /db_xref="GeneID:3372042"
FT                   /locus_tag="cgd7_300"
FT                   /transcript_id="XM_628220.1"
FT                   /product="CpCCP2; extracellular protein with a signal
FT                   peptide, ricin, discoidin, NEC, LCCL, 2 levanase and an
FT                   apicomplexan-specific cysteine-rich repeat (apicA repeat)"
FT   CDS_pept        69239..74263
FT                   /locus_tag="cgd7_300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CpCCP2; extracellular protein with a signal
FT                   peptide, ricin, discoidin, NEC, LCCL, 2 levanase and an
FT                   apicomplexan-specific cysteine-rich repeat (apicA repeat)"
FT                   /db_xref="GI:66362512"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_300"
FT                   /db_xref="GeneID:3372042"
FT                   /translation="MKKTRLDWLIAFFLFFGVSLIEGKNDGGILESILGTTLKELEKSI
FT                   IDTQDLGESNDTKKLNETQILSDAYEANINKDRDNVPAATSSLSKAYNPLKLGELFIVP
FT                   LTSAIADNYYHSYGPDGRDLFLPENGIRRGINHWLSDGNSIKKDIVYFTGILSEPRTVS
FT                   GIVINWASSPGEVRIDVSKDGYTFEQAVDWTTNRLPSKEFEQKLYFKEKPIRISRVRIG
FT                   MRNPIHTFFGINFTGLLVVGAPIVQLTSGITSMTEEFCWQIENGDIYSKGAELVLGSCI
FT                   EAVASGDSREIFEFNSKGQLFNPVSKLCVRLKDNVVGGGALVLDDCRKASDGSGLFELM
FT                   PNNQLRLARGGNLCLTSPGDKPGVANVALNSAASSTSVVRTGIENGPAMAVDGKDTSYW
FT                   LSDSLTPGKDSANVNFLIDTGSVTKLKDIFIEWKYPAIDFNIDLSENGKEYQTQVSVNN
FT                   NGLMSTTYSLEGKKARYVKIQMTIPSQDETGKYVYGIKQVRIFSNTMRSAVEDCSSVKQ
FT                   HNDGRDKIFPLPYNGDNFAPGLLLKAHGISVKNRLNELQELSGKVTSILPNLDACRKTS
FT                   DGRDNTLKMQATKLGFLSEKLEKLTSDYNLEYKFTKPALGGSELYPGEDCVAIKNDKTQ
FT                   EAISGFYYVRPFCSTKPLRVYCDMNTGNTIYPMEMSVHSSRAASSACATVGLKPLLLRD
FT                   KKESVVGIKKMLNMMNINDNRRVIPLTHDFGCDNPKGCNSQFTQLGSGVEEFVAASPQA
FT                   AASNSTSGALPELVLCSTNTNLKHESNAISLSCESRFSDMKVFKSSPLLTSILVKCPTS
FT                   CNPENGGVVIGSDVYRDDSSICLAAMHANTLNRSTGLAQITPIEGLESYGASIKNGISS
FT                   VAYTGKRWKKSFVTSKYEGLCPSDSSLSMLISFVELENKGNENVNITSNYTMPQAKSLG
FT                   MGVAVDTFEAINMMERYMDNIGGITYSPAMKESIGGSQVLVSKVRSQLKPTQIMDYHTR
FT                   TSADDMLVRLHTVSSVLYYHMEEILETIVEQEDLLNKVRELKSTQTGFDSFKMPISDFI
FT                   QFGKIFESWDTPGLVNGVGNWRILYEPIGGGGRSGVLGQTSSVGPNLPDRTVAIGSFSR
FT                   IKYKKFYDIDYHVDVYVDSYEGSFGLAFRMQNFERYYLLEINQNKNGGFKRLIRVMDGQ
FT                   KSILSTKYDGGYVTGSWHHVRILLTGSRIQIWVGTEANSVQGENKKYSSPVKVFDLYDS
FT                   TLLSGSVGFFSSGIKGGGVYFDNINIEAKPCTQPTIISSLLRPSAPPTAPVCSSYKSGS
FT                   FGGVHNEFMFVDPELSNDGPSNWEFRSNVGGLQTRSLIQTSNIHSISSDNIGTHAILGG
FT                   NRQCNSGVFEYSFFPQCPNGIIGGIIHYESESNYVIFEMGSYYSRIRAIKDGVIKTIAS
FT                   NVFVGYQVGVWNNIEIQFGTLGTKILASTNNYGKTQLLYSGSPLGIHDGSVGLSSFRCP
FT                   GVAFQTIQLKPLSTMKSISGLFVEKDSSSNTKEETKTQDGKNLTTTTSEFNLDSEMTCQ
FT                   ADHTTLRKKDCEKLSGGKQCETNYCSYCCENSANRTTKEQLKCKQECHKKDVMDEQSKK
FT                   VLKKLGDCHSEDAIKLYSDKCNFTERKGQFSISMLNDEWTKQFVCFVDMCQMCCNTQPM
FT                   DGVTEDSKADEASLSECYLQCILQDYKTMSISKSRK"
FT                   /protein_id="XP_628222.1"
FT   gene            complement(<74389..>75765)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_310"
FT                   /db_xref="GeneID:3371901"
FT                   /locus_tag="cgd7_310"
FT   mRNA            complement(<74389..>75765)
FT                   /db_xref="GI:66362513"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_310"
FT                   /db_xref="GeneID:3371901"
FT                   /locus_tag="cgd7_310"
FT                   /transcript_id="XM_628221.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(74389..75765)
FT                   /locus_tag="cgd7_310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Gle1l protein, nuclear-export-signal
FT                   (NES)-containing protein/polyadenylated-RNA export factor"
FT                   /db_xref="GI:66362514"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_310"
FT                   /db_xref="GeneID:3371901"
FT                   /translation="MDGEKLSQDLNYLVFSWESKYVRNDKVLKEKITPIKEHNWNSEKA
FT                   EQDEDIVSPIINRHIQEIEEEIQRINKENEDKRRKEEEERKIKERKEREKREQEELRLK
FT                   KEQEELRLKKEKEQEELRLKKEQEELRLKKEKEQEEERQKAQEEAKRKEFNLSQDYPKN
FT                   EANFETQGKAYIEKISNYQNSSEYKEIISSTESSIKSTRMNVKKTIQLSINQISSTHQQ
FT                   ILSSSKRIKELLSGLRSSSTSITSSDTQSPMYSYGLYMAASLFIDQCWTQISAFPDSVW
FT                   SYAYSCVYILDENDEFEAFLEGLMLTECRVLYSSNLEDLNKKENETEENFGKRLNSIVR
FT                   FYLSINILRGNFGKIWLWLVKLLNKNSPHRLFVFVVLAVTQIVPHFFFSQFKNQFMKII
FT                   DYILRFKLPQIYTLIEGNPFPIKGQCKQLEAILSDLKSSCNAPPPSGFILKDKHLDVEC
FT                   "
FT                   /protein_id="XP_628223.1"
FT   gene            complement(<76755..>77312)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_320"
FT                   /db_xref="GeneID:3371900"
FT                   /locus_tag="cgd7_320"
FT   mRNA            complement(<76755..>77312)
FT                   /db_xref="GI:66362515"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_320"
FT                   /db_xref="GeneID:3371900"
FT                   /locus_tag="cgd7_320"
FT                   /transcript_id="XM_628222.1"
FT                   /product="putative 60S ribosomal protein L18A"
FT   CDS_pept        complement(76755..77312)
FT                   /locus_tag="cgd7_320"
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative 60S ribosomal protein L18A"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362516"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_320"
FT                   /db_xref="GeneID:3371900"
FT                   /translation="MKSMPDPSLQMKVNQYMVIGRGKPTELNPHPKVFRVCIFAPNEVV
FT                   AKSRFFYFMSRLNKVKKANGEILSVTRIFEKRPTYVKNFAILLQYRSRTNVVYMYKEYR
FT                   DISKTGAVSQMYEELAGSHRAQRSSIQIIRVSQIDAKLAKRPKTTQFFNSKLKFPAIRK
FT                   LPMAPKALRSTFTASRPTTFQK"
FT                   /protein_id="XP_628224.1"
FT   gene            <78604..>80445
FT                   /db_xref="ApiDB_CryptoDB:cgd7_330"
FT                   /db_xref="GeneID:3371765"
FT                   /locus_tag="cgd7_330"
FT   mRNA            <78604..>80445
FT                   /db_xref="GI:66362517"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_330"
FT                   /db_xref="GeneID:3371765"
FT                   /locus_tag="cgd7_330"
FT                   /transcript_id="XM_628223.1"
FT                   /product="integral membrane protein"
FT   CDS_pept        <78604..80445
FT                   /locus_tag="cgd7_330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein"
FT                   /note="with 9 transmembrane domains and signal peptide;
FT                   similar to endosomal endomembrane protein 70"
FT                   /db_xref="GI:66362518"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_330"
FT                   /db_xref="GeneID:3371765"
FT                   /translation="LNFLLCRKMRKELEMLLNEWKKIVLLILFLSQVFTAVHGYKHGDI
FT                   VSIVMNRIWKYDENIVTSEFSFYSKVPLCHDNRKIGEMSFNEIVRGDQLKIIKAVFGQT
FT                   ESNKSFCSINLTSDQLYSIRYHIRNNYVFEIYVEDKAIAKTLGYINENNEAILITGYDF
FT                   FIGYRNNEIVSLDVKTKREHTINIDKTLELNKPGKLHLINMSYCVNWVDKSNEPAEKAG
FT                   KSMVKIPMIRWLGVFNSSFLTILIIMMLLLIFMQVLRSEFSRYFPMGDDDLNLAFDDDP
FT                   IEMKGWKLLHGDIFRSPKYRMILSSFVGNGIQILFVGLIICITDNISMFRNLSFDLETL
FT                   KFLLALFTISSYISGFVSSYIYTSMGGKKFKYNIFLTCFIYILPVYLMVISVKSLTLGS
FT                   GPNFFNIYSSVKVFAIYSMISLPLCFIGGLFGQRRSKNYFKFPCKTNRLPRQIPRQKWY
FT                   NSQKFQLMVSGILPFSAVYVELHYLFISFWNYTPFYFYNNQHHNNFLLLTISTLLLILV
FT                   GSTSSIILIYIQLNLENYKWWWFSFLNGLSPCVYFFLFSLYYFLSYSNHIYGFIQFRLF
FT                   LMSNLIIAYTLTLALSCITFITSYIFIHYIYKHIKSD"
FT                   /protein_id="XP_628225.1"
FT   gene            complement(<80687..>82885)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_340"
FT                   /db_xref="GeneID:3371902"
FT                   /locus_tag="cgd7_340"
FT   mRNA            complement(<80687..>82885)
FT                   /db_xref="GI:66362519"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_340"
FT                   /db_xref="GeneID:3371902"
FT                   /locus_tag="cgd7_340"
FT                   /transcript_id="XM_628224.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(80687..82885)
FT                   /locus_tag="cgd7_340"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to golgi protein; conserved Gly-Trp motif:
FT                   GWGGKGLLGCDIAAGPLYDIP"
FT                   /db_xref="GI:66362520"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_340"
FT                   /db_xref="GeneID:3371902"
FT                   /translation="MGGAQTKQLGGFRVCNYGENSLGRLLELERSFDYIVGIDGVPLTQ
FT                   VSDASHDFFLKRLKGIGRHQVKINIYNSLSTRIRTIILNPHKHNENNEGNIPNRRFSVE
FT                   SEKDGLGKNAFVDGIESNMVEFDAPLNSLRVYQFLSYDERISGLGIGVHWEEISTKGIR
FT                   VVNIQDSSPAQAAGLISNEDYIVASSTLMRPFYSTDDFLVFVKKNDKVPLSLVVYNTET
FT                   EVTREIFITPNSGWGGKGLLGCDIAAGPLYDIPLREKEVSFSKPHHGNITYIEVIIQNN
FT                   NGKETIQFNLKEEHEVISKDFLHGDEDKDKDSCYNKGNDQQQLEPQLDEIPREDLLVKD
FT                   YSFDLYRIKQSEESSFDEKQGIIEQALINSGRQNIPDFSINPVQCLREATIPENDHEFT
FT                   ENLSNSSVNNTSESFIIISDLKRSSNSDEDQNDENNTVLSTSSTQSRNQTQVQITTETS
FT                   TTAELAHKEAHEECQIQTISPSYTEFSHRQVENQTQNPDIEINSLHQNPLLSASQQTPP
FT                   ENISGKKPCGSNCMPESPSEHCPAILPKSEDSLSMQLHALPHDQAGNVAVRSDQSGEEK
FT                   ASTLELHLKPQEHENGENIIVITHEKLLEPLKEDLKNEIEQTSNSNTDQKIPLNLEFKE
FT                   ENNAFDENNENKVSKMSQNDQIEEPYNGVTQPGNLDTLGEKNQVHEKNQIQSPRKNMEN
FT                   MSPEDERACEILKKLMKIEPKFNYDPPGKIVYTDQGEI"
FT                   /protein_id="XP_628226.1"
FT   gene            complement(<83213..>84337)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_350"
FT                   /db_xref="GeneID:3371903"
FT                   /locus_tag="cgd7_350"
FT   mRNA            complement(<83213..>84337)
FT                   /db_xref="GI:66362521"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_350"
FT                   /db_xref="GeneID:3371903"
FT                   /locus_tag="cgd7_350"
FT                   /transcript_id="XM_628225.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(83213..84337)
FT                   /locus_tag="cgd7_350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved in plasmodium"
FT                   /db_xref="GI:66362522"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_350"
FT                   /db_xref="GeneID:3371903"
FT                   /translation="MQNTLDNSNSAHASESASVNKILANVQGYYSGDYDWNDFYGDDDD
FT                   FSVDEDDDMKLDPNAILTSNSNKFDSIIQDKLKIFQNKGSTDNSNLGDVRFRQRIRNRR
FT                   MRHKANEDDNPDFLHDEIEQIQRGEEIAALSPEEMNEIRSTAWIPKGEYIPEDIIMGYH
FT                   TAWDIGKRGCVAVKLVGNWDSHISPNKVRFFIMDGTDPIAFLSYYTKSDLKVSRGEKSE
FT                   KKGIIFAKDLRDGYWDYGRSKIIFTRRNKSGQTTIIENLPTQFMDAMMVCIREIEVHKK
FT                   VTKIIKERRKQANNNTLDKNPAKIIVNSGISNSDDPNSNLLDTDISKNNLVPDKNDFIE
FT                   DAEVVVPLGNALTGKRASITKLVAPKIDFEKLKI"
FT                   /protein_id="XP_628227.1"
FT   gene            <85591..>87558
FT                   /db_xref="ApiDB_CryptoDB:cgd7_360"
FT                   /db_xref="GeneID:3371904"
FT                   /locus_tag="cgd7_360"
FT   mRNA            <85591..>87558
FT                   /db_xref="GI:66362523"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_360"
FT                   /db_xref="GeneID:3371904"
FT                   /locus_tag="cgd7_360"
FT                   /transcript_id="XM_628226.1"
FT                   /product="heat shock protein, Hsp70"
FT   CDS_pept        85591..87558
FT                   /locus_tag="cgd7_360"
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein, Hsp70"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362524"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_360"
FT                   /db_xref="GeneID:3371904"
FT                   /translation="MKYLKAIIFSVFLSLFLAFPVRSSDEKKYDGPVIGIDLGTTYSCV
FT                   GIYKNGRVEIIPNEQGNRITPSYVSFTDDERLIGESAKNQATINPVQTLFDVKRLIGRR
FT                   FKDDSVQKDKTLLPYEIINKDSKPYIQVSVKGEKKQLAPEEVSAMVLVKMKEIAEAYLG
FT                   KEVKHAVITVPAYFNDAQRQATKDAGAIAGLNVIRIINEPTAAAIAFGLDKKAEKSILV
FT                   YDLGGGTFDVSLLTIDNGVFEVVATSGDTHLGGEDFDQRVMDHFIKIIKSKTGKDVKSD
FT                   KRALQKLRREVEKSKRALSSAPQVKVEIEGLMEDVDLSETLTRAKFDELNADLFRKTIE
FT                   PVKKVLEDAGIKKSEVDEIVLVGGSTRIPKIQALIKEFFDGKEPNRGINPDEAVAYGAA
FT                   VQAGILAGEGGSDLLLLDVTPLTLGIETVGGVMTKLIGRNTVVPTKKSQVFSTYQDNQP
FT                   AVLIQVYEGERPMTKDNNLLGKFELSGIPPAPRGVPQIEVTFEIDTDGILQVSAKDKGT
FT                   GKSEKITITNDKGRLSQEDIERMIKEAEQFAEEDKLVREKVDAKNALDSYVHSMRMSIE
FT                   DKDKLAQKLEEEDKEKIKEALKDAEDFLSSNPDADAQEIKDKLKEVEGICNPIIAAVYG
FT                   QAGGAAGHAGGDDYSGHDEL"
FT                   /protein_id="XP_628228.1"
FT   gene            <88607..>90442
FT                   /db_xref="ApiDB_CryptoDB:cgd7_370"
FT                   /db_xref="GeneID:3371905"
FT                   /locus_tag="cgd7_370"
FT   mRNA            <88607..>90442
FT                   /db_xref="GI:66362525"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_370"
FT                   /db_xref="GeneID:3371905"
FT                   /locus_tag="cgd7_370"
FT                   /transcript_id="XM_628227.1"
FT                   /product="protein with a conserved N-terminal region"
FT   CDS_pept        88607..90442
FT                   /locus_tag="cgd7_370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with a conserved N-terminal region"
FT                   /db_xref="GI:66362526"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_370"
FT                   /db_xref="GeneID:3371905"
FT                   /translation="MASILSSFSSQYNELWKAIIRPPRDRYSIRDLGPMRFAIGKSIFK
FT                   RSDFTLRNRRFQALHCSHFEPIDNERQSESLPCVIYLHGNCSSRREALPYIPLLLPIGI
FT                   TVMAVDLSGSGLSDGDYISLGYHEKDDLSVLVEYLRNSKRCSSVGVWGRSMGAATALMY
FT                   SGVDKGDGFLKGIVIDSSFCSLRQLCHELVHHYIPLLPNFLVDSALSFIKSTINDKAKV
FT                   NIDDIAPIKSVGQCKVPALFISGTNDTLVNPNHSKTLHDNYAGEKMLMIIPGNHNSERP
FT                   KFVKASIVIFFYTVFDCFNIPKSADALRSFINTDLNLLFNYDGLYCDENGRIPKPITQS
FT                   FYAIQQYIRHKTTNNVSAPINNGLQKKNLGFSKEHLRREDMIRSSSNESFNDQSQGKGI
FT                   QMRPPDVDKYIDRMIPLSSENIKQSSSTIYSTGASCSRSTTFETISQGFERGDTMNTVS
FT                   SFEEFKDTFSPVTQPNRPSGAESGIEERVVGAEFGSDHLEGIVHYQISPPPGMKHANNN
FT                   NSDNQQQYFNQNQNIHQHSPSYHPYGLNQKGVTYTNGAISNGANSLLLSTGGLAPSTIG
FT                   MSSVQHQAPTGEGVKKPSIASSLPKRVANYNYPGN"
FT                   /protein_id="XP_628229.1"
FT   gene            <90845..>92584
FT                   /db_xref="ApiDB_CryptoDB:cgd7_380"
FT                   /db_xref="GeneID:3371906"
FT                   /locus_tag="cgd7_380"
FT   mRNA            <90845..>92584
FT                   /db_xref="GI:66362527"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_380"
FT                   /db_xref="GeneID:3371906"
FT                   /locus_tag="cgd7_380"
FT                   /transcript_id="XM_628228.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        90845..92584
FT                   /locus_tag="cgd7_380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362528"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_380"
FT                   /db_xref="GeneID:3371906"
FT                   /translation="MGEDQEWSDSSYVLRRKYRLYWIAILRNAPEGLEGLYDRFSKWSV
FT                   SLGFSLPNLVEESEELCIQRGEKKVYKISFPSRSSTRSFIRLSKRNIWREISRDSYSEL
FT                   YVYCDPAYKLRPFCDFQTMNLSTCYWIIRGISKDIENEEMIWDLVGRRNQFGEFLRRVV
FT                   YIRDEEGNNGFCFLQFSSPLTSYRALKWELKHFKGFELAHGKKMYLTPEFVGTSHVKAL
FT                   LLLCRGLDKFEIKTLKTVEMSLNDLRNSDRLNGENAISHEKVLQGYLNFWKRSNGLPVP
FT                   VDRNSEFQYNYDERNEYMYREALYNSGIDLFPKKPIRLYYCKSLDFLWDWNSRIFIDCQ
FT                   SKSLFEFDPELQSLKFIYNSGELSRLSNVGVGSTYGEIICDRNNREDFQIKAQISQEKL
FT                   KKEREIRVASFLETARSQLNCNMNTNNIYKNSVEEGYDSKRQEITQFFDISSNVTYEKS
FT                   GTYTSQRTEPRTPTCQNSSPGVQSSCIANACAVPATCESESVDARNMCMWSVSDGGVTE
FT                   GTIGEEIGQVKSGSKSGGTKEEELICFVCCRAFGSIWEKVNHEQNSLLHKYNLEIWKVG
FT                   SER"
FT                   /protein_id="XP_628230.1"
FT   gene            complement(<92660..>93817)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_390"
FT                   /db_xref="GeneID:3371899"
FT                   /locus_tag="cgd7_390"
FT   mRNA            complement(<92660..>93817)
FT                   /db_xref="GI:66362529"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_390"
FT                   /db_xref="GeneID:3371899"
FT                   /locus_tag="cgd7_390"
FT                   /transcript_id="XM_628229.1"
FT                   /product="phosphoglycerate kinase family protein"
FT   CDS_pept        complement(92660..93817)
FT                   /locus_tag="cgd7_390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoglycerate kinase family protein"
FT                   /db_xref="GI:66362530"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_390"
FT                   /db_xref="GeneID:3371899"
FT                   /translation="MAKYHQVDWEIVGIFEEDSTENHSNEFKFFDHHNPKSNLTLKDIE
FT                   SCFLDPNKYCKNSYNNNILKNNVILTRSWVCKLYILSGITGKDLSICMDYLENLILNNN
FT                   NFSQLNRIFCYFKNLPYLISFPLSQCKFEKYLACSKNKVQKNEIIEKVNHLIKKCLIHL
FT                   FSDFSVKPNIILIAGTSGSGKSTISSYLASFLRVKCVISTDTIRHVLRSTEKYKHNKAL
FT                   NCSTYEVHKYTTTQQTQKYKDQYSESSIVLGYLIQSSIIEDYIYEIIKNFVNKEKSIIL
FT                   EGVHITPSLFERIQSLANLENANLSTFLIYIQDIEEHIQRFQQRSKGILNSKYHNNIDN
FT                   IREIQSYLVKTIGKLSSVTSIDNTSNNIDNIVQEKILEQVTFKFL"
FT                   /protein_id="XP_628231.1"
FT   gene            <94666..>95709
FT                   /db_xref="ApiDB_CryptoDB:cgd7_400"
FT                   /db_xref="GeneID:3371907"
FT                   /locus_tag="cgd7_400"
FT   mRNA            <94666..>95709
FT                   /db_xref="GI:66362531"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_400"
FT                   /db_xref="GeneID:3371907"
FT                   /locus_tag="cgd7_400"
FT                   /transcript_id="XM_628230.1"
FT                   /product="hypothetical protein, signal peptide"
FT   CDS_pept        94666..95709
FT                   /locus_tag="cgd7_400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide"
FT                   /db_xref="GI:66362532"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_400"
FT                   /db_xref="GeneID:3371907"
FT                   /translation="MKFCQNVLYMISIIILVVRGAPTLNVRNPGEHGHPDSMITTSTTK
FT                   ATHTLKSNNQSTSEELLSMKSLQNEPNCENAVFPSEVFASQPRDDKVYIKPSTIPESGF
FT                   TRAGLTKFTSAFGIHILGDYRVPDDKLSYLTELLASVLDNDQDGLVDATQNTILDTIRS
FT                   SNAMMVILSGNEESVDKLLDPHEGLPPEYSCMMFLLVEQAKNIIRGGPHQKNCPQDLDR
FT                   VNDRGLGFVVDFISQAAYPVTFSLNEESSMRMENLYNSALRKGWFLPQNIPVANNELCD
FT                   EDCKRLSFQSWLATSILDQDKCSCIKANVFKLCTSEEIRNISPDDFAYFASALKRPTAY
FT                   SSPAIIA"
FT                   /protein_id="XP_628232.1"
FT   gene            complement(<96500..>97717)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_410"
FT                   /db_xref="GeneID:3371865"
FT                   /locus_tag="cgd7_410"
FT   mRNA            complement(<96500..>97717)
FT                   /db_xref="GI:126652094"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_410"
FT                   /db_xref="GeneID:3371865"
FT                   /locus_tag="cgd7_410"
FT                   /transcript_id="XM_001388329.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(96500..97717)
FT                   /locus_tag="cgd7_410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126652095"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_410"
FT                   /db_xref="GeneID:3371865"
FT                   /translation="MGIGTRTGTGTGTVVMRPGPEFWKERRLDLIKDALKSLYIDRTRP
FT                   HLQELIRRLKERVDLGANYNLQMLVKDLTENEEEFLLFSNGEIYFRNLNVPDNHWIDPK
FT                   NPNNPYSHEIWSGFLQYINNLVCVKGESNINGSNTINNSNNYSIDSKGHELIINQKESE
FT                   SDFLLIPLNSNYSNSQIEPDLLRYQFKGGRYGVAMEIHKAKISQLEDLSLGELSHLVQL
FT                   AINGGILQYENNVLKPRCTCVKIAAAALSMDVDQIESNETPNDDSNCSALINRLEKKSL
FT                   HNKLIDLKNELNEILILYPNGILLSLLKRFYNRYWGKKLSPTTFGYTHISTLLLSDELK
FT                   KTCRLYFDSLNHVIVQSTQFNIPENVRLLEEKKFQKKTSFLNSDLFVPIRNMSDISFEY
FT                   MRLLNK"
FT                   /protein_id="XP_001388366.1"
FT   gene            complement(<99423..>105551)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_420"
FT                   /db_xref="GeneID:3371908"
FT                   /locus_tag="cgd7_420"
FT   mRNA            complement(<99423..>105551)
FT                   /db_xref="GI:66362533"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_420"
FT                   /db_xref="GeneID:3371908"
FT                   /locus_tag="cgd7_420"
FT                   /transcript_id="XM_628231.1"
FT                   /product="protein with DEXDc plus ring plus HELICc;
FT                   possible SNF2 domain"
FT   CDS_pept        complement(99423..105551)
FT                   /locus_tag="cgd7_420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with DEXDc plus ring plus HELICc;
FT                   possible SNF2 domain"
FT                   /db_xref="GI:66362534"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_420"
FT                   /db_xref="GeneID:3371908"
FT                   /translation="MVRFKAKPLRYGGVLYQDKEYFILEEDNLKKEENNLDLKLDLDND
FT                   LDLDLDLKKPKKLNKKEELGIKYNKRQIITKLNDLICCLNIWENIKITIIQENENIDFI
FT                   EIMNSLNDQNKEFIVHIGLLEENKSKCEFVILNDKFEKENIEYDELNIKEGILGRGTIS
FT                   WLNLKPKIPYFNVRKALILLQDAGFITFTCEILGVKKSYSYNIRNFSIVNSDTSNSGTT
FT                   NSNTANSSTSNSNISNSNTANSNTSNSITANFGTANSNTANFNTANSNTANFNTANSNT
FT                   ANFNTTNSNTANSNTANSNTANFNTANSNTANSNTANSNTSNSNTANSNTSNSNTANSN
FT                   TANSNTSNSNTANSITTTSSNCSRSKGIVLNMNIKMYLNRTSLDGKLLSRKKDGKNSFK
FT                   ILFSWLNEELKLPSIENYTYNQIKNKKNSFQTIQIKPNELYSIFQEYNISMKRMGSSSS
FT                   TIKQNHDWNNHLGLVSELRNYQKDAVLFALNVEKETVKLNIEYPPYWYCLKIPKKEENE
FT                   QDLLYFNMITGELSFNILPSGGGHFTIRGGFLCDEMGLGKSLEIITLILMNPRKEYYYY
FT                   LNLNNKEECFKKNSSLPIFKYKDNNNNNNIEIECPCGVFKPFKDYNIVECKKCQVKFHF
FT                   ECCISDNIMNFNHLDNINLLCSLCQSIELNERLIVKATLIIAPGSIVDQWYDEFNKHLE
FT                   KGRLKVVKYQGVRYIQNYLKNRALNKLNNKDINLDSMTNNNGIILTRRDILNYDVVLTS
FT                   YEILKEEIYHVLDQNTITNKRSMRFKKSYPILASLITNIDWWRIVLDEAQMTEGYSLVS
FT                   KMTSKLICYNKWCVSGTPIVRSCSNDLIGLLLNLSNVGFDLINDTLYKKYIGYLSSILY
FT                   IKSNKGNTEFQGGSEDQAEVRAEDQVEDQVEDQSQEQAEDQSQDRAEDQDYSQSRPQNQ
FT                   PKDPNHMNENEKELLTEEKLLKEERWFVCESGLDYITNEYISMMNLIQHLEYVVGSLFY
FT                   RREMKQVKEEICIPPAFYGNTYLSLSSVERFFYIKQCESGYNSIINYKSQESFLRNKKE
FT                   MDSLITMLRLACIHPQLGIMGIHNKNKDDDSKYYNLDNHNDTGIVSLNTGLKIMTMDQI
FT                   LDKLLNKCRIDIEESVRKYVMNTLGLAGIHFTKKSKYDDDDDNNNNNNNNNMQMNKSVF
FT                   YYKQVLDIRKEDRVDVLQQIHTLWNLGEICNDELEKKELMKECNDLENKYRSKYFKEYI
FT                   EKHDLFIKSKDKANSLYSDDHWWYIFKKKFNMSTKGGISEEDLLLDRIENFQYEFKSAK
FT                   DGNIEHNLPSFNSIHGLIITLDLKVKQMQESRTKLLHQLKQLELLRFNNIQDQNTCSSQ
FT                   SMSQNLDVSQNLDVSQNLDVSQNLDVSQNLDVNQNLDVNQNLDVNQNRNLDVNQNQNQN
FT                   QNLDVNQSQNLDVNQNLDVNQNQNLDLSQNQNQNQNQNQNIKSQLILDEIIAKVTSCFF
FT                   CQQGQNSQIEDNQQKNIGKKNNKLIQKQESCIFCIIQTHIEELEYSLYTIKKKTFTRLS
FT                   ESSNNNHSIEIDNNQQNKIIHHDSTYLRDSETIAILKFLNKELRKKFFKSGSNSKDEEK
FT                   ELEFEQEQEQEQEQEQELNEMDDFSSISKISTKHIKYIESLKIELYNIKAFVSATRQLI
FT                   NSYLELIDCKQRIQIIQNNQSNSSSNHNNIIHISEIPFLIEKYESERISALGVRRNLKS
FT                   QQKFLCHLKLQQRSKKDWKNEILQEKDHEKEKEENQDHDICPICLNKLKDDYSQVLLPC
FT                   AHIICIDCYKLISKKSSSNHKLKNQCPKCRLNFQDTNVVLIVPDNDNHNIIKENNLENN
FT                   INSSTSLINESLNKPNQVDFGIDYFNTIQSIEILGNFGTKIEAIIKHIKWILNNNNDKI
FT                   IIFSDFQPVIDILSSAMHLNEILFKKYCGGKSEYHIIREFSSSENSIDINYRVLLCNHL
FT                   NVGKGVNITAANHIIFVSPLLNKSDELQAIGRIIRMGQTKTPHIWNFIIHNSIDELIFQ
FT                   YLFNFYNNQNPHNPSFNSNNQYSLNLKIIQHVSDTNFKQREHTIEEKQPN"
FT                   /protein_id="XP_628233.1"
FT   gene            <106361..>107323
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_430"
FT                   /db_xref="GeneID:3371866"
FT                   /locus_tag="cgd7_430"
FT   mRNA            <106361..>107323
FT                   /db_xref="GI:126652096"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_430"
FT                   /db_xref="GeneID:3371866"
FT                   /locus_tag="cgd7_430"
FT                   /transcript_id="XM_001388330.1"
FT                   /product="cyclin-dependent kinase-related kinase, putative"
FT   CDS_pept        106361..107323
FT                   /locus_tag="cgd7_430"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin-dependent kinase-related kinase, putative"
FT                   /db_xref="GI:126652097"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_430"
FT                   /db_xref="GeneID:3371866"
FT                   /translation="MFSISERYEQINAHIGQGTYGKVEKAIDKNSDTIVAIKKVKICEL
FT                   PSDLTESRQKVGQCGIHFTVLREIKIMNEINHPNIMGLRDVFVQGDFINLVMDYMESDL
FT                   RKVFENRIRFSESHIKCLLKQIILGINELHNWFIIHRDLAPANIFINSKGIAKVGDFGL
FT                   ARSYGQPRREYTPEVVTLWYRCPELLFGSTKYTHAVDMWSIGCIFAELLTGGKALLPGD
FT                   DEVRQLGRIFELLGTPNEDNWPQAKELPLYCEFSPRSPLNFKDIFPNASEMAIDLIQSF
FT                   LRLNPLERISASQALEHEYFKSYPLPCDPSELPLNYFKN"
FT                   /protein_id="XP_001388367.1"
FT   gene            complement(<107395..>108861)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_440"
FT                   /db_xref="GeneID:3371766"
FT                   /locus_tag="cgd7_440"
FT   mRNA            complement(<107395..>108861)
FT                   /db_xref="GI:66362535"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_440"
FT                   /db_xref="GeneID:3371766"
FT                   /locus_tag="cgd7_440"
FT                   /transcript_id="XM_628232.1"
FT                   /product="RIO-like kinase domain; N-terminal region
FT                   conserved"
FT   CDS_pept        complement(107395..>108861)
FT                   /locus_tag="cgd7_440"
FT                   /gene_family="HOG000282747" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RIO-like kinase domain; N-terminal region
FT                   conserved"
FT                   /db_xref="GI:66362536"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_440"
FT                   /db_xref="GeneID:3371766"
FT                   /translation="NTKMKLDVSNMRFISKDEWRILTAVEMGMRNHEYVSPQLIESISN
FT                   LRRTGSYQLLQNLLRNKLVSRESKIYEGYKLSYLGYDFLALRALNKRGIISSVGARIGV
FT                   GKESDIHIAADENGKLICLKLHRLGRVSFRNVKNTRDYLRNRKTSSWLYLSRLAALKEY
FT                   SCLKALYENGFNEGEIKVPEPIDWNRHAIVMELIDAVPLNSIRHLDDPYGALERLMKMI
FT                   IRLADCGLIHGDFNEFNLLIDSKENITLIDFPQIVNTDHINAEMYFNRDVNCIIELFRK
FT                   RFGIQVMEYPKFEDVIVFTSDNVHSSNKIINIGKIDRDMNRLDYLNTIISQNNGKNNLD
FT                   GSELHDNSEISHEEDDSTQEEEEEEEEEEEEEEEEEEEEDDDDDDDEYNCRNQDQDNSD
FT                   NEHQEEEEYDEIIDKQEYDEFKARAINERINNLWLPRKNKTTQFDKDRIRKSFVSQYDK
FT                   HHSSKGNSGSKKSREYRKTKAMIDNIKNDY"
FT                   /protein_id="XP_628234.1"
FT   gene            <109702..>111054
FT                   /db_xref="ApiDB_CryptoDB:cgd7_450"
FT                   /db_xref="GeneID:3372024"
FT                   /locus_tag="cgd7_450"
FT   mRNA            <109702..>111054
FT                   /db_xref="GI:66362537"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_450"
FT                   /db_xref="GeneID:3372024"
FT                   /locus_tag="cgd7_450"
FT                   /transcript_id="XM_628233.1"
FT                   /product="putative cytidine diphosphate-diacylglycerol
FT                   synthase; integral membrane protein with 7 or more
FT                   transmembrane domains"
FT   CDS_pept        109702..111054
FT                   /locus_tag="cgd7_450"
FT                   /gene_family="HOG000209582" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative cytidine diphosphate-diacylglycerol
FT                   synthase; integral membrane protein with 7 or more
FT                   transmembrane domains"
FT                   /db_xref="GI:66362538"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_450"
FT                   /db_xref="GeneID:3372024"
FT                   /translation="MKNSRYIRSNSIFDDTEHETESDNFFSEVELRRRNGNRKESSEKN
FT                   GHKEGNKNGIIENSKITGNHSSTNNSGDLNWVTRTIWTIILLSSFLVILAAGHTYSAML
FT                   VLILISAVYQEVNSLKRSAEEDKRLPFFYTLRWYWLGVTLFSTGKLWWVPLIEKYRRNY
FT                   YLLYLIVYYHSLISYVGALFGFIAFILSLRNYTLRYQFSQFGIMILSLLLVVTQSVFMI
FT                   ANTYRGLIWFILPSCLVICNDIFAYIVGKIFGKTRLFRLSPKKTVEGFIGASIITIFAA
FT                   IILGNVLSKSQIFICPQNELLEKPFSMWYELKCDPNPVFIQKPYNIPPFLHFIFGKEPF
FT                   LIPDSQFHAIAIGIFAAFVAPFGGFFASGLKRALRIKDFGSAIPGHGGITDRFDCQILI
FT                   GLFTYLYIRAFIFTNPKSVSLDIVIKLAKMLPEPEIQHLISVLSSHISSQQ"
FT                   /protein_id="XP_628235.1"
FT   gene            <111961..>115836
FT                   /db_xref="ApiDB_CryptoDB:cgd7_460"
FT                   /db_xref="GeneID:3371909"
FT                   /locus_tag="cgd7_460"
FT   mRNA            <111961..>115836
FT                   /db_xref="GI:66362539"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_460"
FT                   /db_xref="GeneID:3371909"
FT                   /locus_tag="cgd7_460"
FT                   /transcript_id="XM_628234.1"
FT                   /product="P-type ATpase 3; integral membrane protein with
FT                   signal peptide and 12 or more transmembrane domains;
FT                   possible MgtA, cation tranport ATpase."
FT   CDS_pept        111961..115836
FT                   /locus_tag="cgd7_460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="P-type ATpase 3; integral membrane protein with
FT                   signal peptide and 12 or more transmembrane domains;
FT                   possible MgtA, cation tranport ATpase."
FT                   /db_xref="GI:66362540"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_460"
FT                   /db_xref="GeneID:3371909"
FT                   /translation="MKLGIFGDIYSTFFPIDLCIKLLIFTISILLFFYIANLIIWRRYD
FT                   KHTYKHQSFEMILIPCRKNIYSNIFRCTLNFLTAVHLILIPLVTYDSVSAPESSSILYW
FT                   RKKAEVFLVEYVVALIICIGRKLFTQRIRLTLIMPSNLFDCNFVCLWVRDNNNINNNHN
FT                   HDHNTNDNIIQSINKDPSYSTLNKKFLNFYKKSLAFLDGEMTGFKYYGCHIQTDESSGI
FT                   RYFIAGSTRFVFSIETGTFLPQIQSSRVSVNQIENALNCGGHSEASVISYLSVFGKNEL
FT                   PYETEPALLVMKRIFFCPTFILQYLMLSTTFFLRFFTWSFCWSALILYTNLFSFFKDIF
FT                   RNRKLLKETHEINNRPVKVIRGNIKKSIKASDIVLFDIVLSETGDIAPCDMILMEKLVL
FT                   VDESSLTGEATPVFKKPLDLSALSNSQILSASDNILKDSLIHAGCKIIKVFGGDESNDS
FT                   LISVVLNTGVFTFKSKILRTVSQNMISDDFHNDIPLLWLLTLSVASVVITVQCLISQFN
FT                   IGSIFFILGTLLQLLPIWAPAFVQSCINSSVSTLKNDKNVESSYPRRILFASKLDTLFF
FT                   DKTGTLTMNDYVLDNVERLNSDLLEDQGFFTGNERYSERIVRGINGEKIDILKMAISTC
FT                   HSLSFVPDQGDGGYYGDSIEKEMLKFTRSCIYEKSSLNDRSLRRFVFEKGAEFDLENIY
FT                   RSHNTANLEKKLSKGCEILKIFDFNGVSRSMSVIVRCNVTDRVFLFTKGASESILKFSI
FT                   KNQSTEEIEFRTSKLSSSGFYVIIIAYRELKSDKESIELYRLLNESERINFEVDLIPVG
FT                   ILCFSNCIRKEAPFIIKEIKDLGIKPIILTGDNSDCALCVAKQVGIINSQFKVSNIEAK
FT                   LNLCEIDLNSHQIAVLCCIISGKLVFLNEFRHEIDLEEVIKNLNKIRLVVTFESYEMMS
FT                   KTILHNYEGIVNPLKNDSKQAFLSNETLLDLFKNNISVISRANHINKQSVIRQFMNEGK
FT                   IVGMVGDGTNDVAAVKDSNLGIFVNKNGSLSSHFSLDKGDLNGILSIIREGCGCAANSR
FT                   SLYLFMIMYGFTIVICKNILLYSGQATLPTMGYFYYSIFVNFPSVWGIKRSRPANKIKK
FT                   YPVDAGLVSRSSILTVICFVSVIGINLGVVLFLLSNKSWFVSSYTRNLGIPIFISARQD
FT                   GFESSTTLIWMCSLHSHMALIFGMGGYHREPFYKNKVLVSTWFLAQLGLLFLIFSEPSL
FT                   ITCFFKINCQEGITPGTLFGMNIPKFSSSNVFPFSWKFELVGWIAASFLICIFIYRKLN
FT                   FNSASKI"
FT                   /protein_id="XP_628236.1"
FT   gene            complement(<116451..>117437)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_470"
FT                   /db_xref="GeneID:3371767"
FT                   /locus_tag="cgd7_470"
FT   mRNA            complement(<116451..>117437)
FT                   /db_xref="GI:66362541"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_470"
FT                   /db_xref="GeneID:3371767"
FT                   /locus_tag="cgd7_470"
FT                   /transcript_id="XM_628235.1"
FT                   /product="malate dehydrogenase, adjacent gene encodes
FT                   predicted lactate dehydrogenase"
FT   CDS_pept        complement(116451..>117437)
FT                   /locus_tag="cgd7_470"
FT                   /gene_family="HOG000213794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malate dehydrogenase, adjacent gene encodes
FT                   predicted lactate dehydrogenase"
FT                   /db_xref="GI:66362542"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_470"
FT                   /db_xref="GeneID:3371767"
FT                   /translation="LKKISYKYNTVIMRKKISIIGAGQIGSTIALLLGQKDLGDVYMFD
FT                   IIEGVPQGKALDLNHCMALIGSPAKIFGENNYEYLQNSDVVIITAGVPRKPNMTRSDLL
FT                   TVNAKIVGSVAENVGKYCPNAFVICITNPLDAMVYYFKEKSGIPANKVCGMSGVLDSAR
FT                   FRCNLSRALGVKPSDVSAIVVGGHGDEMIPLTSSVTIGGILLSDFVEQGKITHSQINEI
FT                   IKKTAFGGGEIVELLKTGSAFYAPAASAVAMAQAYLKDSKSVLVCSTYLTGQYNVNNLF
FT                   VGVPVVIGKNGIEDVVIVNLSDDEKSLFSKSVESIQNLVQDLKSLNL"
FT                   /protein_id="XP_628237.1"
FT   gene            complement(<117820..>118833)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_480"
FT                   /db_xref="GeneID:3371768"
FT                   /locus_tag="cgd7_480"
FT   mRNA            complement(<117820..>118833)
FT                   /db_xref="GI:66362543"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_480"
FT                   /db_xref="GeneID:3371768"
FT                   /locus_tag="cgd7_480"
FT                   /transcript_id="XM_628236.1"
FT                   /product="lactate dehydrogenase, adjacent gene encodes
FT                   predicted malate dehydrogenase"
FT   CDS_pept        complement(117820..>118833)
FT                   /locus_tag="cgd7_480"
FT                   /gene_family="HOG000213794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lactate dehydrogenase, adjacent gene encodes
FT                   predicted malate dehydrogenase"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362544"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_480"
FT                   /db_xref="GeneID:3371768"
FT                   /translation="SEFLFSKHLFIFFILKMIERRKIAVIGSGQIGGNIAYIVGKDNLA
FT                   DVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITASIPGRPKD
FT                   DRSELLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAG
FT                   VLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPVTSSVSVGGVPLSSFIKQGLITQ
FT                   EQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHY
FT                   GVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLDNAPAAGA"
FT                   /protein_id="XP_628238.1"
FT   gene            <119676..>120320
FT                   /db_xref="ApiDB_CryptoDB:cgd7_490"
FT                   /db_xref="GeneID:3371910"
FT                   /locus_tag="cgd7_490"
FT   mRNA            <119676..>120320
FT                   /db_xref="GI:66362545"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_490"
FT                   /db_xref="GeneID:3371910"
FT                   /locus_tag="cgd7_490"
FT                   /transcript_id="XM_628237.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        119676..120320
FT                   /locus_tag="cgd7_490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362546"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_490"
FT                   /db_xref="GeneID:3371910"
FT                   /translation="MSSLIEIMTIVESKGGKEDVEVELSKDLPEADFNKLREQLFMMGF
FT                   ELQNQNIEKDQKSGSSGNTGDNCRKFKLKKESYNELIVKEISNMSLKNQQEASIPLTPK
FT                   SALKSKKDNFVDKSQKLDEELAAIRAEKARQFKDSSGHSYRNTNNTCNSNNSRTSTDSQ
FT                   SSFRRFMNFDWFTSMFSSRRRGTSQRDRMHLDSSYYRSKNTGCCGSSCGGS"
FT                   /protein_id="XP_628239.1"
FT   gene            complement(<120374..>122104)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_500"
FT                   /db_xref="GeneID:3371911"
FT                   /locus_tag="cgd7_500"
FT   mRNA            complement(<120374..>122104)
FT                   /db_xref="GI:66362547"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_500"
FT                   /db_xref="GeneID:3371911"
FT                   /locus_tag="cgd7_500"
FT                   /transcript_id="XM_628238.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(120374..122104)
FT                   /locus_tag="cgd7_500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362548"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_500"
FT                   /db_xref="GeneID:3371911"
FT                   /translation="MPNNSRLFKEKLRKELIEKHVKNIENSNLISLKFQERLIDNHGRL
FT                   DDDVILKIQSFLRPCDLEEISIERSDKSKCGWIQCQVGISGGSSNNLKSKWALDKRSGN
FT                   IIERSILSLFCSTNCYYLYLDLSISLSETHPHLRTDALIEIQKWLGLYQNEEQNDKDNV
FT                   FKNEEMKIDCENKKNEEKEKQQEKEKHLEKVENEDIGMVNTLSFSQSKIPTNDTFDNSQ
FT                   MSTDKDQKMINLKKVETNKVENTKGHAELSSLLNSIKTFRRNNTQYKFDQIVKHFDYLD
FT                   IEESEPTRSSESNELSIKNHKPSSESLQDRGKENSVDGKKLDNLDSLEELDDPEYTYQD
FT                   MMQVLHDISEDDEDDYEDEDEGDEEENEEKEEEQVDKNEDKKDCSGKKHKKNGAVQDYV
FT                   LLMTQFYDNLSPEVVVLDLLTSLISEETRDLIKSKCIVEQGKNNEKEESNKENNKNNEF
FT                   DIIQIDRRNVLKDNISGYITSIEWIFHTKLLVFTIYRILDTFVFPFSIPNLKQPCLELL
FT                   TFILIDIIMDNEIHFNITNYFKSLQDEIKIKAEQWLLEIRRKYDDKFIDNIKLLFISKD
FT                   "
FT                   /protein_id="XP_628240.1"
FT   gene            <122317..>122643
FT                   /db_xref="ApiDB_CryptoDB:cgd7_505"
FT                   /db_xref="GeneID:3371858"
FT                   /locus_tag="cgd7_505"
FT   mRNA            <122317..>122643
FT                   /db_xref="GI:66362549"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_505"
FT                   /db_xref="GeneID:3371858"
FT                   /locus_tag="cgd7_505"
FT                   /transcript_id="XM_628239.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        122317..122643
FT                   /locus_tag="cgd7_505"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362550"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_505"
FT                   /db_xref="GeneID:3371858"
FT                   /translation="MVQFCIHCHNILLLKEHEERMAFYCPTCPYVFKIVSQISKVTDFV
FT                   PKKMEEPSIDMNEIASSKTMGKLRLYSGSTIICRRDLYLLLYYTNKLYLYIQSIIYQLI
FT                   KKGI"
FT                   /protein_id="XP_628241.1"
FT   gene            <122723..>122911
FT                   /db_xref="ApiDB_CryptoDB:cgd7_510"
FT                   /db_xref="GeneID:3371769"
FT                   /locus_tag="cgd7_510"
FT   mRNA            <122723..>122911
FT                   /db_xref="GI:66362551"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_510"
FT                   /db_xref="GeneID:3371769"
FT                   /locus_tag="cgd7_510"
FT                   /transcript_id="XM_628240.1"
FT                   /product="RNA polymerase III subunit C11"
FT   CDS_pept        <122723..122911
FT                   /locus_tag="cgd7_510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase III subunit C11"
FT                   /db_xref="GI:66362552"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_510"
FT                   /db_xref="GeneID:3371769"
FT                   /translation="IFANYFNNNFLFYWCSLFKLLAVCPKCSFSEAYFFQLQIRSADEP
FT                   MTSFYTCVKCDFKWKEN"
FT                   /protein_id="XP_628242.1"
FT   gene            complement(<122916..>125252)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_520"
FT                   /db_xref="GeneID:3371912"
FT                   /locus_tag="cgd7_520"
FT   mRNA            complement(<122916..>125252)
FT                   /db_xref="GI:66362553"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_520"
FT                   /db_xref="GeneID:3371912"
FT                   /locus_tag="cgd7_520"
FT                   /transcript_id="XM_628241.1"
FT                   /product="cyclin'cyclophilin like peptidyl-prolyl cis-trans
FT                   isomerase fused to WD40 repeats at the N-terminus'"
FT   CDS_pept        complement(122916..125252)
FT                   /locus_tag="cgd7_520"
FT                   /gene_family="HOG000213214" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin'cyclophilin like peptidyl-prolyl cis-trans
FT                   isomerase fused to WD40 repeats at the N-terminus'"
FT                   /db_xref="GI:66362554"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_520"
FT                   /db_xref="GeneID:3371912"
FT                   /translation="MSLQNQLQEGESSDGSEDFGPGFTDFVDKSKKDEDQQFSYLEPDF
FT                   SNDKYELGYSNKLKTRKIEVITNNQLKEIKEDNKDDVDDDDDDSLGPMPTMLTTNDSIE
FT                   KVESENKDNKERERNREKELEKIVNIPKTDFYECSFMHKKQVTHILSSNKTGFIITASK
FT                   DGVIKFWRLRSEKEILREKENQTKELSSPVITSLEFVKGFQAHKNEVSDISISNCEQYM
FT                   ASISENEKDIKLYSISNFDMISIIRIPIYPNRCVFLSSIGGGLSSSSINNHGNKNDKNK
FT                   SNMRNINTFNLSSGLIYPQIVLSELKTGSIYIYSIKGGNLLINNEKDPDNESFPKYNNH
FT                   KAQVTCLKFLPNLGIIISGDISGGLEFWDPWTMTLPRRNIQDNELNPIKFQYKIETDLF
FT                   ELQKNKCYAINMVVSNDERNLAIKCSDYKIRLFLIQTGKCYKIFDENISSYNVMQSNPE
FT                   YDYLHIDHLEFGVRSSVETEIQNLPEYYNMQNMVFDETSRFLIYTCMIGVCVLDIQIGK
FT                   RVLIIGKFETGKRFLNLGLLQIHRGINYNDNHLSNVDSAIITSAYKSNRIYIFSKRLPL
FT                   LDNGDVNLKRDIFNELPSSEEIERQKQLEQFSNKGKERSNAYVRIAKQVILHTTKGDIT
FT                   LELYPEIAPKACENFSVHCFNGYYNNCIFHRVIKGFMIQTGDPTGQGIGGVSIWGKEFE
FT                   DEISPNVKHDEPFTLSMANAGPNTNGSQFFITTASCPWLDGVHTIFGKVVHGKEIVKEI
FT                   EHVSTNRNDRPIQDVSIISASTIFN"
FT                   /protein_id="XP_628243.1"
FT   gene            <126102..>126383
FT                   /db_xref="ApiDB_CryptoDB:cgd7_530"
FT                   /db_xref="GeneID:3371770"
FT                   /locus_tag="cgd7_530"
FT   mRNA            <126102..>126383
FT                   /db_xref="GI:66362555"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_530"
FT                   /db_xref="GeneID:3371770"
FT                   /locus_tag="cgd7_530"
FT                   /transcript_id="XM_628242.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <126102..126383
FT                   /locus_tag="cgd7_530"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362556"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_530"
FT                   /db_xref="GeneID:3371770"
FT                   /translation="IPYILNLFNLSSILLPHFIQNFIYPYLYYRIRVGESYYHASEDEA
FT                   TEKIEELKSQVEGRIEEISKELSSIQQEMDKLKVDLYLKFGSNINLDE"
FT                   /protein_id="XP_628244.1"
FT   gene            <127075..>128475
FT                   /db_xref="ApiDB_CryptoDB:cgd7_540"
FT                   /db_xref="GeneID:3371913"
FT                   /locus_tag="cgd7_540"
FT   mRNA            <127075..>128475
FT                   /db_xref="GI:66362557"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_540"
FT                   /db_xref="GeneID:3371913"
FT                   /locus_tag="cgd7_540"
FT                   /transcript_id="XM_628243.1"
FT                   /product="hypothetical protein with signal peptide and 8 or
FT                   more transmembrane domains"
FT   CDS_pept        127075..128475
FT                   /locus_tag="cgd7_540"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide and 8 or
FT                   more transmembrane domains"
FT                   /db_xref="GI:66362558"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_540"
FT                   /db_xref="GeneID:3371913"
FT                   /translation="MKKELVFLIIISILIKLSFFILVEHDLEDYTNGFFGILGQNFGEV
FT                   LEFCALKEYGISTYYESKRVNFPAVFMELISGLCSSINSKNGLIFPFLAINLIQILQGI
FT                   LIYSYLIKSYPILSTISKTIIEKNNYELCVNMLVGIFWINPISIYTSSLLSFGIEFELF
FT                   LQLLLLWISIDSSHKFRALLPIISGINVYYSPTVSISLIPSTLTLFLSGNQHFLKFNTC
FT                   PQLFDNFKMHFKHFWINFLSNYFNFRNILKIILFFTSFTITFLSLHIFSFIIINHQNSH
FT                   HILTFKEYFYTFIVQNFTLLENKDLNPYLNIYWFLMYCIASEFRLYFQIILGSCLIIYA
FT                   FILNISLEKIPFKALQSQLLLCFVFKSNPTFINYLLIFFFILFDSVTLFESKSGFLASF
FT                   SFVTWMICIPSAFLIRPIWILENSLDSNFYYFLTLAGNFSIIIFIGEWIKSLFNNLVKY
FT                   SPNPDKVS"
FT                   /protein_id="XP_628245.1"
FT   gene            complement(<128733..>129941)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_550"
FT                   /db_xref="GeneID:3371914"
FT                   /locus_tag="cgd7_550"
FT   mRNA            complement(<128733..>129941)
FT                   /db_xref="GI:66362559"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_550"
FT                   /db_xref="GeneID:3371914"
FT                   /locus_tag="cgd7_550"
FT                   /transcript_id="XM_628244.1"
FT                   /product="hypothetical protein wtih 9 transmembrane
FT                   domains, possible apicomplexan-specific protein"
FT   CDS_pept        complement(128733..129941)
FT                   /locus_tag="cgd7_550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein wtih 9 transmembrane
FT                   domains, possible apicomplexan-specific protein"
FT                   /db_xref="GI:66362560"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_550"
FT                   /db_xref="GeneID:3371914"
FT                   /translation="MDNQHSETLLGTLREKYENSAILSLSSLFIFITLCNMFIMYRLLL
FT                   DVIPYPIGVTFSQLLVGMMLAYVLGGCDLRKVKDETLSRFSEYAVPVGVYLLMFTIANI
FT                   LLKSTPVIAVYPCILALAVVLHHIFRYLFCDQRNLLSFKTVLITALSYIVACFDTNLVP
FT                   PTLLGLSILYAISSAIFRAVCLEKALHVTERDANKLYNVQVFCGVFALLFATIIFEPEF
FT                   FLSVQSKSFSEFILSIGCLVTVGTIPFVKNIIANKLVTIGQQAPWRFSEIVSVALFFVF
FT                   GVIFFECDITITIIISFILVISGRTMSMVDIINNDNKRHSGSHHKKRHAPKNTLAFNDV
FT                   HEDTAAQIADPPMRDMSMQDSPNGYEGDHESEMDHEAINEQGIIDQDDVDPESGIVQNE
FT                   NEE"
FT                   /protein_id="XP_628246.1"
FT   gene            complement(<131121..>133115)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_560"
FT                   /db_xref="GeneID:3371867"
FT                   /locus_tag="cgd7_560"
FT   mRNA            complement(<131121..>133115)
FT                   /db_xref="GI:126652186"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_560"
FT                   /db_xref="GeneID:3371867"
FT                   /locus_tag="cgd7_560"
FT                   /transcript_id="XM_001388331.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(131121..133115)
FT                   /locus_tag="cgd7_560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126652187"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_560"
FT                   /db_xref="GeneID:3371867"
FT                   /translation="MKVETPQIIWHSKDSKFADRVYSLDFQPGTSRLATAGADEFIHIW
FT                   EITREAEWKLKILSRLLGHEKEVNCIRFSSSGELLASGGQDDSLCIWKPTTEKQQVAFG
FT                   HNSEDVLGFPEYWKRITVMRCMAPVISLSWSPDDCKVVVGTEDDRVTIWNVYTGKLLRQ
FT                   LDAHTHIVMGVSWDPKDEFIASQSSDQTVRIWKSKTSKTKKKNKSITNSNSNINDTKIS
FT                   PKEDVEMEINNKMGGNSENACTEINVHTGMEMTSCTTNYGEQQPKEEAGIESQNITSGT
FT                   PVLLVSPSESSTPVCDLGIVQNAASQQTNKSDVKSWKLHHTIKYEVLDNCSKQKQSNLD
FT                   IDMNSELVIGDCATPNNNKLSSSNSNIKRRCLFLAESATTSFFRRLDWSPKGEMLVVPT
FT                   GQYLLNQETDSDNGDNKNNQILFPVSYIFLRDEYSFPAAVLPSPDGTTSSIRFNPVTFC
FT                   PLKSSNTSQNQFFFKRITPQGGEDSWIFSKNGNHGEIAPRYIFSVITLAGTINIYDTQH
FT                   FHPIVCIRGLHFQGMNDASWSSDGHTLAVASSDGYITIIFFEDGELGEVLIPSSVPTNT
FT                   SIHSTIIEPKEKISQNSENDENIDQNSFKNNENVPIPINDNPSSSAVSEKITAFSDNIS
FT                   TSDQVDNQIPLPAKTKRRIAPTVLISYDS"
FT                   /protein_id="XP_001388368.1"
FT   gene            complement(<133658..>134830)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_570"
FT                   /db_xref="GeneID:3371915"
FT                   /locus_tag="cgd7_570"
FT   mRNA            complement(<133658..>134830)
FT                   /db_xref="GI:66362561"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_570"
FT                   /db_xref="GeneID:3371915"
FT                   /locus_tag="cgd7_570"
FT                   /transcript_id="XM_628245.1"
FT                   /product="protein with 2 TPR domains"
FT   CDS_pept        complement(133658..134830)
FT                   /locus_tag="cgd7_570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 2 TPR domains"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362562"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_570"
FT                   /db_xref="GeneID:3371915"
FT                   /translation="MEKLEDNSTNSNAPQMITTDEGSVGGVSLYEEDDDIDWEVNPEAV
FT                   KKLVEKYQGEEFPLFMGEDVLDPNNPHIQALQALVYDDETPESLARQFRTVGNEYFQDG
FT                   KVRYKDAIIAYTKGIEQKSTDKETNSLLYSNRAHVYLLLKRYVDCVDDCRASLKENPKN
FT                   VKAAYRGCRASMCMQLYRQALNFALHGLKYEPENPELLKLKSQLEERLSEIEKRRKERE
FT                   ELEKRDGGKNESLQKRDNILNERKYVLGEAIYDVIHTYNHEIKCLKNELVYPILILLDE
FT                   PMLCEFICEAKESSTLGDHLKVMFPKDRTLPWDTNGRYNWETVSVFYEPGPPHHNTVWE
FT                   VSIEKSIREILDVVRYIPKIPTIHIIAKNSTCIEEFSKITYNVVRDPLLI"
FT                   /protein_id="XP_628247.1"
FT   gene            complement(<135278..>138445)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_580"
FT                   /db_xref="GeneID:3371916"
FT                   /locus_tag="cgd7_580"
FT   mRNA            complement(<135278..>138445)
FT                   /db_xref="GI:66362563"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_580"
FT                   /db_xref="GeneID:3371916"
FT                   /locus_tag="cgd7_580"
FT                   /transcript_id="XM_628246.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(135278..138445)
FT                   /locus_tag="cgd7_580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362564"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_580"
FT                   /db_xref="GeneID:3371916"
FT                   /translation="MGLSGSSSAENCGIGNVKLRCDGKSRKESVSAGNGGPSRIVSFYE
FT                   ELNEYLDLEFLAEDIEESNILSELGESLKRGKSHDASLVSVLNENTREEIKPELMRSGT
FT                   YNIGSKAFGCECSRSSSGRSGRKLRNFLSSELYIQIPDDEHKKLFQGGIAGGNRVIVGK
FT                   DDLIDTAMRYICDTEKNTCLPLFPSSLYTSNITCNSWYSLTGFLENGISFEVPEGVEAI
FT                   SLMGYSFSVEDSDIRRSANLHTLSLLENLRLVLREKKIAKFTIIKPQVWFKRTEESLSQ
FT                   LEEENLTKTSVVSTNKDFHHEQQDRFYFQGIIYCSILTGTVSLVEGKAGIEVWWSFEGS
FT                   VSSLPNEAIKLPLVASLDIGISKLENWLFNETVQHPETWVPFFVPQKKLGNSTPIWVHK
FT                   LEKLLLNAQILWKCQYLIKSLNTYNSCLLALAGTNSIEQDYKTGASLVLSKFINEDHIT
FT                   IYTVCFSELITQFESWRVNHRITSDYCMEMMSLVCLSSLLTSESLLKTMLGLKEFGFEL
FT                   KLAISTQEESPFTGTKATEDILTGRFTSVISKILLLRGLSLRSLLNYNTREFLAQHLRS
FT                   KIQSLQTNGSEKVNLKESFNQILDIFEKDQVFENAIQTFITGLHLTNHLLLERSSSLVV
FT                   RETILSAMLFFAEVDRNITFAKMIGKKLLTDKLKVAEGEAVKDISWKEISGIDILFNLD
FT                   KISGSVDALSCQIEEEVIPLFVVFDESMITENNLLLSQRLERVFESIQIQVHVLRVRLS
FT                   PAFINFLLPKAVDEVKEELYSLRKGAFSRFQDDKENNGGMIFENCCQSRSYTDSNNNNY
FT                   LQETETFRSGIDSVQKRIIEKDQEIQQMISPSFSNEDNSPKKELKKTSISSMIFSVAKS
FT                   LISRERSIGFAGIQCCNTDRTDFRNLLDLADSNSIGGGIYNPPTWSISERNINQKIPTE
FT                   KSNYMISHKKTDKLEELIFDWIKLRCWNFTDSDLRWIDGCKYIGGGEFETALMQLSPDL
FT                   NIEGVAKRILQEVDHSEVRQSLRHITFDESSPLILVRNHVFPYGELLLPNPQVSKLINA
FT                   VRSCSFR"
FT                   /protein_id="XP_628248.1"
FT   gene            complement(<138942..>139628)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_590"
FT                   /db_xref="GeneID:3372004"
FT                   /locus_tag="cgd7_590"
FT   mRNA            complement(<138942..>139628)
FT                   /db_xref="GI:66362565"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_590"
FT                   /db_xref="GeneID:3372004"
FT                   /locus_tag="cgd7_590"
FT                   /transcript_id="XM_628247.1"
FT                   /product="Ser/Thr protein kinase"
FT   CDS_pept        complement(138942..139628)
FT                   /locus_tag="cgd7_590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ser/Thr protein kinase"
FT                   /db_xref="GI:66362566"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_590"
FT                   /db_xref="GeneID:3372004"
FT                   /translation="MRGQWRYILLYCGGDFQESGLAPLIATTGTKYSHPKYKIRHALAL
FT                   ITPYCEYGNGISLIKNLSGQRHIYYYTCDLLHYNLLLIIKALSFLESYEIFHGNIKLSN
FT                   IYVNATGFILLLGDFMLPLRIKHWFIEIMKKNANIPLNVSPELRYALTKPNYKTYEDFE
FT                   KEVDLHKNDVFCLAMVFLSLSLIYEPKEKDYKRLRSFVKESLLKLAADPAWSAGKFLKY
FT                   QQWFLC"
FT                   /protein_id="XP_628249.1"
FT   gene            complement(<139792..>140166)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_600"
FT                   /db_xref="GeneID:3372003"
FT                   /locus_tag="cgd7_600"
FT   mRNA            complement(<139792..>140166)
FT                   /db_xref="GI:66362567"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_600"
FT                   /db_xref="GeneID:3372003"
FT                   /locus_tag="cgd7_600"
FT                   /transcript_id="XM_628248.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(139792..140166)
FT                   /locus_tag="cgd7_600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362568"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_600"
FT                   /db_xref="GeneID:3372003"
FT                   /translation="MRNLRSATLLFRWDKKSLPPDLHRLDAPWIHLLKVQVQRDKDLQN
FT                   WIQKQWDDSRDKFFKSRGLKPPKRKKTIEQAIGTSEEKAQVNDKTKKKKGSKSNDDTEG
FT                   SDKPPQVANDDMRFAAKMVS"
FT                   /protein_id="XP_628250.1"
FT   gene            <141138..>142982
FT                   /db_xref="ApiDB_CryptoDB:cgd7_610"
FT                   /db_xref="GeneID:3372005"
FT                   /locus_tag="cgd7_610"
FT   mRNA            <141138..>142982
FT                   /db_xref="GI:66362569"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_610"
FT                   /db_xref="GeneID:3372005"
FT                   /locus_tag="cgd7_610"
FT                   /transcript_id="XM_628249.1"
FT                   /product="apicomplexan conserved protein"
FT   CDS_pept        141138..142982
FT                   /locus_tag="cgd7_610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="apicomplexan conserved protein"
FT                   /db_xref="GI:66362570"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_610"
FT                   /db_xref="GeneID:3372005"
FT                   /translation="MVESLVEFDYLRYKDGPDIPVVENPHYFTLIRFLGLISNTSMAID
FT                   WTFEDVQAMFEKEELTEYSRNLHLKLLGFLGKRFPPHVTLERNLTKFLDERPIDVSVIF
FT                   WDKMSFNADNQNKDLDENREDEDLKEVKSEEVDIEGNDSSKPYKEESELLDVQLYNPYR
FT                   DNEYKNVQSYERLRTIRILLNTCIQESKQLRNIFQGMENYSMKCKNVKPGECFFGLSPP
FT                   YVGDDQLGHHYWYINPPNDEVIFKLYRESSLTGELTLLSDNSDTLCSTFKTFLNSEGLQ
FT                   EIGQKLEIKYNALVVAEKAKLRKIRQMRSIRNQLESSWGNCAPTDEMLSGGRTKRKAAM
FT                   NIDYSYSVSENATRRSSRINKNGYDSDSLNHEQSSTFNNVVKDRSDRLALRNAKKQQIE
FT                   ESEKDLDESTEDSSQTYCSKPEINPDPADNDLTNSSQTPVLPPLLNLENKNYTTQSSSY
FT                   TSNSSTQDINNNLNSMIGSGILLDTQNHHPSHMQSIDLAPKYVSMQFPSGVIPVLPSPS
FT                   YNFSSSLPAFNLAQVQKMPQLTQISQIPQISQMPQISHISQVPQITQVAQMSQIPSFQT
FT                   SSTVPNSPLITANGNIPTITNFPNPGTPNIQPEQYSKN"
FT                   /protein_id="XP_628251.1"
FT   gene            <144638..>145849
FT                   /db_xref="ApiDB_CryptoDB:cgd7_620"
FT                   /db_xref="GeneID:3372006"
FT                   /locus_tag="cgd7_620"
FT   mRNA            <144638..>145849
FT                   /db_xref="GI:66362571"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_620"
FT                   /db_xref="GeneID:3372006"
FT                   /locus_tag="cgd7_620"
FT                   /transcript_id="XM_628250.1"
FT                   /product="Sec14d domain containing protein"
FT   CDS_pept        144638..145849
FT                   /locus_tag="cgd7_620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Sec14d domain containing protein"
FT                   /db_xref="GI:66362572"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_620"
FT                   /db_xref="GeneID:3372006"
FT                   /translation="MSGIKKSMIDEFEFNSSPLYGEDLSDQIYNYSYEEERDKHSNNTT
FT                   STREKNENVNLHIQKGGIRTKTVKEVKQLRNMSEKLQRYSYKFSPIDNTVDRELTRSSW
FT                   TREEIALFCLRSMNNNVKKAIKSYKCFTTMMCKFNSKNGNEIDIYNPTILSQLRSGKVV
FT                   IFDKLDLHGRILVIVNLHHHDPRLQTVDDLILLFVFVLELIMIENPHDYAAERNGISVL
FT                   INASKIGFGDFRIEYCTRIIQLLKKNFPIKMGQVLIFKPNRLIKLSIKLALLTKKKIKR
FT                   KIQIINKVFEPLDSITDFDALSHFIDRKYIPEEFGGNHYFDFNNFWELKYQGHMLAELF
FT                   QKRGASIKIQEPTKMLTNEKIKNDSKDKGKKKKKKDCKVSSINEKDRLILSNFYYSKTS
FT                   FDIN"
FT                   /protein_id="XP_628252.1"
FT   gene            complement(<145999..>146946)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_630"
FT                   /db_xref="GeneID:3372007"
FT                   /locus_tag="cgd7_630"
FT   mRNA            complement(<145999..>146946)
FT                   /db_xref="GI:66362573"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_630"
FT                   /db_xref="GeneID:3372007"
FT                   /locus_tag="cgd7_630"
FT                   /transcript_id="XM_628251.1"
FT                   /product="Ym1014wp-like, Ymb4 methylase"
FT   CDS_pept        complement(145999..146946)
FT                   /locus_tag="cgd7_630"
FT                   /gene_family="HOG000209191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ym1014wp-like, Ymb4 methylase"
FT                   /db_xref="GI:66362574"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_630"
FT                   /db_xref="GeneID:3372007"
FT                   /translation="MGRSKNKIICNIKPSDKECRPLTCSVPEMLDEKGNILEDKCDELE
FT                   NKYVHEIYETMAEHFSHTRGIPWPKVKDFVSSFEPGSLLLDVGCGNGRFMDCIKDSKVC
FT                   FMGTDRCKSLLGSAIARNPDLQVFVDDCMRLNVRSGTFDGIICIAVLHHLSTPERRIQA
FT                   VSELIRCLRRNGTLLIYVWAFEQKKGTVGSRDFSSKDTMVPWHFQKKYAKDEKGEEIQE
FT                   CTLDQFREEKNNYHKEAGAPGNIVKVSPEKYLIALQRYYHLFEEQEIVEICNKGIEKYR
FT                   ENTKCEKNCESDENVTIIETYFDCNNWAIKIAKN"
FT                   /protein_id="XP_628253.1"
FT   gene            complement(<147407..>150535)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_640"
FT                   /db_xref="GeneID:3372008"
FT                   /locus_tag="cgd7_640"
FT   mRNA            complement(<147407..>150535)
FT                   /db_xref="GI:66362575"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_640"
FT                   /db_xref="GeneID:3372008"
FT                   /locus_tag="cgd7_640"
FT                   /transcript_id="XM_628252.1"
FT                   /product="Prp16p pre-mRNA splicing factor. HrpA family SFII
FT                   helicase"
FT   CDS_pept        complement(147407..150535)
FT                   /locus_tag="cgd7_640"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Prp16p pre-mRNA splicing factor. HrpA family SFII
FT                   helicase"
FT                   /db_xref="GI:66362576"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_640"
FT                   /db_xref="GeneID:3372008"
FT                   /translation="MLPDGRGQIKGGGRDGGQGRVWRGRSRYSVNEQTWNREGSSLTDY
FT                   RRESKFHEKEQQSQPPQEYFQQDRIWYDSYEDGGSASLNDHLGFESGLLLYGEGALGTH
FT                   RNQTESMQGLGKPFKRKRISQKKIQGNIDNERWELSRLGGSGIGLGSEIIERKETLFLN
FT                   DLEFDEKNNKKIHIIVDRTYPKFLKSWELNTIKSQLESFKGDPETENDEVNTIKDKTSD
FT                   IAKLARTGSSILKTLRLKENKVKMRQRFWELQNSKIGALISSDKSHSIEENSIYSQDGP
FT                   KEGKYDNSKQSFGDLFRKSKDISENDSRQRMLMTRRSLPVYKVRDSLIKLIGEHMVVVV
FT                   VGETGSGKTTQLTQYLHEFGYSKRGIIGCTQPRRVAAVSVAQRVADEMNVDLGKEVGYT
FT                   IRFEDFTSKSTVIKYMTDGVLMRESLSDPELERYSAIIMDEAHERSLNTDVLFGIFRSV
FT                   LSNRRDFRLIVTSATMDSEKLSSFFGNAPIFNIPGRTFPVEIEYLRYFPDDYIDAAVRQ
FT                   CLKIHCTNPLSLLENKDNSDEKQKKDGDILIFMTGQEDIEATCILISEKLENLMIDGAD
FT                   PLMILPIYSQLPSDLQAKIFKPSPYRKVIVATNIAETSLTLDGIRYVIDCGLCKVKVYN
FT                   PKIGMDSLQITPISQANALQRSGRAGRVSSGICYRMYTEQTFLADMLPNSVPEIQRTNL
FT                   SNVVLLLKSLGSEDVFSFPFIDPPSSSSISTSLYQLWSLGALDDNGSLTDLGRQMARFP
FT                   LDPPLSKVLLTANKLDCLIEAIVVVAMLTVPSIFYRPKDRLEEADASREKFSIPESDHL
FT                   TLLNIFIQWKRHGSNVRWSERHFLHQKALMRVEEVFNQIVEIYSNIMSMETMPRIDWKP
FT                   NPLCWDNLRKAFCSGYFHNSAKIRAIGQYVNLSTSVPTYIHPSSSLFLSGVNPDYLIYH
FT                   EVIITSKEYMNAVSAIEPEWLNFYAPHIFKLNINDSNKEDLLSLNDSSQINDQKPDLEE
FT                   PENLMNVFRENDLKVDVQSLSAFENSQQEVFERPSRKIRSKNNKHALSFSFGE"
FT                   /protein_id="XP_628254.1"
FT   gene            complement(<150842..>152836)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_650"
FT                   /db_xref="GeneID:3372009"
FT                   /locus_tag="cgd7_650"
FT   mRNA            complement(<150842..>152836)
FT                   /db_xref="GI:66362577"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_650"
FT                   /db_xref="GeneID:3372009"
FT                   /locus_tag="cgd7_650"
FT                   /transcript_id="XM_628253.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(150842..152836)
FT                   /locus_tag="cgd7_650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to cyclins"
FT                   /db_xref="GI:66362578"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_650"
FT                   /db_xref="GeneID:3372009"
FT                   /translation="MMDNKVAFSQNEYIGGVNQNIGITGEKAQINAQNSSSMNNNNNVG
FT                   GSKSFSTCRRWMISGRFQDILPKESLTMSLMDWEDLYRRERLAQVHHSIYTTSGCFLQL
FT                   DQRQLVMSWISDVAHRLAWEKSTFHIATSLIDQYMFCLERDPVSRRKLDRSSLAATFAA
FT                   AVVTAASLGECLGECHDRKHCPGLPPLHRFVQSSGIIRSSRDIVEMQIQLLVQTSRYGG
FT                   PSLLNKTPAHMTLHYLSRLKHLMDSLHNSLSEVLPDSSWPFGSQNRENFPQNITSNSNN
FT                   GKIDGSCSNVNMITGNPDEVLCCKKGACWANKIGLSTTVGQAVLGIREKINYAYLFEKI
FT                   MFAHELALYSGLNLLVPGSRIAACVLINILISYDPILQFPSHQNILYNSLCLLDYDTGI
FT                   RPFMPYLDPLVRRVISMSMESIQALENSGAGAKHAGAKAGIHLGMPLDDTCSGVILIHK
FT                   HHVIPEKLLSGLWVSNLIAMHSRMSQPNIMTPFSLSSPSSIPVSPHSSLGSVSGSPGAF
FT                   QCSSLFYSLGGSRCYVDDKTLVHGVGKGRFMGGGGGSSGSSGNFANYGIGTGSNSSGRS
FT                   GTRIQFLENSDGFSGKRVLAEGERSEIQYDSGDYKRDPVSLKLFQKHQNNGHFVGSHLH
FT                   LVSNRVSDDQHLYTTCSTATNSPLLGGPI"
FT                   /protein_id="XP_628255.1"
FT   gene            complement(<153672..>154520)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_660"
FT                   /db_xref="GeneID:3372010"
FT                   /locus_tag="cgd7_660"
FT   mRNA            complement(<153672..>154520)
FT                   /db_xref="GI:66362579"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_660"
FT                   /db_xref="GeneID:3372010"
FT                   /locus_tag="cgd7_660"
FT                   /transcript_id="XM_628254.1"
FT                   /product="cyclin; possible cyclin A"
FT   CDS_pept        complement(153672..154520)
FT                   /locus_tag="cgd7_660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin; possible cyclin A"
FT                   /db_xref="GI:66362580"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_660"
FT                   /db_xref="GeneID:3372010"
FT                   /translation="MKNTRLKKVQVIRNQKENESSTIESKHKLLSERDETYYSAMKLVE
FT                   ENMWTKWGLLKVDPETQEIQITMFKILNELGLMYQVKFVSIYLMFLMRNFWDQVLLNTD
FT                   KSFANKSHAYKNNLLMVSCIFISSNYEELDPPSYTRIVQIVYDSGFKMKSGEKIIRKQV
FT                   HILERLAWELTGFQVELPSANSFLMQIIQNSTLPKSKKFRVSKLSTEIIHNSLNTQAVI
FT                   KYKQSLIATSSIVLAITMEYEKQPEKKQVHIDEVLKYSGYSNKQVQVVRKILENLVSSR
FT                   K"
FT                   /protein_id="XP_628256.1"
FT   gene            <155285..>156220
FT                   /db_xref="ApiDB_CryptoDB:cgd7_670"
FT                   /db_xref="GeneID:3372011"
FT                   /locus_tag="cgd7_670"
FT   mRNA            <155285..>156220
FT                   /db_xref="GI:66362581"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_670"
FT                   /db_xref="GeneID:3372011"
FT                   /locus_tag="cgd7_670"
FT                   /transcript_id="XM_628255.1"
FT                   /product="t-SNARE domain followed by hydrophobic stretch"
FT   CDS_pept        155285..156220
FT                   /locus_tag="cgd7_670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="t-SNARE domain followed by hydrophobic stretch"
FT                   /note="conserved in plasmodium, transmembrane domain or GPI
FT                   at C; transcripts identified by EST"
FT                   /db_xref="GI:66362582"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_670"
FT                   /db_xref="GeneID:3372011"
FT                   /translation="MVFEIQIHDGEGENEEEEEEELSYFVSDTQRDWAESHERRIAKLF
FT                   QQLEEKQVQLEEKISESQGISKVSHDLCKKVDQIFKKIEQLNQNINDVLRSWRIELAGN
FT                   PLEYREQKNILENYLARQKVALDTIGYLSRKVEDLKSRQTTIESNSYSNHFDRFTGYET
FT                   DNRNNNYGYRLPHEDSSYEVQIEDDNFRQQQSHYKPPTLYTHQTFDMVDRQIAQETAIG
FT                   LGHIQSQMYEANQIFKNLASMVNEQGETIQNLETTIDNTVYTAKQAVGELRKAYNSSSY
FT                   KFSLIANYGLPGFLLLILALILTLYFLHVI"
FT                   /protein_id="XP_628257.1"
FT   gene            <156633..>158972
FT                   /db_xref="ApiDB_CryptoDB:cgd7_680"
FT                   /db_xref="GeneID:3372012"
FT                   /locus_tag="cgd7_680"
FT   mRNA            <156633..>158972
FT                   /db_xref="GI:66362583"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_680"
FT                   /db_xref="GeneID:3372012"
FT                   /locus_tag="cgd7_680"
FT                   /transcript_id="XM_628256.1"
FT                   /product="hypothetical protein with a signal peptide"
FT   CDS_pept        156633..158972
FT                   /locus_tag="cgd7_680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with a signal peptide"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362584"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_680"
FT                   /db_xref="GeneID:3372012"
FT                   /translation="MLRLHPNFKNLLKTVYFIPLDGGWISVLISVIGSLLLSPVLTIGI
FT                   LTTHIFKLFDIIWIKLSYLWCGERHLLLEPLNDVDYLMWRSSFYGQPLIMCFFVTDRIP
FT                   ATQMEKHLIQRIENKDAFQESTGNTKSNSNKLGSKYTSLPNHLRENKRFFCKVESSLGR
FT                   LWFKYAGNEYDTSRNIIKLTPKHARMILRMPELVIDRDSSKTLSERILDIQNDKNEIKY
FT                   DESSLTEEETKNFYNLLFNCENYQLSPKRPCWRIILLDDVIWNGVQSSILIGQFHHVIG
FT                   DGSTLTEFVKKTVLNSLETNNLKQGNMKGVTRSAKFWHQWVSGLLWAAIAGPITLLKAA
FT                   LQARPERSWDTPSKKRSKRSNKISSAGPVNLSLKEVNLVKDKLNEDLNLRERSISLSSL
FT                   QQDSISTASTSNENNPPQTENKNKSELISRKIRKNSSNPVNAIEKTKKKESHHFSKRIT
FT                   FNDIILSCIASGYSKYVNHYISIQGDSDDTSNSSTSAHSPVSLTSKNSPPVTMTPNPGL
FT                   MKEVSMLTTTTTPSSRRFNEYDKENATHSTSPFHFDDKSPYSSILKYDSITNSQDLDVE
FT                   LDFHSNSQLKTKINGLYSGSYSSYKENDLSSLCHSNLNVVVTTNNRVKPPTKLDNAFSI
FT                   IVLPIPTCPLASPSERLRCVFESLQEYRKTSLPIIFIRYIQYTLCLSPYALLCLWHPHS
FT                   KSCSMYYSSVPGPKNCSFMNKKIRDMTFALPLTDHIGLGVSVFSFDDKVSISCTFDEEI
FT                   ILDPYLLLRFIKLSFEELKAGILAKV"
FT                   /protein_id="XP_628258.1"
FT   gene            <159466..>159753
FT                   /db_xref="ApiDB_CryptoDB:cgd7_690"
FT                   /db_xref="GeneID:3371771"
FT                   /locus_tag="cgd7_690"
FT   mRNA            <159466..>159753
FT                   /db_xref="GI:66362585"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_690"
FT                   /db_xref="GeneID:3371771"
FT                   /locus_tag="cgd7_690"
FT                   /transcript_id="XM_628257.1"
FT                   /product="small nuclear ribonucleoprotein"
FT   CDS_pept        <159466..159753
FT                   /locus_tag="cgd7_690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small nuclear ribonucleoprotein"
FT                   /db_xref="GI:66362586"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_690"
FT                   /db_xref="GeneID:3371771"
FT                   /translation="LLNFLEPLDLIRLSLDEQVFVKCRGNRELKGTLYAYDPHMNMVLG
FT                   NVEETYYEEESKSDTQNSEKKLKKRRIEMLFLRGDLIILVKPAVKLGKST"
FT                   /protein_id="XP_628259.1"
FT   gene            complement(<160119..>160778)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_700"
FT                   /db_xref="GeneID:3371868"
FT                   /locus_tag="cgd7_700"
FT   mRNA            complement(join(<160119..160319,160374..160564,
FT                   160643..>160778))
FT                   /db_xref="GI:126652274"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_700"
FT                   /db_xref="GeneID:3371868"
FT                   /locus_tag="cgd7_700"
FT                   /transcript_id="XM_001388332.1"
FT                   /product="N-acetylglucosaminyl-phosphatidylinositol
FT                   de-N-acetylase"
FT   CDS_pept        complement(join(160119..160319,160374..160564,
FT                   160643..160778))
FT                   /locus_tag="cgd7_700"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-acetylglucosaminyl-phosphatidylinositol
FT                   de-N-acetylase"
FT                   /db_xref="GI:126652275"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_700"
FT                   /db_xref="GeneID:3371868"
FT                   /translation="MTIFENQKNVCVLVAHPDDEAMFFTPIIKQVCGEGNKVYVLCLTN
FT                   GDYYGLGKLREKELLEACNALGILRDRIRVVSNDKFQDQPNEKWPYTDVISEIESFVDE
FT                   FNIDIILTFDEFGISGHINHISTNESVKEWIQGSKREKYPKVYVLETSNIFIKYSGILS
FT                   LLYLYIFPKNEW"
FT                   /protein_id="XP_001388369.1"
FT   gene            complement(<161011..>164730)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_710"
FT                   /db_xref="GeneID:3372014"
FT                   /locus_tag="cgd7_710"
FT   mRNA            complement(<161011..>164730)
FT                   /db_xref="GI:66362587"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_710"
FT                   /db_xref="GeneID:3372014"
FT                   /locus_tag="cgd7_710"
FT                   /transcript_id="XM_628258.1"
FT                   /product="possible helicase"
FT   CDS_pept        complement(161011..164730)
FT                   /locus_tag="cgd7_710"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible helicase"
FT                   /db_xref="GI:66362588"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_710"
FT                   /db_xref="GeneID:3372014"
FT                   /translation="MQNERSKVINNNAKTLITVSKFYTYLNNLLIISPKRRLGIWRKVF
FT                   GEKGESKKCFVSVSGDSVMEPECFGVAKRELSILEEKGVSQRGYNSSLNDIMDLKPFSD
FT                   LKGRDIHSLSYWYIPNSVKHQYYMNYNLNRLSDWQVNTLSYILNYMVFQEDLSIEQQNY
FT                   MLATNSFQDLSPYLIISPNVNENQTICEIVALSSLLYSGGNILAIFPNPQKCDAYYQRC
FT                   KCLFGNNSLNLRIELFGQSSRTINTSWFPNIDLTICTLEKANSLINRLISDNMLNECIK
FT                   TVIVDDINFIEDPERGHLLENILTKISYVNLVSDYYIKNNNYKGKNGPLTCLYVSNGGI
FT                   PNLDIYKNVLKVGRIFENHKYEKECEPDVYIKRGNSLYFWDKLKYNNQSLNENEIFEII
FT                   EIFKNDKNNNIFQQTAISDLKYFSDLILESLMNNKKALIFCPTIEWCRKSLQIISMEIS
FT                   EILLNKENNITSTQKNLINDKFGSFLSQISQDKPYRIEMIENLKRVTKDGFHLENDFLL
FT                   LDGILNYGIAIHNSKLSFKERKLIEDAFKNNHLKVLFCTSLHMMDSEIKADRIIIRSIG
FT                   LGKINNLTKNKTGNREWISKNTLKQFFNRISHCKTDITAKSEMHASSNTCTLNLAGTKG
FT                   FKRGIFIFTGNDLEFKYLNDMLNESDFQSLEFKSYLSELNLFRLILELIQTDLVRDLRG
FT                   LELLISKLTFRGNLEALKSHSVLDTFSKDHQKLLQNSQEQGLNKDILLSLSFMVMNQLV
FT                   SFDSGKDNYNINEISLSDKYVHQFQDKFEHLKSPIISSKYALIGLKTRDKLNKSILNII
FT                   LRQNDFLTKLGSGKKYLLSFFNSIGGSFISDYQIFGTCLANSIIKLQLHPCIILEVYSD
FT                   LIKSKLIGIDLSNNLQIFILGLLAYNGSHFKVNWNNYLQIFSELTPGEMEIADFNGINF
FT                   KVISEISRTVTSNPNLIPELNKLSPISIQLSYFYSETLNFKGMIEKYRLISIYRFYYAC
FT                   FLKDLCNPMITFELIMAKYSLESTTIRLIINSFNQSINVVSNLCKSIGWLELAEIILNI
FT                   NNHLKSSVSIRNIKYLYKITQEQNQYQTTYSNTNHSIIGSKALQNYHYLDQQDISRIMN
FT                   YVNSIISLSHNITPNIAISLYFSGLNCIENISTASTETLLRAIQNASKLDDYFGIFSNK
FT                   PPESNLNLIVICQEIIQQAKKALSKSDNTQDLDSLSNSDNYTENHEIDIDLNDLDLEFD
FT                   QDLGEILTTKSKAL"
FT                   /protein_id="XP_628260.1"
FT   gene            complement(<165418..>166512)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_720"
FT                   /db_xref="GeneID:3372013"
FT                   /locus_tag="cgd7_720"
FT   mRNA            complement(<165418..>166512)
FT                   /db_xref="GI:66362589"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_720"
FT                   /db_xref="GeneID:3372013"
FT                   /locus_tag="cgd7_720"
FT                   /transcript_id="XM_628259.1"
FT                   /product="PASILLA splice variant 3-like 2KH domains,
FT                   transmembrane domain at C-terminus"
FT   CDS_pept        complement(165418..166512)
FT                   /locus_tag="cgd7_720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PASILLA splice variant 3-like 2KH domains,
FT                   transmembrane domain at C-terminus"
FT                   /db_xref="GI:66362590"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_720"
FT                   /db_xref="GeneID:3372013"
FT                   /translation="MVNSSNMERTNYINMQSDEEQIIFVKLLISDKAANRILSNSGSIL
FT                   KKIKQVNHVFILVSGTNKYFPGTNYRVATLEGNEKNVNETMEVLDFLLKNNKDDGQEGL
FT                   KNYEYNIRLAVPRSVIGSIIGIKGEFISHVRTATSAHINISPIFVTSEKACNERIITIS
FT                   GSNSNQVIHAFIILTKKVNSSPEGRSCKSVIYRRADFFRRKNHKTEHEKVDPLLSSQLE
FT                   EMKNVLNENPINSAYEVESRSLEIKERPKLNFKTTSKGRWSEQVDLLAREEDKSLEKLG
FT                   SELKQVRIIQKGLIEGAQINISQKTELANDDNKMQENLAEKLYEAPSKTVQERIPTNLF
FT                   IISFLALITGAFFLQYISSEVIRV"
FT                   /protein_id="XP_628261.1"
FT   gene            complement(<167286..>167726)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_730"
FT                   /db_xref="GeneID:3372015"
FT                   /locus_tag="cgd7_730"
FT   mRNA            complement(<167286..>167726)
FT                   /db_xref="GI:66362591"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_730"
FT                   /db_xref="GeneID:3372015"
FT                   /locus_tag="cgd7_730"
FT                   /transcript_id="XM_628260.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(167286..167726)
FT                   /locus_tag="cgd7_730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362592"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_730"
FT                   /db_xref="GeneID:3372015"
FT                   /translation="MDISCMILNEDFTGIQQNTLDKYLEVYKQFLDLIPNNFHEHIEID
FT                   DILKNIKSINQECIPQSNITKTKFNILTRNISKKYFGDWRQVDSENLCVGTEKKSNNYI
FT                   FKPEKEYNIENVLKKRFLFWIINNYENQRIPNLNSFNQDSIL"
FT                   /protein_id="XP_628262.1"
FT   gene            complement(<168067..>172224)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_740"
FT                   /db_xref="GeneID:3372017"
FT                   /locus_tag="cgd7_740"
FT   mRNA            complement(<168067..>172224)
FT                   /db_xref="GI:66362593"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_740"
FT                   /db_xref="GeneID:3372017"
FT                   /locus_tag="cgd7_740"
FT                   /transcript_id="XM_628261.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(168067..172224)
FT                   /locus_tag="cgd7_740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362594"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_740"
FT                   /db_xref="GeneID:3372017"
FT                   /translation="MSLNEKSIKELLNELVKIQVKNHLQNINNEKNHENLIKRIEDKVW
FT                   TTILYNKTKKKSMEDSDYINFVDSTLSNIVVQSRIRPESMDNMNMIIDQRSKLVETQMF
FT                   CFLPLFILSHNIIKQYYQSSSGSYILHMMFILIGSLDYYNLDFWKNQCLVKVYHSDFTW
FT                   RLNSIMQRNLSDSVTKDAKENIELIFDLKTYLSTFSSLIFKSIAFNKSNMDFWMDLISD
FT                   FALGIVTFKNLASNLYLNEESLFNNELTQLAEDMGEIEISRETNKIAEIAFGNDNFHFT
FT                   DNDITKGTESKNSIIPKKIISVEQNSTNIRKNRNSLLASFMGNSDDELDELEELEFYQE
FT                   YKFSKEEEGEKEEEEEDIEEEVEELKIFDNQQSQIQNQVSAKSKRSSSIINMERNKNEK
FT                   FVDSKSLNLSSFNYFDGLSKSIKEKKDEAEDENYRICNLSKVKLPNLLRRVSGRRQIQY
FT                   NNKYLGFSWDQQYLSLNKTNKIFNESILSVLTTERIKNCTIVSPNNEISSTDGYIWVKL
FT                   DSLMKLFQGLDSEEFSLYPKYHRVREYKKTELLECYTIFIDEYNISLELVEEFGELSPW
FT                   MNNYYQGDKFIYTRTGTNIKKNDILGPQSDFMNTKSCRDEQIFLSQDLVSMICLFGTKV
FT                   HYLRSLAELLIMLGDMMNDQQKLESITKNEYLKCNQISIEESMVSIKILGKVIFELLHM
FT                   YFGDIELCFSKFNYGNDHISNLSSTKTSSYLNLIALLDEFSPSFEILVSIFKLRSYSGR
FT                   EETRTWKIPHGYSLLSYIYTYLWQFQINPYYIISNNYFINIDGRKDINNRIDKGIYSSG
FT                   HILSVIYKNLQRGIFKDKLDYITSNKESNNLELKLKANLSLNKSILRLVVPVLLRILMI
FT                   KRISFNKTFQVTGRNHGNMALAKTIPLEKQDLSMFFSDINVFTQDFKFNNKIYIDLNSE
FT                   SELDVHDHDHDAELPRVPVPIKNFQETENIKKITQIAIMEYLKKNQLDFNKVYEIYFKS
FT                   LDQAFENIIGLEFNINEYIDLAFEIGGLLADKSYQRNEYNIGISIQEEFESLKELIQDK
FT                   VKKKKFILTSQCDLVSEERGIENLKLRENYHTAYTKQLNNYISVNGCLQYENLIKLVFG
FT                   LDLDLSKYFKKQINISEVFSTFDIQKIGKEQGEEEFIKLFQIIVLLETISKRFINLKNF
FT                   VGRIALYIWCRKYTTDYNLYIKFSQGYLYDSFSEELQKLIWDIERNISRVYSTIQVIQE
FT                   YLVMLFRRFDLKTITKSKSYGSEVSYEDYNYDDKWIVVQKYYNGKLLNNLSLSEKGFIY
FT                   FITCLVCQICLVLSDLLSKTDSFRDPPKRPSSFSPKISENQDQSDNQRNVILEFVNNWK
FT                   SNCLEEKVSQYFTVYKSLKNYISGNKNIFSTENSHILYYINS"
FT                   /protein_id="XP_628263.1"
FT   gene            complement(<173025..>174167)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_750"
FT                   /db_xref="GeneID:3372016"
FT                   /locus_tag="cgd7_750"
FT   mRNA            complement(<173025..>174167)
FT                   /db_xref="GI:66362595"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_750"
FT                   /db_xref="GeneID:3372016"
FT                   /locus_tag="cgd7_750"
FT                   /transcript_id="XM_628262.1"
FT                   /product="hypothetical protein with signal peptide and
FT                   transmembrane domain near C-terminus"
FT   CDS_pept        complement(173025..174167)
FT                   /locus_tag="cgd7_750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with signal peptide and
FT                   transmembrane domain near C-terminus"
FT                   /db_xref="GI:66362596"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_750"
FT                   /db_xref="GeneID:3372016"
FT                   /translation="MNLWVLRVIWLDVALLVGRVFGITGDESSVLFPYRNPKVGVIPIS
FT                   VGNGSGDLIVRIWEENVRLEWERSKEERRGECLIIGKGVSCGDFDCKKYMNDEQGVAKV
FT                   CDYLEFTPENKWIPSFIDEDLPICRIFNLGSIAGIRNTLSEYLFNSPRACLCNGEKKSE
FT                   NFKILSPSVSGDDIGGWKFEIFKDNMEIPKIYPFNRFIVDVRVLVNPGWNLEFVLSSSS
FT                   LQISKAAFSIVSLKKDYLCQGFPEDESLKILQPTKLSPKGSHIIQTYSWSPSKSNGYLK
FT                   DGHFDYKFPVNHQTTTHYYLCYYHHYNSNSGHLLGNVYFRLNPEDATQTFSLILLIIIF
FT                   TPLIFFSIHIIISSKFKTSIEKLQGYILFEDRNKVSSLFF"
FT                   /protein_id="XP_628264.1"
FT   gene            complement(<176213..>178285)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_760"
FT                   /db_xref="GeneID:3372018"
FT                   /locus_tag="cgd7_760"
FT   mRNA            complement(<176213..>178285)
FT                   /db_xref="GI:66362597"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_760"
FT                   /db_xref="GeneID:3372018"
FT                   /locus_tag="cgd7_760"
FT                   /transcript_id="XM_628263.1"
FT                   /product="bruno-like protein with 2 RRM domains"
FT   CDS_pept        complement(176213..178285)
FT                   /locus_tag="cgd7_760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bruno-like protein with 2 RRM domains"
FT                   /db_xref="GI:66362598"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_760"
FT                   /db_xref="GeneID:3372018"
FT                   /translation="MDNQSYRDVTDSRAFWISDKKCQGFSKGDIGGGRHMVSDLNCVSQ
FT                   ALFNRSNSFPASFCSNNEESYFVNFDQITAMGEDQLNPFVESIRDANTLFLDDNISFIG
FT                   SKETDSYFDNTSKYQRSVTMDFSNNSKYPGICSYYPRSINSVNYSRSNSDLARFLENKD
FT                   ELETYNTDNSLTRDSSGSSTESTGRFIYGSSNGCIEYGNIEGIVDSKHPHYCGVNMVRG
FT                   MSSPKRERFIRQSDSLSSLTSDQLKDIGFINKQNNKRRSKRGYAPVKLFVNRVPKHMTN
FT                   EELLKIFNKYGLVVECNIIRDSNGPKGCAFVRFSNIYEAQNAILCIHGKTVLDKEVGPI
FT                   QVKYADGEIERLGLSPDVQPCGESVKVFVGSLPKNCTEDQLLLLFKQFGHVDEVHIIRD
FT                   NNKQSKCSAFVTFPRKFMAENAIMFLDKKYIFDNSKRPIEVRLAKSRAKQKQQQQQQQQ
FT                   SQNGNNGQSGSLSPNHSDFATGNMGFGMSYNKKSCGGSSSGVQAMSLRGGVDLFDSIPE
FT                   TTSQQMQFSNIPNSHHNADVAIQNFVIGHNLNHGHYLSHQHQHSSHRHGNQPKVTSNGT
FT                   SNTNTAINITNTASSTSSSTKSKPNTNFSILMGMNSSMSNRIDSTPNVIHNTRNLDHQM
FT                   NQEHINGHKRGIHMGTSHSSLISDSCYKGGPNNEDQIKFTPPTLLDFWTKPILNI"
FT                   /protein_id="XP_628265.1"
FT   gene            complement(<179181..>183545)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_770"
FT                   /db_xref="GeneID:3372019"
FT                   /locus_tag="cgd7_770"
FT   mRNA            complement(<179181..>183545)
FT                   /db_xref="GI:66362599"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_770"
FT                   /db_xref="GeneID:3372019"
FT                   /locus_tag="cgd7_770"
FT                   /transcript_id="XM_628264.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(179181..183545)
FT                   /locus_tag="cgd7_770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362600"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_770"
FT                   /db_xref="GeneID:3372019"
FT                   /translation="MPKTYRMNQNGSSGWKKLLNCLSICLGLSLIGRCLSKNYEFTNKM
FT                   TLYYSPIEGFINKQFDNKTQELENLKFIIGEPWEGFEIAKVQLNSSSINNDTKTMESLD
FT                   GKNNVVFGKYKKLEINYPLGSKKKLIALQNCKTGVTALINYSPMRIKTEFSIYLSFGSN
FT                   IDPINNQGLTYLMGFIFLNMASEVDNYLFNSGEYIEKQKDNSLTSVTVSSLYTKLTVTV
FT                   SDDKAIEALKRFINSVGYSGNVDNMTSTSKNDDGEFYIKNRPLTTKNLLNSLCRLYYIY
FT                   KSCLRDEEYRISFIKTSMRAIDPKKSKEEESSSFGSSDKVEEDLVSDYFSNCGIFSTYW
FT                   QKYLNFFSTSSCSFQSNIIEANLSSSLKDWLHELKQLIKEHYEKYWLPENMNLYIDSAL
FT                   DYRLFEKLLASEMATFSSECDNKGKLFIENDLFMQEIEIKKKYGRKLEESKNQGFDENV
FT                   DLNDRKSNKTIKIFNVVPLSYKKSVLDIDYKIKLKNISQLVSISLTRVMDVVTTLFLDS
FT                   KMVKRLRDELGIIRDLKLTWRLHYSSLKLRLIFRFILKSMEVSNARKVMEDFYSYSIFL
FT                   FRQFERTNGRKKSNPEFKVSKELFDIVDEIQRLNEINWHLQYLYEDLPTQLTTPINNCG
FT                   TPIQVSQPNNLESNWIKNEIRIYNPLLFKNYPQLILSSIHRSLTRLPKECDIMKRKKCN
FT                   CYRTDHSGKISKANSILDTGSIVFVLMEFIIKKIVELKANVIFTDPYFRYRTDFVLKVR
FT                   AYNYHEYVNLQFSSYYQKNNLLKEDFTDFTNSENWTLPERIVNFETSMLIPDYEYYKNS
FT                   TAINRQLSYPRISYKNELSLTTRLENFKFYSPIVFVRSIIRTKLSPCKIFKDCFCEVDC
FT                   ISKRHTGLIMLKILSDIFNISIEKFLESEPIPGYMNILEKLSHNSSTKYGNWRISDSLT
FT                   KPFHFGSIMIGNNEIELNFVGPSCSLIEYMRKIFKEMNSRFKPLKIVKFYQILRNFMKN
FT                   EIKRRKNRTPMDFIRYYQGILQYEDYFEDESFITTGISITYDNYLSFHNYIIDTLFNKD
FT                   SDRPRQKGFMETVVLGITSDEFNKRYTETILDWIYFEKPDSYKEICMLQEPYFAFSAGD
FT                   EPLIIRQTFTDGILTTSSASIRFQLPCNKNSSTGFNSSLSDNDIFFKDEKEYKWETNDG
FT                   LQPRCIFNTVASRVLERILRKYFSSIVRKLVLEMSQSHSNNTNLPPNLNSNFAVRGEVE
FT                   VSFYRLNSIPQFTLYILSSHFDSFTLLSILNSSIKRFKTDIIDSEEVLSEEEFSSVKSY
FT                   FIRYYCIKEKIQIRNLRASLLEMSKWRYNYNWKHESCNLIRTLKKKHIVQFYYDYFLMD
FT                   SPYRRSYILLLQAPPFNRLISYSKQKGTSIDPVSTVFQNYIVSLLGKCDKADYYRQTNT
FT                   TKDADWNISMLSYPRILQSDIGILDYKYKNIKKYQPRCSKFMLEAINTEKQN"
FT                   /protein_id="XP_628266.1"
FT   gene            complement(<183951..>185426)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_780"
FT                   /db_xref="GeneID:3372020"
FT                   /locus_tag="cgd7_780"
FT   mRNA            complement(<183951..>185426)
FT                   /db_xref="GI:66362601"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_780"
FT                   /db_xref="GeneID:3372020"
FT                   /locus_tag="cgd7_780"
FT                   /transcript_id="XM_628265.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(183951..185426)
FT                   /locus_tag="cgd7_780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362602"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_780"
FT                   /db_xref="GeneID:3372020"
FT                   /translation="MIKQELNFGNDRIIHSAQNENTYKTVKTAEISPLRSGLMINEESE
FT                   EKFGVGAMNNRGSASLGLNSGFSENYYSGFPTQQPQVYFQTKNIPMFSEAMSSGQHISI
FT                   GGYNMLSSHSVGPVFQQSENTNYMTNTSSGMQIKRLNIPSNSVKSVSTIPSNGVSDIPI
FT                   IGGTSGYEYKDGSVLNGVCQQPFQTQNLAKNITGNSSNLHITGNKSTKIQENLNLNTNS
FT                   SSITIHPNNTNNSNVYPSEKPLPSARAKDDYLQYEQYSSVNTKSFISQQNTALQTNFQS
FT                   NNLSNVPFFSTNTSNPNQMNSLMNPHYLNSVPLLAQIRIECIQDLPNNFHHHSMGIYSS
FT                   ITNMDYSIVASFNNIDDKNETYRIGPFPSSSMSNSKLNCIVQDEISIPFSWSQPILKLK
FT                   ILEENDFKADIIGVCSISIDMSSIGIPSQACLIDPQTNQVRGTLRFVVKLVPNQQNPNY
FT                   RFDQIHGPNSILNRRYSHDDSIFNIFKGFCCAD"
FT                   /protein_id="XP_628267.1"
FT   gene            <186643..>187002
FT                   /db_xref="ApiDB_CryptoDB:cgd7_790"
FT                   /db_xref="GeneID:3371772"
FT                   /locus_tag="cgd7_790"
FT   mRNA            <186643..>187002
FT                   /db_xref="GI:66362603"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_790"
FT                   /db_xref="GeneID:3371772"
FT                   /locus_tag="cgd7_790"
FT                   /transcript_id="XM_628266.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <186643..187002
FT                   /locus_tag="cgd7_790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362604"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_790"
FT                   /db_xref="GeneID:3371772"
FT                   /translation="VIFFIKLEMAGDKRKRVQETEVDSEGNEEETSLKKNSVEVDVEED
FT                   DFDGLPSEEEELDDIDDEEDDDEEEDDDDDDDDDDDEEGDEQEPTQGGDEDVEDDDDEE
FT                   EDDEEEEEEDDDDEE"
FT                   /protein_id="XP_628268.1"
FT   gene            <187679..>188503
FT                   /db_xref="ApiDB_CryptoDB:cgd7_800"
FT                   /db_xref="GeneID:3372021"
FT                   /locus_tag="cgd7_800"
FT   mRNA            <187679..>188503
FT                   /db_xref="GI:66362605"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_800"
FT                   /db_xref="GeneID:3372021"
FT                   /locus_tag="cgd7_800"
FT                   /transcript_id="XM_628267.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        187679..188503
FT                   /locus_tag="cgd7_800"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362606"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_800"
FT                   /db_xref="GeneID:3372021"
FT                   /translation="MSQEKWFVCKVKDFMSKRNTKINNLANIYSDDQNDLEEFFELPEK
FT                   TGSYAIFMCYKLYSLFDPEDKGYISLKSIEQWAKMQYNSFCQDNNSSIDAKAFDMYKGK
FT                   TQRICNSIETYKNNYIYYLKLKEEVENLEVDTQDIPITISEFITFVSPLFDNVEDSHAK
FT                   KHKSLSNCSALHFSHIQETNLSLTNYFGTVTNSDPIGKYIPCTSSSSLYLEPKSKNVSR
FT                   GKSRPFKNDILYISDSNLYHSSLWSPCINPASSSLHAMARELNKLQDSDDVN"
FT                   /protein_id="XP_628269.1"
FT   gene            <189217..>190185
FT                   /db_xref="ApiDB_CryptoDB:cgd7_810"
FT                   /db_xref="GeneID:3371773"
FT                   /locus_tag="cgd7_810"
FT   mRNA            <189217..>190185
FT                   /db_xref="GI:66362607"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_810"
FT                   /db_xref="GeneID:3371773"
FT                   /locus_tag="cgd7_810"
FT                   /transcript_id="XM_628268.1"
FT                   /product="protein phosphatase PP2A, calcineurin like
FT                   phosphoesterase superfamily"
FT   CDS_pept        <189217..190185
FT                   /locus_tag="cgd7_810"
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein phosphatase PP2A, calcineurin like
FT                   phosphoesterase superfamily"
FT                   /db_xref="GI:66362608"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_810"
FT                   /db_xref="GeneID:3371773"
FT                   /translation="ERQLFSRMPKGLDVYLDSLKLDREISTLLECKTLSENEVKQLCEL
FT                   AKDILEEEQNVQQIGLPLTVVGDIHGQFFDLKEIFRIGGVPPETNFLFLGDYVDRGYYS
FT                   VESVTLIVALKVRYRNRVFLIRGNHESRQITQVYGFYDECLRKYGTPNVWRYFTDLFDY
FT                   LPLSALIDNKIFCPHAGLSPSLPSLDSIKSLDRIQEVPHEGPMCDLLWSDPDERYGWGV
FT                   SHRGAGYTFGEDVSEMFNHTNNLQLICRAHQLILDGYQWSHNKNVVTVFSAPNYCYRCE
FT                   NQAAILRIDDLGNFTFLQFDHAPEKVLPRQENQLPVPDYFV"
FT                   /protein_id="XP_628270.1"
FT   gene            complement(<190682..>193207)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_820"
FT                   /db_xref="GeneID:3372163"
FT                   /locus_tag="cgd7_820"
FT   mRNA            complement(<190682..>193207)
FT                   /db_xref="GI:66362609"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_820"
FT                   /db_xref="GeneID:3372163"
FT                   /locus_tag="cgd7_820"
FT                   /transcript_id="XM_628269.1"
FT                   /product="RAD3'DEXDc+HELICc protein'"
FT   CDS_pept        complement(190682..193207)
FT                   /locus_tag="cgd7_820"
FT                   /gene_family="HOG000205390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RAD3'DEXDc+HELICc protein'"
FT                   /db_xref="GI:66362610"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_820"
FT                   /db_xref="GeneID:3372163"
FT                   /translation="MVRFFIEELEVFFPYDNVYPEQLEYMKYLKQILDAHSHGVLEMPT
FT                   GTGKTVTLLSFITSYQLVHPNMGKLIYCTRTVAEMEKALQELKTVVDYCKKEIENDKIK
FT                   LEQEIKSENNSSLASVSESRFSAASILGIGMTARRNMCINPRVSVHADRDKIDSMCRSM
FT                   TAPWVRAKHQMEARERSALSEGDANSSKMTEIADIEEMLESGCTTLCPYYEAYERVWSS
FT                   DLVPTGIYTIDEFKDFSKNWEHPILGKKIQFCPYFASKRLIQTAKVVVLNYQYILDPKV
FT                   AQASLLGGGTVSQGFSHGANPNGLSLGSKFAASLLPEQEGTKEPSVVVFDEAHNIDNVC
FT                   IEALSVNMNRQILSGAARNLRTLKSEIESLSSLDEQRLQDEYTRLIQGLRNSGQVQDEA
FT                   VLEDLERFPVLPEEMEKIKKGLIPGSIRRAEHFITIMKKLILYLQEYIRVYSTRIEGPL
FT                   TFVKHIEASCYIQSGLLKFCDERLRSLLNTLRIVDSDQYSSLELVCTFFTILGSYSKGF
FT                   IVIVDPYPEVSGLYDPVIQLSCLDSSIAMRPILKRYQSIVLTSGTLSPLDLYPKLLGFI
FT                   PVVSQSLTMTLDRTCICPLIVTRGSDQTPLSSKFESRADVSIQQNYGKLILEITKKVPD
FT                   GVVCFFSSYLYMEQMLSQWYESGLLAQIMEHKLVFVETKDIVSTTLALHHYRKACDIGR
FT                   GAIFFSIARGKVAEGIDFDRHYGRCVVMVGIPYQYTLSKILQSRLSFLKENYGIQENEF
FT                   LTFDAMRQASQCVGRVIRSKADYGLMIFADLRYNKKDKREKIPPWILKHLKPEYSTLST
FT                   DMAVSISSNFLKQMSQPYAVSNSIIKLGS"
FT                   /protein_id="XP_628271.1"
FT   gene            <193412..>194707
FT                   /db_xref="ApiDB_CryptoDB:cgd7_830"
FT                   /db_xref="GeneID:3372022"
FT                   /locus_tag="cgd7_830"
FT   mRNA            <193412..>194707
FT                   /db_xref="GI:66362611"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_830"
FT                   /db_xref="GeneID:3372022"
FT                   /locus_tag="cgd7_830"
FT                   /transcript_id="XM_628270.1"
FT                   /product="queunine tRNA-ribosyltransferase"
FT   CDS_pept        193412..194707
FT                   /locus_tag="cgd7_830"
FT                   /gene_family="HOG000223473" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="queunine tRNA-ribosyltransferase"
FT                   /db_xref="GI:66362612"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_830"
FT                   /db_xref="GeneID:3372022"
FT                   /translation="MRNEISKESNEPHHEDSMSLPPVLPIKKGEALSFYVAHSCGRARY
FT                   GVLNLPHGRVDTPIFMPVATHGSIKGLSSLQVEELNVPILLGNAYHLGSRPGDEIIDKF
FT                   GGLHNFMRWNRNILTDSGGFQMVSLLKFANITEEGVEFRHPYTNANLLFTPEKSIQVQN
FT                   AIGADIIMQLDDVITAKSTDYQRFDEAVDRTTRWLDRCIKAHKKPDKQNLFAIVQGGIF
FT                   KDLRERSLKSLKERNTPGYAIGGLSGGESKDSFWQIIELCTRSGVGLPENKPRYVMGVG
FT                   YPIDILVCVALGADMFDCVYPCRTARFGTAMVHNGLLKLKLSKYKDDARPIDSRCKCYC
FT                   CKHYSRAALYRIVLKDSLACQLMTIHNISFMMEFCNDMRNAIKNQTFGEYCKSFVRNYY
FT                   SSTELDHLSDLEKKEGIPKWVVDAFKYIDIHL"
FT                   /protein_id="XP_628272.1"
FT   gene            <195260..>195664
FT                   /db_xref="ApiDB_CryptoDB:cgd7_840"
FT                   /db_xref="GeneID:3371984"
FT                   /locus_tag="cgd7_840"
FT   mRNA            <195260..>195664
FT                   /db_xref="GI:66362613"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_840"
FT                   /db_xref="GeneID:3371984"
FT                   /locus_tag="cgd7_840"
FT                   /transcript_id="XM_628271.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        195260..195664
FT                   /locus_tag="cgd7_840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362614"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_840"
FT                   /db_xref="GeneID:3371984"
FT                   /translation="MSESNVSNNTENKGKNNGDDVGVYVHSESDLTSFARENINFATKD
FT                   DENKPERMIKGSQSSFPTIKSTIEKIKMPAKLLQKCVDVIFHGRWKMITLNYFERFFMV
FT                   YSRFVFRHSMAVIIAVTLICLFLGIGKFIL"
FT                   /protein_id="XP_628273.1"
FT   gene            <195905..>199864
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_850"
FT                   /db_xref="GeneID:3371869"
FT                   /locus_tag="cgd7_850"
FT   mRNA            join(<195905..199324,199384..199621,199683..>199864)
FT                   /db_xref="GI:126652345"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_850"
FT                   /db_xref="GeneID:3371869"
FT                   /locus_tag="cgd7_850"
FT                   /transcript_id="XM_001388333.1"
FT                   /product="putative patched family protein"
FT   CDS_pept        join(195905..199324,199384..199621,199683..>199864)
FT                   /locus_tag="cgd7_850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative patched family protein"
FT                   /db_xref="GI:126652346"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_850"
FT                   /db_xref="GeneID:3371869"
FT                   /translation="MKSFHEGLMNLTFTLDETEAKELLEAYNELRNSTSSKQRATEENH
FT                   LNQTTSEEGGHLRSILESPIVKMNSIEEYELIKRKLIPGQKFGFGAKRNFNKNKFGQNN
FT                   HSQNSTRNDSNIQSKKKENEKHYLDTEMFTGNDYIAPQIVEEKDSSGKIVKKYKFNFSH
FT                   VCARVQGGSCRRPSGILWMYKDTKDFGKPIPAPYVINTLTYQSFRTDMWLSPIGMEHEK
FT                   KTDHVKASRAAILEYQLSDQDKMKRFSFRWEEQFMKYCEKVQRRLQKGDYGDDLRDGSN
FT                   FLAFTNELDVHSQAHTTNNNIKKKNDTEHIQNDDLVFDELDDIYIAETERVHIKNNTGH
FT                   EQLSYTIPNIKRINKGATKYLFKGDTANAPLSIFYNARRALSDELTEQTYIHTPKDFAI
FT                   IGSLVVILLIYGWTVGYGSNIYTSRATSGVCGAIAALLAFIGGAGLCYLAGLEHTSTAS
FT                   AAPFLVLGVGMDDSFVVINSFNMTYPLKNAEDRIVSAVRDCGLSISLTTLTNLLSFAIG
FT                   TSAGYLAIKNFCILTFVGLLFGYITCLTILLGVLCIDARLEEKKMIKIFGREFFANRKH
FT                   PDPLVPEMEIPVEKFSTVALIGFLVSQYKHFNDSKVNTQELILIENESSIGKNIDPNEI
FT                   QVSKITNNFEDASINSPIDEEEIIVKAGQINVLYKSKASVSEEQTQNTTYMNNSGSPST
FT                   LFSNKTSSIQSKENIFEAQRKLHSNLGSEKYLENDHKDLSNNFNSSNQIDKLKDKLISI
FT                   SKSEKSNSRSSKKKNEHNKAKHENQSQGKKLIPNFADILDTRLLNYKRGRSNAHSSIQL
FT                   TENIEVSDYTAEQLKKDKGMVSKSQTESSLLSSPNSGGSYFSESKLQLTNSDFTSSSSS
FT                   SESETSSSGSELTVFPMEAKQNIGRKSRRFVIKYYATFLTMTSTRVIILILASIFLAVS
FT                   IYSSIKLKMGLDLKVLAPPSSQVYKFYVNHEQLFNKYGDVTYMMFQATQKLGDNNNSNN
FT                   NNWWEESFIRDYKELQTKIHDSWFTEIKLDGMVAFYDSLLIKGLPKNSVEYSKMLKAFI
FT                   SSPYNRHFEDDFVFNQNTGELEAWRSVLIPIYLPDTSVRGKYMTDIRKIMGSVPGVKNP
FT                   IAYSPLFIFYESDVSILPQTLYNMGCALIAVLLASLILMPSISSVIIVIIILCMVDVCI
FT                   IGMMAQWGLQLNMLTMVNLIMSIGISVDYSTHICHCFAHCSGKDRNTRVIETLGLMGIP
FT                   IFHGAMSTQFAVTVLAFSDSYVLQTFYKMMTLVVCIGICYGAIILPVILTVFGPM"
FT                   /protein_id="XP_001388370.1"
FT   gene            <200731..>209061
FT                   /db_xref="ApiDB_CryptoDB:cgd7_860"
FT                   /db_xref="GeneID:3371985"
FT                   /locus_tag="cgd7_860"
FT   mRNA            <200731..>209061
FT                   /db_xref="GI:66362615"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_860"
FT                   /db_xref="GeneID:3371985"
FT                   /locus_tag="cgd7_860"
FT                   /transcript_id="XM_628272.1"
FT                   /product="large protein with possible conserved (animals
FT                   and fungi) N-terminal and C-terminal regions"
FT   CDS_pept        200731..209061
FT                   /locus_tag="cgd7_860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large protein with possible conserved (animals
FT                   and fungi) N-terminal and C-terminal regions"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362616"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_860"
FT                   /db_xref="GeneID:3371985"
FT                   /translation="MSTELQKQINFQLRNNELTFLSQRALKVNRNKKERISFLFDTSNT
FT                   EFHSRKGLKPDNRIPIYEDLGRLRYLAEQGLMELESLNPRISHESFNEFFENTDVPSIQ
FT                   MLTKQEAGEMLRKLERLIDFLVPYFLLESAKICIEYLIQAYDINVLLGEYLFYSFLPYH
FT                   DMAEFCQLIRTLDIPENSEIKGLVDSIKTTRTVITSRSYLSSILIRNPALFKNIVIFWE
FT                   KRLETFQLTKNIPLTNLITWLVIEIIEDLSRSKDLKNLHIFLESIIEIIIFGTCLKGSQ
FT                   YEELRSTGYCILYKLSTPLLSLSNETQVRIIDELFKSISRNQTYSPNYLSETILLMNHI
FT                   LTQFGTLTHYEYLDHEISEFIIENQAIFISAFKQLSEWESDFLQILALITKSIINFGVN
FT                   QDQSFSRPCLNFFESILNCLGNSSSLLLMDERQSKMIKVIILSLIDVYSQDQIQNPFFG
FT                   NIIKILHTNYPSELLSALSFSLNVSSSPQSQLFELKEKAQMFVDIVLKEEEEAKSDSGI
FT                   LQSKEGESSRMFLTLLNSQDKSVLNSCLDMIINLIKKSSKNPSEITQFEKRVFELSLRH
FT                   FLGSFNDESGKQNNFGEEYALKILSLPQTIEISKFLDLEDIPSQDQGHRDLQKQWRVNL
FT                   IFKSFLFYFKSKITSGYSTLIKYFSKEISSELNLKDHQNGNFNIEAMIMESTFSHIFGQ
FT                   NFETNLMDLFKSFSIILENDTFELKNQMNNLDVILMENSDIFIPLFTLISHENLSFSQD
FT                   LKKSSTRLLALMYKNDQINTYFKQILFKSSVNCLEISLILLSLKKLNLDLRSSYLLPNH
FT                   SFSKFGIYLNNDQEIISLLETLYYKFYYYISSAIRPLKNDKKISNQLVGIYILIIFRST
FT                   LQIVSSRRDHFILYYKLLNISLVDTLDIGILSTNHLGLPLFQMINSCFDSNNEKKNKKI
FT                   SILVINLTRNLFNILSQSGSASFNLDYLNNDQSYSIFYGKNVYLDTLISHSYSFLEIIT
FT                   SKLPVLQDSKNNTFSVSNLLEILYSILSYAIIPAFLDQKSISIKMASFRLCKAIQDKLN
FT                   PINIEKVFGNSNLKFSDILLSYNNSNDTGTDFNYTNNHLRSCYLNKFGPKIHQVLEVID
FT                   SLLNHQSEVIVENNFQNLFEIIFKDNNKSINIPGTLLMLNLVMTFEMAFTSKFIQKIDL
FT                   NYTLLSDYVRKNFIFGSIDSNYHEILINISKSFLIKNEYIDHHIIIGLSFLKQGIDNLV
FT                   DYIDKQEQIDTIKELILEYLNVIQRFEKEFQYFVLIKESNLAKQVFCEILLTFLNEKIT
FT                   QYLKSDHEFASFVVGIISQIIQYSPESIKKVSLSQYIQSKSLERLDLLICSLLEYCLKD
FT                   EHSKRSNSNFKLNNDSDTVFNEQIILEWIYCDLNLVNIEILNDQKEVEYTFNKDLICQT
FT                   LRYLEINRNRLKRNHHEEMDLDILFKTEIYLIRILDFGIKLRYTQFKDLEPILNYFEIT
FT                   EETNNRVEISKFILNPMIISSITSLFSSIKIKSKNKDSMDHSKSYFKICKILFSIYMNL
FT                   AKNTHGGIDQKNYTIKSTFYSLNLFVNHSLQDCIYFDHSSKERMKGILFKILISEQIKE
FT                   IVETNKFNQIHEILDFMEKLHNDVIYCQNVHRFKKSQGIFMIIRYYLNMNQDSQSEDLE
FT                   QLIKHLLKNQLFDTRTNVYKDLLLNVQNEMEILMKFEDHDHNNHGFETRKVILENLILM
FT                   TKTIIYFLNKTLLTTEIKSNESQDLLELFDSLILIKTLMNKKILKKLGTVLKNNETDLE
FT                   MNEKLKSRIDKLEKEYLINSIGLDKDFQHYDNEEYVIKTIQKDIDQLIQSIIEDDSMKK
FT                   YLIVHWDLSKDSGFEVLKNLRKRFYSLLISNKIDSLGIILKESLDKKLKISIDFRSSSI
FT                   NNHDQVKQESNVFNTIQYLLDIMISSKEFKNSFKYRSKTQKDLHVLDESMDTGTESESE
FT                   ENEKEDLRSKLKLWIKNWYIIDLILKVVKTQGEERQKDQFNKLIFSKIMSFYNSQENMH
FT                   DGYGIVFKIPLIQNFLLEKISKLEKTDTITILNEIQIILEDTIRTIKLLNSNSNIFEYI
FT                   HILEDRKVKSILISMITSSYKDLDNDENDEFKTRKALLLPYLALLNTLLSSNIGSVMMN
FT                   AETRKEILINVLLHDSMVPYYDLNILTNLLKSERTRKSKFNTRKEKYKQDKSLENHIED
FT                   LTMLDKNKSNSNHKLNFYLEELDKNINSSSGILIEGGTLENYLVRILLIYCNLTSSPTS
FT                   HSYNEDFIGGYSQVLKEISSELFSKLNLEEGTGIKKILKDHGINIYYSKLTNLVLIVSF
FT                   SLNFMDAGKLITEKSFIERFSQFYLLLVNLLIINFSKLHSIKETELKMLEEDSTDSKIG
FT                   NSLEKLSGRKRTEEEKDDNYNRRNNMKSNNNNRGKEESLNGFISNIFGVDVLLSHGCVN
FT                   PKWFDLDIKDLKKLSNLKSNNTFTNLKIWKLESSISTLISVFVLKLNAKRLREFILLIK
FT                   RLIHRNGESFLSKVSSMTKKSDDSKTASNSDKKAIKDLYEEISSSESSTLIKDIYSCRI
FT                   WILILLAVFESTGEYGIYCLIDDVALDVKSICDLTQMNALTCVQNITISQYRNIHSPSK
FT                   RSPNHQQIANLSHLDNELGWYWYHLGIYNLILIKIIYLNLSVQNEESKDVPNSIEDYLV
FT                   NPIVTNLDMFALFEPGSTKNLTGCGKQWDLILSDIWIHSIRCFRSNDLILAGIIRLLVN
FT                   KIRNGNDQVRMFSAEVLLKLWKDEICSITILSHLSDILPTIKELLSDHSEEMINITKSI
FT                   VKKIEERTGEDISKQLC"
FT                   /protein_id="XP_628274.1"
FT   gene            complement(<209417..>210196)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_870"
FT                   /db_xref="GeneID:3371986"
FT                   /locus_tag="cgd7_870"
FT   mRNA            complement(<209417..>210196)
FT                   /db_xref="GI:66362617"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_870"
FT                   /db_xref="GeneID:3371986"
FT                   /locus_tag="cgd7_870"
FT                   /transcript_id="XM_628273.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(209417..210196)
FT                   /locus_tag="cgd7_870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362618"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_870"
FT                   /db_xref="GeneID:3371986"
FT                   /translation="MKASRYHQILNQWIGKTKGFIIDENKDANTIQVTGESKLNRNKDS
FT                   DTEWGSKWRFGENENDSKKGEKELVGVVSSIPSLTDIIRPFGDLPNDVYMDIMSKYKCF
FT                   LHELKLKLIEIFRINSEKFKIQYKLDIVDERLALVEELGQEVYKLSAADLARIHTQKDK
FT                   EECLMVDRLVPVVEKAKSLIIVEEEKFLLELNSKLRTNLDQLTKEFHELQTQISQVDKQ
FT                   LKDADETSNSFITDAIETFRKWSENAKEVIKAVERAN"
FT                   /protein_id="XP_628275.1"
FT   gene            complement(<210640..>212400)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_880"
FT                   /db_xref="GeneID:3371987"
FT                   /locus_tag="cgd7_880"
FT   mRNA            complement(<210640..>212400)
FT                   /db_xref="GI:66362619"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_880"
FT                   /db_xref="GeneID:3371987"
FT                   /locus_tag="cgd7_880"
FT                   /transcript_id="XM_628274.1"
FT                   /product="eIF-3A like translation initiation factor that
FT                   has a WD40 repeat-containing beta propeller"
FT   CDS_pept        complement(210640..212400)
FT                   /locus_tag="cgd7_880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eIF-3A like translation initiation factor that
FT                   has a WD40 repeat-containing beta propeller"
FT                   /db_xref="GI:66362620"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_880"
FT                   /db_xref="GeneID:3371987"
FT                   /translation="MSRAVEYDDEIVCLGKGGVYRLRGMTKNDVNSEELTVNNPIPFLE
FT                   GVEIYAQEPQGRGYCFVPKDSKNSVILITKGEGEVNKELKIENDFPVRKLQYSPLGSYL
FT                   LVLTVFEQGKNENNLQVYKLKENVKLLFSFPFKTNSAKVLSTWPPYRWSNNEIFVFKVQ
FT                   DTSVSIFKSDTESLENPIGTLNFSKSIQLSVSNEIDGGSDLGEEGSKLSSLNFTVVTPQ
FT                   SAQNMDVYVYHAEMDSKKEIQLSSIGQVCVKEAQTCQVSWNNSGDSILVFAQIEGETLG
FT                   KSYFGSSSLHLLRIQNSKTVVANSAWKGNKGGNNDLENGNKNGSDGFKPSEKLSLRHQV
FT                   VVPPEEGPVNDVAWSPKSNEFLLCKGIIPPELTLNSGIDGSPKVSFGKSRRNTIRWNPS
FT                   GKWFAYGGFGNLAGDLDIWDLDKQKLIGQTNASCCITLEWSVCGRFLLASTTSPRLRVD
FT                   NAIRIFRYNGDLLKRVNFDTLYSAYWSPKTADYRRSVKYRSVSPGREFNSKPQPEKQIY
FT                   RPKWASSGFAERMRAARDSNNVPTVVNVQQKPKNEYVIPGLPTLEASAAAVASSRQSNH
FT                   RQKQKQKPKK"
FT                   /protein_id="XP_628276.1"
FT   gene            <213346..>215577
FT                   /db_xref="ApiDB_CryptoDB:cgd7_890"
FT                   /db_xref="GeneID:3371988"
FT                   /locus_tag="cgd7_890"
FT   mRNA            <213346..>215577
FT                   /db_xref="GI:66362621"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_890"
FT                   /db_xref="GeneID:3371988"
FT                   /locus_tag="cgd7_890"
FT                   /transcript_id="XM_628275.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        213346..215577
FT                   /locus_tag="cgd7_890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362622"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_890"
FT                   /db_xref="GeneID:3371988"
FT                   /translation="MSLGNNGSGGINNGGYEDIRFGNKSGTHNMVFQDLSGKHTGYLEI
FT                   QQNNHNSAQIIMDDHEIGGGSSQRMDQLGGITQSNSNTGSLAGSQSSIGSQSYQSHSLN
FT                   SSSTSLPNSNSNSNLNMIMMSSNSVQGHNHGQNRNSSSQILRSSIHPQNSHYYNNPNLN
FT                   SSVSQPGPSQFQHQNNHMQQIPQNVYQLQMQNPVKSQQSSRSHSVPPSSSPSPSSSPTL
FT                   QASQLNDYPSKGSYSQSSQVLQHSPSPSPQYSQSSHYSQPSRNSHPYQLTQPSQMSQQT
FT                   QLQSSQPHKQIQFSQSSQAFQLTQPSQPSQPSQPSQLTQPSQPSQPSQPTQFSQLTQPS
FT                   QLTQPSQLTQPSQLAQASQLSQSSQLAQASQSSQQSYLAPSNPLRNYNIPIEKVVWDYL
FT                   HFLYRQNTGVLGYLAPYIDESFNIGKFHCLVTEFCKRQRVSKDALIINSKNWFKECLDQ
FT                   REATQSVELTIECEIKKYVESKIKRYEDLGFKLESDKISKFYCNLVPYMIKNLWRRLEN
FT                   ASYQRVDWSSRQFLGSEVDPKFCNYDMVSRIMRLNSSNSDESNRDNSETVSGNKAIRSQ
FT                   DNDKELSSREKHEGSDYMMDSNSDSGNRRSHQSIMNVKANIDDHHDHCINEIDNSQSHG
FT                   QNYSQNQNQDDIQMNKRRNPDEHDEQTKEMVIVSRTQKWLLRNVKLEDFKYLIRVDQLR
FT                   EENILRNSAPSKHKSKSKSRSSSSNTSVRLPRKTQNVILDYINLCNFKI"
FT                   /protein_id="XP_628277.1"
FT   gene            complement(<215727..>217238)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_900"
FT                   /db_xref="GeneID:3371989"
FT                   /locus_tag="cgd7_900"
FT   mRNA            complement(<215727..>217238)
FT                   /db_xref="GI:66362623"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_900"
FT                   /db_xref="GeneID:3371989"
FT                   /locus_tag="cgd7_900"
FT                   /transcript_id="XM_628276.1"
FT                   /product="hypothetical protein with 3 or more transmembrane
FT                   domains"
FT   CDS_pept        complement(215727..217238)
FT                   /locus_tag="cgd7_900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with 3 or more transmembrane
FT                   domains"
FT                   /db_xref="GI:66362624"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_900"
FT                   /db_xref="GeneID:3371989"
FT                   /translation="MIDNYQEFLTDSERSHELSFSTVLDEIIISELNEDPNINLDNWTS
FT                   VPKMKIDLFSYLEIMDKLGEILFYKYSFNILVFLLIQIIQRNSRNILDFDNKFDTILIK
FT                   SNIFIYNSWSFYLLVYTIGVIYSIFLFNKEKYLCKFLFFQNDIFNHNQFSGIYNTWCSI
FT                   IGVVSRFHEIVDIIFFSYLSSQYLKLSQSVLFFLVRLSFLVIQVRSFLAAGNITSSFNW
FT                   ITNNTQNPGQTSSFGSQNLHSSSSSSSSSYYSTIKAELYQNQDNFGCQEVNQQISPLSS
FT                   SSFHSTKSQEQDIGRDQSMDIHSKKRSKKKDDCHLSSQVLSDLPSSSSSSSSSLSVSLT
FT                   SFLSALPSVHQDNFLFCKFSQTFFTQGLISYFHFNASDSFRVALTKYTSQLKQNQTKIK
FT                   PFKILQLADLAFYLDLFSLENILYSLYILNKHKETHEFNISTYFLWKVLSNDLIINIYK
FT                   LFFLIFVSRLSKIYIILTLTISSLSISSLFLYLHVNKQVINDVIR"
FT                   /protein_id="XP_628278.1"
FT   gene            complement(<217652..>218866)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_910"
FT                   /db_xref="GeneID:3371774"
FT                   /locus_tag="cgd7_910"
FT   mRNA            complement(<217652..>218866)
FT                   /db_xref="GI:66362625"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_910"
FT                   /db_xref="GeneID:3371774"
FT                   /locus_tag="cgd7_910"
FT                   /transcript_id="XM_628277.1"
FT                   /product="phosphoglycerate kinase 1"
FT   CDS_pept        complement(217652..>218866)
FT                   /locus_tag="cgd7_910"
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoglycerate kinase 1"
FT                   /db_xref="GI:66362626"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_910"
FT                   /db_xref="GeneID:3371774"
FT                   /translation="LKGKRVFIRVDMNVPVKNGQVTDKTRIIASLPTIKYALECGAKSV
FT                   VLASHLGRPDGQRKMEYSLTVIVPILEELLGKSVIFAKDCVGNETEELCKNPAEGSIIL
FT                   LENLRFHLAEEGKGVNENGEKVKATPEEIEAFRKSLSSLGDIYVNDAFGTAHRAHSSMV
FT                   GVDLTPKVAGLLLKKELEYFSKALESPTRPFLAIMGGAKVADKIQLIKNLLLKVDRMII
FT                   GGGMAFTFKKVMDNMQIGKSLFDEEGAKIVKEIMDTAKERNVQILLPSDFVIADNFSNE
FT                   ANARIIKDSEGIPDGWMGLDIGPESSNSFKELILSSKTIVANGPPGVFEMEKFSKGSRS
FT                   MVEALVAATESGSITIVGGGDTASLVEKCGSANKVSHVSTGGGASLELLEGKLLPGVTS
FT                   LSSKS"
FT                   /protein_id="XP_628279.1"
FT   gene            complement(<219850..>223053)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_920"
FT                   /db_xref="GeneID:3371775"
FT                   /locus_tag="cgd7_920"
FT   mRNA            complement(<219850..>223053)
FT                   /db_xref="GI:66362627"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_920"
FT                   /db_xref="GeneID:3371775"
FT                   /locus_tag="cgd7_920"
FT                   /transcript_id="XM_628278.1"
FT                   /product="protein with 2 possible TPR domains, possible
FT                   n-terminal acetyltransferase"
FT   CDS_pept        complement(219850..>223053)
FT                   /locus_tag="cgd7_920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 2 possible TPR domains, possible
FT                   n-terminal acetyltransferase"
FT                   /db_xref="GI:66362628"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_920"
FT                   /db_xref="GeneID:3371775"
FT                   /translation="ESERKKSRGKKMSKEIPNLATLSTRDQQQFKNIVQLYDQRIYKRS
FT                   LKLTETMLKKYPKQGDLLSMKAFILGAMHPESKDEKHKEAYECAKEAIKQNMRNPMSWH
FT                   CLGTLYKGDFDYNEAIKCFKTALKFDKEDLVVLRDLATCLIQIRNYQGFRDIRNEIKRI
FT                   RPDIRTNWIASALGNHFCGYINSAINCLLSIDQFGSSENGNIHSKRTSLDENNYGVLFS
FT                   FLEPFQRSELLLYFVRVLLDGKKYQQAYNFLRSNKEFILDKTDYYNIMGNLLVKCNQNY
FT                   TKECSECFNNLLELYPDDDYALFGCMITNKSLNNVVLSPPHLPAHQIKGFRLQESEDES
FT                   VSSGNEAVIPICSIGSNFFHTRGTSGIIYFPLLTNDNIGRNKHLEHKRLNSKEIECDYG
FT                   YKASSNITNPVLEFIIYEDSELAEKKVEYENSLRKIEQFFQEKKSQFPNSDTILRIELA
FT                   FSNGEEFLRKFRSYLKSKLKSRITALKSLIGYLIKLDSKKKFLIHSELNNIVSEYENLY
FT                   EKGEADKDELITLYLIYSQHLDCMGLSLEGLNYIEKALKLDDKKPDTFNIKRRLLKHLY
FT                   RFDEATNAIDHARLMDINDRYLNTRTICACLENGDFNEAKELLKKFMTRISDQSKSKES
FT                   EVVPSNETEIKNLQMIWYEKRVVKSLELFDSSIDGYVMTFDHYLRLLDSMEIMKTDQYD
FT                   YHLYCLRKMTLCRYLDFINMQDKLFCNTNYRKISVIFWRKVWINIYKIVHGKLELSQIN
FT                   SKKDKQKNKNKGGDENESLKETLEFVKDSEQNWSKSHEIIQNYRKDCIFNTQSYIPIYI
FT                   HYYCSQKILGKLSMETCILVCSKSIYRVYTLENSYIRENQIGVFPILLTHFYTKIFNNM
FT                   KNGIDNISTEYRNNILDAIIKQLQIFTGIENLNIDNINTHFQNYISSMNFNNINDIESL
FT                   CNLVKISIITGTFNNIESYLDNFDNIDNLNKFSGIFNKQIINLVKLLIIRSIISSNSDT
FT                   ESLNLNSSNFSIENYSFSKSKLLNKIINSYDINSRKFVTTYNQQNHEHKFMLQVKYLKD
FT                   QISKEIIEISNLPILALSI"
FT                   /protein_id="XP_628280.1"
FT   gene            <223591..>225327
FT                   /db_xref="ApiDB_CryptoDB:cgd7_930"
FT                   /db_xref="GeneID:3371990"
FT                   /locus_tag="cgd7_930"
FT   mRNA            <223591..>225327
FT                   /db_xref="GI:66362629"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_930"
FT                   /db_xref="GeneID:3371990"
FT                   /locus_tag="cgd7_930"
FT                   /transcript_id="XM_628279.1"
FT                   /product="hypothetical transmembrane protein"
FT   CDS_pept        223591..225327
FT                   /locus_tag="cgd7_930"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="GI:66362630"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_930"
FT                   /db_xref="GeneID:3371990"
FT                   /translation="MFEKIFDRYSKGIYKVIDTCASLLYWSLRVTRYFFPLTIALVLLS
FT                   FTIFSLTWILYLGFYWYWIPPKSISFPINFDFQNKYFSQLIPDNYLYSDQSFNKFSNSA
FT                   PGLSQRNYQDNVYNNFINSNELSRQLMYEQSEASAILNFNNITWRYKNVGNKRYSITNK
FT                   SLFNQTHFLENTDISTEKNGDISTGTLSYFLYLKDYWSSKAYNFVTFNWYQRKKYYKGI
FT                   DEGINRIIHKHVDSRFGNRMNSEILGNEIDIIVELFYFPSQYNINISPFQISLDLIQCL
FT                   EPNINLNLGSDIHNNNSSKILASFKKTSTIEYLPQVVLRFKEYISIIPSLLGLQINSLG
FT                   LGLENKISVKLVENFPLQRKHPFNFNSLETHIKLCGAKIKMKPALHISKSHLIFQTKLP
FT                   FWKEIIRNHPILMGNMVSFIVTLFLLSLLFFIVFLSGIYFLWKKYPANNYNDYHISNSF
FT                   LPTGTVTYTNCTPTSSYQINSNGFNQGNNQDFSSTKNIPLSNCEQLLIDYSMTNSSINI
FT                   NGLLPLETKQISHPRNQYITHSQSFGDRNSDENIKSEENGDSNEKSIQSPKSNSSSNHS
FT                   ET"
FT                   /protein_id="XP_628281.1"
FT   gene            complement(<226389..>227249)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_940"
FT                   /db_xref="GeneID:3371992"
FT                   /locus_tag="cgd7_940"
FT   mRNA            complement(<226389..>227249)
FT                   /db_xref="GI:66362631"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_940"
FT                   /db_xref="GeneID:3371992"
FT                   /locus_tag="cgd7_940"
FT                   /transcript_id="XM_628280.1"
FT                   /product="splicing factor RRM domain containing protein;
FT                   T22E16.120 SC35-like splicing factor"
FT   CDS_pept        complement(226389..227249)
FT                   /locus_tag="cgd7_940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="splicing factor RRM domain containing protein;
FT                   T22E16.120 SC35-like splicing factor"
FT                   /db_xref="GI:66362632"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_940"
FT                   /db_xref="GeneID:3371992"
FT                   /translation="MTFSVELGDDGIGGDNSTKKVYIDYNDGGDENREGDRKIDESKSP
FT                   SRERGVSDDEQRNNEGRNEDNREPVEERDRSRSREKSEVDVSEGCSLLVRNLRFETSPG
FT                   RVRHHFERYGPVRDVYLPLDYYTRRPRGFGFVEYMDPRDAQDAVNRLDGSLLDGSTIRV
FT                   VVAHDRRKSPETMRRIQRDSGRGPRMGGPPSRYDHRPSGGYPPEHGYRGGRYRDDYYGG
FT                   RRQGGYRDDDRNYRPKRRYSSRSPSYHSPRGRSVSRSPYRGGSISREHSHSISRDPYQG
FT                   KRYRK"
FT                   /protein_id="XP_628282.1"
FT   gene            complement(<228949..>230370)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_950"
FT                   /db_xref="GeneID:3371991"
FT                   /locus_tag="cgd7_950"
FT   mRNA            complement(<228949..>230370)
FT                   /db_xref="GI:66362633"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_950"
FT                   /db_xref="GeneID:3371991"
FT                   /locus_tag="cgd7_950"
FT                   /transcript_id="XM_628281.1"
FT                   /product="putative Sec61; signal peptide plus 9
FT                   transmembrane domain-containing protein"
FT   CDS_pept        complement(228949..230370)
FT                   /locus_tag="cgd7_950"
FT                   /gene_family="HOG000231249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Sec61; signal peptide plus 9
FT                   transmembrane domain-containing protein"
FT                   /db_xref="GI:66362634"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_950"
FT                   /db_xref="GeneID:3371991"
FT                   /translation="MAKGLRFLNLIKPALCVIPEVSSPDRRVPFKERVLWTLISLFVFL
FT                   VCCQIPLYGVLSSKSSDPFYWVRVILASNRGTLMELGISPIVTSSMVMQLLAGSKIIDV
FT                   DQSLKEDRALFQGAQKLFGLLITLGEAVAYVISGMYGDIRTIGAWNAILIIIQLFFAGV
FT                   VVILLDELMQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHL
FT                   LFTKPDKISALREAFYRSHATNMTNLLATVLVFLIVIYFQGFRVDLAVKYQKVRGQQGS
FT                   FPIKLFYTSNIPIILQTALVSNLYFFSQLLYRRFKSNMLVNILGQWQELDVGGQSIPVG
FT                   GIAYYISPPNSLVDVVSDPIHTFFYISFVLISCALFSKTWIEVSGSSAKDVAKQLRDQQ
FT                   MIMKGYRDSSLVQVLNRYIPTAAAFGGMCIGALTIIADFLGAIGSGTGILLAVTIIFQY
FT                   YEMFAKERESGNIVF"
FT                   /protein_id="XP_628283.1"
FT   gene            complement(<230770..>232374)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_960"
FT                   /db_xref="GeneID:3371993"
FT                   /locus_tag="cgd7_960"
FT   mRNA            complement(<230770..>232374)
FT                   /db_xref="GI:66362635"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_960"
FT                   /db_xref="GeneID:3371993"
FT                   /locus_tag="cgd7_960"
FT                   /transcript_id="XM_628282.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(230770..232374)
FT                   /locus_tag="cgd7_960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362636"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_960"
FT                   /db_xref="GeneID:3371993"
FT                   /translation="MLDFDDGVRDLVKRIDNVTIQLAGLFCSLENELLELYHLCGSGNE
FT                   RINQGLKKSEFIEGMKELLKNSLLNNQENIDDEYLIALDNSVISLETLTSALVGTKCYV
FT                   NCKVVNENEGGDDSEGISNSLGDCNELGLSEINENSSLIRLCRSVNRLTKHRNKIEKYD
FT                   VEMNNELDKIKSDKTRELENKLKEMEIKLRSKEALCYAHEKQIEYLKCDLKELSKTNNE
FT                   IISQINIQELNIGQDQEFEQYIKTDNEQSLCQSPRDELGIYFGSDEKIECIYVNENIKK
FT                   ENENKITPLKLEPITNFNQVINCQNNRKCDNSSLQETFREEDLGILELKDQIQILNLDL
FT                   QYLKEENSRLKLQLENTTNDYSALPEKNIPDESEVLYDILVNNSFSEKYTETDIEIFNN
FT                   KQVVFKNIEKIINISIINSFPKLKKTELKKVEISNINKINTLPIRQNPKPCLVMWEPII
FT                   DCPSDLSSGLNTNHNIIPLPMSSYGQFRKSRRDGRKNPATIIEENTRTRKTIPINRNSF
FT                   YCDLEKIIKKNTRKQES"
FT                   /protein_id="XP_628284.1"
FT   gene            complement(<233382..>236444)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_970"
FT                   /db_xref="GeneID:3371994"
FT                   /locus_tag="cgd7_970"
FT   mRNA            complement(<233382..>236444)
FT                   /db_xref="GI:66362637"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_970"
FT                   /db_xref="GeneID:3371994"
FT                   /locus_tag="cgd7_970"
FT                   /transcript_id="XM_628283.1"
FT                   /product="Syf1p. protein with 8 HAT domains"
FT   CDS_pept        complement(233382..236444)
FT                   /locus_tag="cgd7_970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Syf1p. protein with 8 HAT domains"
FT                   /db_xref="GI:66362638"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_970"
FT                   /db_xref="GeneID:3371994"
FT                   /translation="MNGVDKSLEFLQTLRYGLLRENLFLELRGIKEFEDQLGKRKGQTG
FT                   VWIEYISKIRRDIEINRDGLSHEVAYMMDKTELNNELDEWKNRDAQEKQGIDDNNLELM
FT                   YKQDYCLLILRRALSSTNRRVSSIWVEYLSFMEDYENFMEIKLSKRLIGLDLTEEYENS
FT                   LKSCNDLDLWLRYNAYLRKSRLEFTNSRLVLDRSLKSLPIEQHHKIWERYLEYSMEMNI
FT                   PELSISISRRFILFSYVEGIRMYIQALIDGGRYEECLDKLIDIVLKKEGNLRIQQTFEG
FT                   LKKGVLVGGVNYKIGEMDDLIGLILVIITEYVLKIDYNKILTYTMNLMLEKLRTCDSRV
FT                   YQDINNENIQDDEDQQKMKPIFRLTFGEVVCKVSEIFMKLANWEQVKSTFNFGIENCLF
FT                   VYDFITIYDSLMMFSTIHLNRMLKSSQSLDSSLSNKNEYSPEIIENNILNLEKVIKDHK
FT                   KLLFRTMVKSDTNNVSRWIEYINVLIQNETIEKKSHPSLEVVKVFEEALETIDFSIIKD
FT                   KSKNVFWIFYASYMTSSIDNGHDRLDIDKKKSSKSDQLIDLARDIFERSLSEDYIEDYS
FT                   LIWTEWIEMELRFGNFEEALNLSRRSICMAKEQKSKITLRNGRIWNLAADLEMSFGTLE
FT                   SSRALIEDLFESGMATANLLVTFGSYLRDKECYEESFSLYERSINCLTIQFSFGLWLDY
FT                   IDSFISHYNNGLNIIKLFDDSDIDTTIYGNLKIDRLRDVFDQCLESLISWKKSSLKEKD
FT                   RKYYLNCVFIAYGIYSAYEAKIGRVSRSFDILNRAMNELEDHDQHKLNLYSKWIKLTLK
FT                   CRDISYTRKIFDMAIDDIKASDIIIRLSLRYINFELNMGEVNRVRSIFIFAGDLIPNIY
FT                   LMNEHIEIFNKFWSSWNQFELEYGNEDTIKDMLRIKKNVALVSGHSNINSIQINQQRED
FT                   QKSNDLMEQTESSDNNSEDRNTSSDSDDDIILSTSSDEQSDLNKKSDEEMSNSDSSSGS
FT                   DSDLVSYSENESDSDLQIKQGDGNSNRDEEL"
FT                   /protein_id="XP_628285.1"
FT   gene            complement(<236830..>241512)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_980"
FT                   /db_xref="GeneID:3371995"
FT                   /locus_tag="cgd7_980"
FT   mRNA            complement(<236830..>241512)
FT                   /db_xref="GI:66362639"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_980"
FT                   /db_xref="GeneID:3371995"
FT                   /locus_tag="cgd7_980"
FT                   /transcript_id="XM_628284.1"
FT                   /product="protein with MYND plus SET domains plus 5 Ank
FT                   repeats"
FT   CDS_pept        complement(236830..241512)
FT                   /locus_tag="cgd7_980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with MYND plus SET domains plus 5 Ank
FT                   repeats"
FT                   /db_xref="GI:66362640"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_980"
FT                   /db_xref="GeneID:3371995"
FT                   /translation="MITSLVDILDLPKKSEISHKKNINIETLQKIFEKSKSGKSSFVSR
FT                   EFKKIDGSSSNYKEAVESLLEICRSLVRQGDSLLAIKQIKRFLFTEPRSLESHSFISLL
FT                   YMKIGNYFKSYEHIMGVRFMTNDNDYDAKIASGSILDTLIFQICRLPLGLKSKSLIGFN
FT                   FDDELPFDERKLEYISQYKFEKINFQSGFSSTTLDKFTTPISNSQINVGDLVHVEEPYA
FT                   LAPEIPSNLDIQTTCFHCLREREVYDHAFSCSVHPNTCPFVFCRWECMVKYSRRHELEC
FT                   EHIGAIIVISNESGLPVSFLLLALRCLIQTHLDSISLLIKTEGVSQKLLDLPSYSDIIE
FT                   IVSPDLFSIFDFITQEFIRVIPIHLRLYFSRKELRSFLITLYSNKLPIIISSASSAFNS
FT                   SPVPVSTGLGFFEKASKFQHSCIPSCVYYMNDEHKLCIRSAYNIPENANLTISYILDLY
FT                   QPTFKRKSIINSPKVFACMCSRCLDDSENNLFLEGIRCPFCIIGFLVPSPIFKKSEVVE
FT                   PNSSQSNLRIISKSILPKKSNLFSRDRPTKDSFLPLSMAKNEDKMTSDIKTLCERARIN
FT                   CKSGEVQIKWKCSNCGEFSNEINTCCNELVSKMENHYKLAINSFNDGKDIEARKLFEKF
FT                   INNFSLITHNNHYLIYNSRSHLVGLYNFSNSNDSKMSYKYCKPIIVSSNKVFPSCYHEK
FT                   VHLFLNLADIIYKKEMIQKVSQRGVFNNSKDLIMECSWLSLYNSMVCYGPKSPIYYYCL
FT                   SRMRLYSSILGVMTPPSNMRIRIASIDLFSNLNREILGNSTISKSADYLSTLSEYSALL
FT                   FIASIKGHLMGIAQLLVGQVKDILLNKVTYLPTGLNLLGMAASNLRDDVCALLLEEGSD
FT                   LFFKNEYGITPIHALCTYPELEEESLDIQNDKKSAIIARDMIRKAIALDMEKSSKTYKK
FT                   ENSEDNGEHLGANACIRKKHAFASKSGEKMPERGSNRYKLLYGKTIKWLGSNTPLHIAA
FT                   FKGRKFLCSELIHGGTDPNVENIELAIPLHLASLEGHIETVEILLKYGSEINKENYQGN
FT                   TPLLLGIYGLKFETVRLLLEKGANLSHRSDTLKMNALHMLALGLCCNTTLSFQLPKKLN
FT                   DLPLISHNGYNNKDLKTYIYSMGTSNTGFGNNSSTKILSIPIHTPIAEFLYISPREMLT
FT                   RLKNCFDIISFLNSVYDISPMLTQRDANGFTPFELLNSTWNDFLKLRNEALLNQGLWYS
FT                   SLSEEDKISTEELWSHIMQRVERLLEKLTIEEKIYDINHDDPDLELPLPKKEYRGIPEL
FT                   ELSDKSEDKHEYLFRKGYLEPIVMKKGYCGNYSIGSDSTIYTQGNMDTFQIKELKELIM
FT                   KKRKDHMEIMFKKDKSAGKVGFNNYGKMALKGNSILGSGKSSSLLNPKQSEGKSSVKDG
FT                   GKVSKSPAKLGLPLSSTLSSLNSNSITSSSKSLPKKDLTAKSSELKKISANIASPKQLV
FT                   LLNKNPEPTTKKLVLKTTSNSNNTSLSSSLPQSKVLMKSPQPVSAVPKPLVPGAKLGAK
FT                   LDLSNVKVAMPKKIEIKTNLIQPKTVAKITVKTKLVPKKL"
FT                   /protein_id="XP_628286.1"
FT   gene            complement(<241964..>243337)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_990"
FT                   /db_xref="GeneID:3371996"
FT                   /locus_tag="cgd7_990"
FT   mRNA            complement(<241964..>243337)
FT                   /db_xref="GI:66362641"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_990"
FT                   /db_xref="GeneID:3371996"
FT                   /locus_tag="cgd7_990"
FT                   /transcript_id="XM_628285.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(241964..243337)
FT                   /locus_tag="cgd7_990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362642"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_990"
FT                   /db_xref="GeneID:3371996"
FT                   /translation="MSRKEHEDDDRGLEKLLEHLTLQNDAFSSSNKLLMNYYKTLKIQT
FT                   CNLMSLIKALICITNPNSLSQEDENCALIVNTCKLKWVESLYNFLNITEHDLETIVISP
FT                   IIESYSLSEAKFELKMSLIKSELNLQKDSLYKNFYSNIIGSLNLIHDSKGIREFVFEAL
FT                   NLFQDKKLENSVTNEEPLFNIFLVKLFNNHNSEEAILITSNQNEGSSQIFCERLNFVDP
FT                   SKYFCFDKCILFNKFNLRFLVYNSAGGLCWSDRICDMNTQFLQDYFFLFKFDNPKRKLI
FT                   FNIISSLNQFISNFMINSIDALNIDQYNNALKLNQNCEFQNTNNSLLENKPSEPLSPIE
FT                   TFNTINKVLSSNDSLLSTSIIKPGNTIQSSIINSINTFTSCVSQEIHLDKIDISSNQVT
FT                   NFSDSSLPIIQRSNSNTTTLSEFIGERNNHTSSSETQNSINIDFFYENDLHSHEWVLL"
FT                   /protein_id="XP_628287.1"
FT   gene            <243560..>244612
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1000"
FT                   /db_xref="GeneID:3371997"
FT                   /locus_tag="cgd7_1000"
FT   mRNA            <243560..>244612
FT                   /db_xref="GI:66362643"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1000"
FT                   /db_xref="GeneID:3371997"
FT                   /locus_tag="cgd7_1000"
FT                   /transcript_id="XM_628286.1"
FT                   /product="F27M3_19 plant like RRM plus AlkB domain
FT                   containing protein"
FT   CDS_pept        243560..244612
FT                   /locus_tag="cgd7_1000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="F27M3_19 plant like RRM plus AlkB domain
FT                   containing protein"
FT                   /db_xref="GI:66362644"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1000"
FT                   /db_xref="GeneID:3371997"
FT                   /translation="MTEEIIYSYKRSKNPSELIHISNLGRKCYFGLEEDLLKEFQVFGE
FT                   VKEFHLGENSNSFVLFANLPASIRFYEHCMQLHAEETPVLIGGRRIKASYSQRVEIKNV
FT                   IEQKNEDYDENKRFLADKGLVLVEDFINKLEAIELLDWIDNNGQWETKLNRKVQHYGYS
FT                   FDYNNKTISSVWERDIPPILNRLIERMLSLKIITEVPDQITINEYEVGKGIGPHIDSHH
FT                   TIGENISVISLGSGILFEFNELSKRKNPDCSSKEGSGSRKYDRISKRTVYIPENSLYIM
FT                   KNEIRYAWEHGIKSRMYDKIQGKFQQRKRRVSITIRKYIESHYNYPCECDYKDFCDSRD
FT                   PSIRILPERI"
FT                   /protein_id="XP_628288.1"
FT   gene            complement(<244613..>262111)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1010"
FT                   /db_xref="GeneID:3371998"
FT                   /locus_tag="cgd7_1010"
FT   mRNA            complement(<244613..>262111)
FT                   /db_xref="GI:66362645"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1010"
FT                   /db_xref="GeneID:3371998"
FT                   /locus_tag="cgd7_1010"
FT                   /transcript_id="XM_628287.1"
FT                   /product="very large low complexity protein"
FT   CDS_pept        complement(244613..262111)
FT                   /locus_tag="cgd7_1010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="very large low complexity protein"
FT                   /note="possible apicomplexan protein, with 2 possible EF
FT                   hand domains in C-terminal half of protein, EF hand is
FT                   conserved in plasmodium version"
FT                   /db_xref="GI:66362646"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1010"
FT                   /db_xref="GeneID:3371998"
FT                   /translation="MPPIWTKSDFLELTIGANWRVPSNILGCDAGSWYSISNSAKFYLR
FT                   VLEKLQNEYLSMSNTTQTTTDLENLRLCLNRIRNSVSYISEEFPWSRLKYMYEKAILRK
FT                   SNLDYKEFHRFIIDTISKVKSLENNHSIILPGIISMDDLKKPIFLLYVVSRNDHHSSTS
FT                   FETIKENHHPKYSFTVINVSGFGTEYHLYTNSLMTNNPTSLMRDSVLVISDIYTERILH
FT                   SAFWISLYRLSFIPSKNNIHYLYTVLLPFLNERNLYDNWITTNHSNSSYKLGIGNIWIP
FT                   NPKRKDFGSSNNLVQSALQFLFQNYSISIFKGVKPEQKANQFQLFLNWSILRLMEEDFS
FT                   YCIKNSDSISFVNACTVISAFIKAFAFEISNYSFGLSIQDHSYILEKRKNDLPFINSSN
FT                   HNNIIPFKEWYQHLSHFKTNFEKMFTCSLFGFGMGSCTLSPNIASNTITRITLYSTFGN
FT                   FGQFRLDGPNIMMLAGESNEPNIDIPIELDSIDRRITCIEDVINILETCISVCILLTTQ
FT                   SESTKNSHLIKFKLIQHIFQDLIPLPLPWTHPQKKENCFWSFCQSQLFRSQQVRILELL
FT                   NSLMRHFLASSFSITFNHKIPQFDRIIIAGAISCIADNIARSFAFDFKSPLSIHLTGRH
FT                   QGPKNWFFVDLINFQEITDFGIYTDPSTVIIRSMILDYFHSTKYYNSDENLRLVPIFSF
FT                   EDKPGTIDEGTIELLMQISTEFGFPSHLSLTKDDQRKMKTFSIPLFFTGETKEMMDISP
FT                   EFYSLRDIFFYLKFVITLNFENHPETLNWNPSNSFLVWNYNSSKDSYQVKGFDKNLECN
FT                   HISTKSLDTKQNKGLWSSFTGWLTNSGDKNHIKSFSKLADPGTIINTFDTLENVPIESL
FT                   VYMNNSSSSIHGSITSSGSRVGAVGPGFTMNQSGLGSIGDIASGSIINQNFMNSSSTGG
FT                   SGYGSSENLNFSSNNSSSSSSSSVSIGDESDILYLKSLPGLSDQLLPSEVERVFQYLTT
FT                   PYLRIPLLLQFFSDENRINSLSSVSVQHIIWMSILEPWQWSPPSSLNSSNRRGSNSDSS
FT                   NSLMLIPVEDNKEISTSSGLLFNEILRSPSTLFKALEELMLMALDKDTGSFSGANSKII
FT                   LFVLRISIIISNYTKHLIRYYENYTRMGLGKVLNMNMNKNDNKDKMVKDSMMIGPMING
FT                   VFRGFEILFKDEKLINTLRQSYIRLRYLIENLYLRMIVDWMKKALKELNISSLCVLYAH
FT                   IASIYGQVFSIDDLDIHSITLLLSSLVFLTTHYSVEDGSSNSNGRTFKKSSSSSSTSSS
FT                   SSSIHQSEKRFSSLYIRNPWGYTLNNILGVPDLDIFTIQARTRSIIIKWLSNNVNEANL
FT                   VLDTVVNAVAMKGIGEIDINNLDLNDDHIDDGLTRGPSTREWIQLPSISGGGRFVPLSE
FT                   IPADLYDWLSCDDIDSVKNKINSKVGSRNTNSSGNSSYRSLNWWRLKRKFSRAIQSRVQ
FT                   RGGGGIGSGSSSGLRSDDGQKETSGSFIDGLGGGGGGGGGGGGVSGSYSSSSPQSRYLS
FT                   TRLEYNEWFRTILSINTETEINVQFSLFSLKNNNLRVLGNWIHEFEDFEDVIRESDDFQ
FT                   KDQLDEEGKEEERREFSNNRLLGNQFQSADIANTENLYWCKLIGSRIDLYKWEAFHKTN
FT                   QITYKTKYSRNSLPKGAEWIVDIFEPWRAIFLGGVTTIYIDDGNSDTNNDNSNNNNKIF
FT                   GSFGSKEKIIMGRNIGKNKMSYKPPDLSNMVRMQFLYPLYEPGEGPESPNQKVASMRNT
FT                   IISRSEFDNVRKKRVNGDNSNNNNNKGGDLGSEEEDEEEDIVSQNVEIVTHSLKEIVIQ
FT                   RFPPVILVFDIVEQGRLYYKQLCHTSNISFSLGSLDNSKFITPFLSTRDFYCDRNGPTS
FT                   LGFGELGVGGGVGVEGGGGGGKFSRLDSNMDGRFALASGMPLSRGRKPSRSLVIMRDYY
FT                   KEPVGTEMYIPSRFLLGLIPQIFLETHEFWQSQSTGNIRGYPRKSKLRLSKVERKKSSL
FT                   KEGSNNSAVVGLGGITREDLKTIRKDHLKKKGEDGDTFEIQDQDKKLKEEPRMHDEDLY
FT                   LLDIFVYPCSDPAQRYGLIGDGISLIQRRYIQNPNIVQTLINLQTLYGSSGEFHSLFNT
FT                   LQRLDDVSHTLLWSNDNPMDSNGTDNLSMELNLDQIEFPRLHLSFVRRERDRSNTLLTM
FT                   PTNMRNSSGFSSGQVRYVCEQHSGLYLSWRNIFDYPLTYELLRGLPHSVLLENDDGDFF
FT                   ILVPATAKPVLIPPIGLSGGTGGVEGKGGVGGTGAGGSISSIQGKEQGIFERFSSTIGN
FT                   NNEGLSSLIYSSTSILSENIESITTAPGQYLVSMASVASQNLFHTAVSALANTTKNVVD
FT                   GTIRKAGEVIIGGGLGGTIGVGTRGVGGGLEQGEGLGGVSSLLFRGTYIMDRGDKVWIS
FT                   KLGPTKHYLYPVHTSKSFIFINSVVSGLYLMLWRFLEQQFESVLSVLDIATSSDMESSF
FT                   SMEGEWSSEEKQLWQVFNSLGHAWDCHPDAHACRLKIWLYCLRHFSASLLLKSRNKIKT
FT                   TNKSLFLASDEFFYSTWDLYPDIEGYVTKLANVSANCRLSLEEELEVLQAFPNFVKDSP
FT                   ELNNRLNLVTCALEKEKSLYSSSILSSSKISNEKRVEKGFIKEDRDLEMIEFQLFNPQI
FT                   PQIDDFDSWMDISCIGVSEYGGVSNINNPISSLWENLSNTLGTLNLPPVVNNNNNSNIN
FT                   INNSGNGYYMDYGLDKSKRSAFLSDGRKMINDNKNYQGGIVSGEDATEFLIKFLGRSTI
FT                   SKMISNAVSATVSGISSGVAAAVAAVSNTNTNNNTNINNITMNNNNNNNNNNNITGGFS
FT                   LDIPFIQDVSSSNTIGTIVGGVGVGGITTTATAAATTTTTTGGGGGTIGGTPVYLSDWI
FT                   FIYELLTGYFPLEVIPGESSHVWGVLLARSLPAWDWKSPSILVSILRLLILNPRLALSS
FT                   RMPRFSEEVKKNKLQIGTVLKSQECFQTLVKDASLILSQEYKSGSLITYSRNYSTNHLK
FT                   SSKNTISSFFSSLFLTNMGNCISQEGNSIKALTISPESRISRWNISLNKGNYNCEERKL
FT                   GCIMVSGSCQINQQDLLCYSKSPILESQNIDKFLIPIEKEQVEDSIYDLPGMLFSHPIS
FT                   RTTIGKSSLERYRNDIREYSRIISNRLDFSILGLDYTRLFSAFCHYHGLLVGSGPGAGA
FT                   GVGVGQGCGVGQGCGAGPGSGVGVGPGSGVGVGVGPGSRVGAVGPGFNLNQSGSGVGPG
FT                   SGSGAGLGPGSGSGSGSGKDPKVRWEEIRQGIMDLRMLLLQLYFKDGQFIDSAISRLDE
FT                   IANGQAGRRSISQERKANKNEKEWFLYWSSIFGKLCGKEPILRFDFLVSQLMSSSSQND
FT                   IKRLSLFVDDEDIQVIHSLTAATMMTVNRRSQVSNALIQLRDIICFLSSIQDELRIREG
FT                   GGMGGIEGGRAGGGGGGGGGGIGQKIHKDFKWLERNLISLEMKLKNVARVLSSKRHYVR
FT                   LLNIRNGVEIVTKEDLEKCKSEDIMALYDPRFLVFEFAYSILLRKDQVELIHKLYNSAI
FT                   KGKSICHQMIMGAGKTTVISPLLSLLLGDSERLVVQVVPHELLEFTRDVLRSRFSCIVK
FT                   KRILKFQFNRNSICTPELYRRLVHAKEQKAIILCHPTSIKSLFLKTVFLFRILRYWNND
FT                   ITSSSGLKMALKYISLSANINKNKLVELFDKSGSSIKQMLKIGSNTTNNSKGGEGIIGN
FT                   GKGGGKRGRKIMGRRKREMRNLRSKEVSSKLVNEVLNNEDKEELYLQYKKELDLCLRIL
FT                   HIFKYESVVIVDEIDMILHPLKSELHWPIGEKIPLDLSGDLDQDYSHSHDHSSIFISDN
FT                   INYCEGERNEYFGSKQIIQDHRLNNFNNNSHGIGVGTEVGAGSEDGDYNINNNSNEFYS
FT                   STLDSIGMRWLIPWYLIEALLTKPNQINLLSNGQMLKSGSIVNLLIKIQSKIESGISSR
FT                   SIQSNPHLVLLDEEYYEKEIKPLLIRWIIFVIRLHKFSGLSDELCELYLSTRGSLKLGP
FT                   GSGVGVGPGPGVGVGPGSGSGQGYESGPRIRSDHSTTKGTQENTRDLNFSTLISKLDHL
FT                   DDSSMKILNLSKDWINEYLPHVFQLVHRVSYGLLDESTSGISRRNWLGQRFPEFKTIKS
FT                   EKDITKTTTMTEQTPPLSRHLLSIPFIGKDTPSVASEFSHPDVVIGLTILAYRYNGLRR
FT                   NDIYHLLDSQKRSCQGGFGQLKDRPSVLEFNKWVKLSGGRVRGTKRDQLKNMISSLNSI
FT                   DHQKNNTTPDLISNFENQSEENNIKTNKKMNKLINSIKNNNSNNNNYYYYNNNKSSSQI
FT                   DQICLLWPLDVINLQDHEQLEQLYQLLRFQPLVIKAFLGRLVFPELLEYSEKQLSASGQ
FT                   EIGGEMLFSTRLGFSGTPSELLPVELGKCEYEKGSDGEMINYLTNGEIISSIEILDVDW
FT                   TVKEFLLNICSTCRNKEVHALIDSGAFITGLSNVQVAEFLLRNGLKDIDAVVFIDDRDK
FT                   QMIMLRDGFRIIEISQCGVSLERRFAFYDHVHSIGQDIKHTPLAKAILTVSKDMIFRDF
FT                   AQGAYRMRQLGQGQTIHIVLQAQVADLIERNAILCRMISERNLFTKSLNESFTSENNNK
FT                   RNKDLISLKGNGNNFEIPNPLLFLRCLCGWLLIQSIIKEFEQNQLLCVQSLENIWRKKS
FT                   FRRMVNEHIQWEEDCNSNENQDKLVDVFVEKLSFEIPSTVPFNIPIKDQLRNKLLDNRD
FT                   IIIESNSFGSTNSFVVNNGTEGPEIKLANHLLEQLEEMSLYKGHQADKVRGGGLDREME
FT                   KELEMELEIYQEKELEQEKEQEKQQEKQQETENANLTLKWAKPSLDVSKDFWPFEALLA
FT                   GNAMLSIGVEGGAGTGTGTGIKQTSSCSTHNNSSNNNIGRKKIEDFAPFAFFTTSKGSG
FT                   GGINRQASTITCPNLENIFLPLSEYYVISSNTTSNNCIDFPNHLRFTTNLYNPSIARNY
FT                   SNNSNLQQRLNNFNIIIEWENFKSSNNNNHLPRDYLIQLKEAFAVFDGDSTGKINLDDI
FT                   PDLLKTLNWVENVNLFEKEILKCLRLKIKSKIKNQDNNNNNNTTLVPNGNDKSSIKTVN
FT                   NLLSVENELNDNNNTNTNNKIRIEKDEELLDFINDHPWEKSNNMNDNQLIEMDSSELIL
FT                   ESSYLQEEEKKINIDFEELYQVMNSVLNTSSNKCYIGVTLEEAQSIRWIIHRICSDTDD
FT                   GEILRKTLNQKINNQFFSIKIYHLSNTLLLLDEINNYIISSFSKPYSQFDNNNNIPIDF
FT                   LEKVKQENNIEKINLLELQAQSIYKFVNSESNFTKQEISTVVRTLQNNHCKLRKDFYMD
FT                   IKKCRRRNKKENETNLLDNNNLLSIIFTTPNESAILQCRGLASRLSSKLNKFNMTILDL
FT                   FKLLDKNQTGSISSIHLYASLESLQIAPNPLDYSRIIHFVFGNNLPDLANDLNSLHHIS
FT                   ISQENFMRAFYTHKNYYNNNSSINNTSCLPSLPKIDDSMINQAESKLKHNMNIYRDSYN
FT                   NGFGGIDGLGIQYFDPIFLSKLKCKLNLHSNFHKVFEIPGVITIWNPEQLEGKYRGVMK
FT                   KNRERICLGQYGSGNYDFTINSSNNSSGNFQSQILEITDHNSSSMSESSELKKFVSIVF
FT                   PHPKKFKPIFKGSLLIPNTNMETGIFTIWKPIPPSNQFVSLGVIVTKGDEVPSINTIRC
FT                   IPVHWCRIVNYRSLPCIGSLQQKPTIGQKISENKNSNTIIHPVSFCLTSNLQVLGAVVN
FT                   LKNHSYSEHANISGSFVNKDEFIQIYNKLYVPADEKIANVLNYREILDRNVLFSRLFWL
FT                   DIAYSEIAVHYLNNNNFEDNKTIEGNKQQHNSIPQVINCSYLIPQISNKKNHISNNHHI
FT                   SLFGI"
FT                   /protein_id="XP_628289.1"
FT   gene            complement(<263294..>263728)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1020"
FT                   /db_xref="GeneID:3371999"
FT                   /locus_tag="cgd7_1020"
FT   mRNA            complement(<263294..>263728)
FT                   /db_xref="GI:66362647"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1020"
FT                   /db_xref="GeneID:3371999"
FT                   /locus_tag="cgd7_1020"
FT                   /transcript_id="XM_628288.1"
FT                   /product="G10 protein"
FT   CDS_pept        complement(263294..263728)
FT                   /locus_tag="cgd7_1020"
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="G10 protein"
FT                   /db_xref="GI:66362648"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1020"
FT                   /db_xref="GeneID:3371999"
FT                   /translation="MVKQFTNVPIPQGWDQIKDELEKYNEMMREAENSSTKGKKKNEYL
FT                   WPIYRINHLRSRFIYTKYYLDKEISRDLYEYCLDHGYADKDLIAKWKKQGYEYLCCINC
FT                   ISTSNTNYGTTCICRVPRDQLQDDGEDIECVNCGCNGCST"
FT                   /protein_id="XP_628290.1"
FT   gene            complement(<263999..>264751)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1030"
FT                   /db_xref="GeneID:3371870"
FT                   /locus_tag="cgd7_1030"
FT   mRNA            complement(<263999..>264751)
FT                   /db_xref="GI:126652497"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1030"
FT                   /db_xref="GeneID:3371870"
FT                   /locus_tag="cgd7_1030"
FT                   /transcript_id="XM_001388334.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(263999..264751)
FT                   /locus_tag="cgd7_1030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126652498"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1030"
FT                   /db_xref="GeneID:3371870"
FT                   /translation="MSKKTLPRAISIDCEMVGCGENGHISVLGRIAVVDDKLKLLMDAF
FT                   VKPSMRVTNFRTKWSGLTWDKLKYGESFESIQKKFLQIVEHYRKESTSGLVFVGHDISN
FT                   DFQVLKWTPPESEIRDTCTYFPLRKLLIKSLLEKGEITHHQKEGFLRQKPSLRSLSKHV
FT                   LNLNIQQGSHCPWEDAKSTMMLYLMVRDRWEALVYNRNSITNSPTTIALNNEQNEDLGE
FT                   AVIPHNKKKKNKKKKDIKKGKHVTINGK"
FT                   /protein_id="XP_001388371.1"
FT   gene            complement(<265421..>265987)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1040"
FT                   /db_xref="GeneID:3371776"
FT                   /locus_tag="cgd7_1040"
FT   mRNA            complement(<265421..>265987)
FT                   /db_xref="GI:66362649"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1040"
FT                   /db_xref="GeneID:3371776"
FT                   /locus_tag="cgd7_1040"
FT                   /transcript_id="XM_628289.1"
FT                   /product="Imp3p-like 40S ribosomal protein S9. S4 RNA
FT                   binding domain"
FT   CDS_pept        complement(265421..>265987)
FT                   /locus_tag="cgd7_1040"
FT                   /gene_family="HOG000213883" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Imp3p-like 40S ribosomal protein S9. S4 RNA
FT                   binding domain"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362650"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1040"
FT                   /db_xref="GeneID:3371776"
FT                   /translation="VGEVLMRKLKFHEQKLLKKVNLYSWKKEDNERETKILRRYYIQDR
FT                   EDYTKYNKLCGLITKLVSGIRKLPPEDEFRKTTSEMLLKKLYHMGVIPTYKSLEAINEL
FT                   SASAFCRRRLAVVLVQLKFCPNLKDSVKFIEQGHIRIGPNTITNPAYHISREMEDHITW
FT                   TQGSKIKSIMQKFNNEYDDFDFLGN"
FT                   /protein_id="XP_628291.1"
FT   gene            <266304..>267623
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1050"
FT                   /db_xref="GeneID:3371871"
FT                   /locus_tag="cgd7_1050"
FT   mRNA            <266304..>267623
FT                   /db_xref="GI:126652499"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1050"
FT                   /db_xref="GeneID:3371871"
FT                   /locus_tag="cgd7_1050"
FT                   /transcript_id="XM_001388335.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        266304..267623
FT                   /locus_tag="cgd7_1050"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126652500"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1050"
FT                   /db_xref="GeneID:3371871"
FT                   /translation="MEENILGYYRKAYIRTEFPMNVYSTNDFSKKATEILSSLLELTYS
FT                   STLNFQLQNEINEGINSIQVGTYYEEIEKMLHNELDLEKDMHMKYVDSLTLQRLKNLSP
FT                   SRVTRNRLSRIPGKIVRIPTGLVSLKEIEQNRRREIFWNSYFLTRLCRNTRLRRQFVSV
FT                   NSIVLPHFLSRKRYSLSNTNSNHHHSNIERERKGESKNQKEREEESKSEKERERKEKKE
FT                   SKSEIVKDGTIIVTVSFYHQIRGMKISEFDILETQTLSELSNSFICHDSKQEEELLGFH
FT                   PTGDCFEINGDLYLNGTDDIKSNFINTLSGFTMKSNPQIFDMKNTQISHLNIPINSHST
FT                   YIHSGDCEHRVTFTNIRLFNSKYDSPYKDSYPIQIYSHSRTLTFCEICGINQVTKVIFN
FT                   SLNLPRNPSQLCDSCTFIFLYDKNTKQSIEKCIIRSINNK"
FT                   /protein_id="XP_001388372.1"
FT   gene            complement(<267710..>268753)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1060"
FT                   /db_xref="GeneID:3372000"
FT                   /locus_tag="cgd7_1060"
FT   mRNA            complement(<267710..>268753)
FT                   /db_xref="GI:66362651"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1060"
FT                   /db_xref="GeneID:3372000"
FT                   /locus_tag="cgd7_1060"
FT                   /transcript_id="XM_628290.1"
FT                   /product="apicomplexan conserved protein with 2 or more
FT                   transmembrane domains"
FT   CDS_pept        complement(267710..268753)
FT                   /locus_tag="cgd7_1060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="apicomplexan conserved protein with 2 or more
FT                   transmembrane domains"
FT                   /db_xref="GI:66362652"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1060"
FT                   /db_xref="GeneID:3372000"
FT                   /translation="MEKFRQFADESTGINPYIPIWGQTKTSILRKIIGFPILITRSIIL
FT                   SICLIMFTIFSMVIELMYLEHLRIIFFSIFLNGLSRVILLCFGCIWISENLDKNTKLSS
FT                   SNDEKKSKTTRKVIYVNRQGFCDIFVCSSILGDPEYLFMDNSGIYLASNSFYALLFSIG
FT                   LKKNIRGGISFITSSNKLKSIYNNSLRPLIVFMEEVNTNGTCILEWTKMEKIPDTSEMR
FT                   DLFSENSESIVIQYKLERSLYGPQFTTGDFINHLINMLSKITHFKIDLRIISSQVMKNR
FT                   ISRKNDDKNSNISLKDLQKKRRIDDLLTNIQNIQGKSCNLPIVTSGAEEAQGFIEYWEK
FT                   TNKGKSI"
FT                   /protein_id="XP_628292.1"
FT   gene            <269870..>270193
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1070"
FT                   /db_xref="GeneID:3371777"
FT                   /locus_tag="cgd7_1070"
FT   mRNA            <269870..>270193
FT                   /db_xref="GI:66362653"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1070"
FT                   /db_xref="GeneID:3371777"
FT                   /locus_tag="cgd7_1070"
FT                   /transcript_id="XM_628291.1"
FT                   /product="snRNP core protein"
FT   CDS_pept        <269870..270193
FT                   /locus_tag="cgd7_1070"
FT                   /gene_family="HOG000166937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="snRNP core protein"
FT                   /note="similar to Sm-X5. SM domain containing protein."
FT                   /db_xref="GI:66362654"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1070"
FT                   /db_xref="GeneID:3371777"
FT                   /translation="NFSIKLFFNFLQTLIEKQVVVTVELKNDLQITGTLHSIDQYLNIK
FT                   LNNTTVNQNESFIHLGSLKNCFIRGSVVRYIFFPPSEVDIELLQKACRKELRSMNDCKE
FT                   KQK"
FT                   /protein_id="XP_628293.1"
FT   gene            complement(<270576..>271625)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1080"
FT                   /db_xref="GeneID:3372002"
FT                   /locus_tag="cgd7_1080"
FT   mRNA            complement(<270576..>271625)
FT                   /db_xref="GI:66362655"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1080"
FT                   /db_xref="GeneID:3372002"
FT                   /locus_tag="cgd7_1080"
FT                   /transcript_id="XM_628292.1"
FT                   /product="eIF3-p47 with JAB/PAD domain"
FT   CDS_pept        complement(270576..271625)
FT                   /locus_tag="cgd7_1080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eIF3-p47 with JAB/PAD domain"
FT                   /db_xref="GI:66362656"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1080"
FT                   /db_xref="GeneID:3372002"
FT                   /translation="MSIYCAQNNIISESDGFLISHLSDTNLTFDSLSKPSIISCRVNPL
FT                   VILSILDSHLRRQSGHQYVIGTLLGYINEGGNVIVTDSFVDRHSFTDDGMLSIMIDTHE
FT                   TMFELKQKTNSRLQVIGWYSTCSGINSVSCAVNNWFKTDIGSSKFQQTPLLSEPIHIVV
FT                   DPSFSNGKLSINGYIQIQSTWTNSIVSIFRPIPLDIVASPCERLHISRILRPLLEKHHL
FT                   NAVGIPPKSLPRTILGPEDEICTVLPLNNSNYSLQSGDVSQLLTKLILLVQRCQNYVKK
FT                   VLSGEVSMDPMIGRQIDYAIHSIYDFEYNIYNIIKSNSTQDALIIGCLTELTRVQLSLS
FT                   EKLQSLIIT"
FT                   /protein_id="XP_628294.1"
FT   gene            <273303..>274493
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1090"
FT                   /db_xref="GeneID:3372001"
FT                   /locus_tag="cgd7_1090"
FT   mRNA            <273303..>274493
FT                   /db_xref="GI:66362657"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1090"
FT                   /db_xref="GeneID:3372001"
FT                   /locus_tag="cgd7_1090"
FT                   /transcript_id="XM_628293.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        273303..274493
FT                   /locus_tag="cgd7_1090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362658"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1090"
FT                   /db_xref="GeneID:3372001"
FT                   /translation="MVSSRSASPNRRGSTGSSSISSINTRIVPFISNYYSLLGDSPNSL
FT                   IDLHVSNPDPHLKWQIPSFIIGGNPRLQGSTIIDNGIISIKSFGKDTLHNLFSSLPTIT
FT                   CKIPVEIMDINETTENIVTVSIHGYVISGIERLLFFQVLQLFHQIDLNNKDNFLIFNNI
FT                   FYVFPIPFDMKSIRSLQTFSNQHSISHSFSLAHTPKSTGSEDYDNNTNEIGHETTGNHS
FT                   HNLSYQQQHQHSTHQQNHHVKTFPTYQDSKKTTKIKPQIKIHGLSANSGLSDKDILSAV
FT                   SFQLKNSNEGFAIAINRNNDEAIIQVDSVQSQELLSQRGIYIQGLKYKVSNVVKKSNSG
FT                   IKGNRNSNKNNNQAEVSGPSSSSAPKKMNSHKKESIPDKDGWITVTSKGKSKSKTF"
FT                   /protein_id="XP_628295.1"
FT   gene            complement(<274498..>276510)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1100"
FT                   /db_xref="GeneID:3371842"
FT                   /locus_tag="cgd7_1100"
FT   mRNA            complement(<274498..>276510)
FT                   /db_xref="GI:66362659"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1100"
FT                   /db_xref="GeneID:3371842"
FT                   /locus_tag="cgd7_1100"
FT                   /transcript_id="XM_628294.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(274498..276510)
FT                   /locus_tag="cgd7_1100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362660"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1100"
FT                   /db_xref="GeneID:3371842"
FT                   /translation="MDNKRYSAFSFDTPIKRGKDSLSSIDTLRSVVTTRNNNEGIDNKG
FT                   RWSIDSFGSNDYHKAEKSSFGTHLAQKPDNILIHHSKERKLIMLSNSVQSIPKSRYTSL
FT                   INSNDKLIGMEKNSVEDDFQIKEYMIDLMPIKKDQHDNDTLVLQEKFDEDIIQKNNKDQ
FT                   SIIPNIPFSLCISYLRQERSQICNKLHSVWKGYKTRSILRGSLQGITLLKTSNSDGFIY
FT                   SFGKIYLGYNIHKILLSIIDLYDLILDEESKVFQGSSTNNNSTSWLDAMYEQVYDFKTK
FT                   YILEVNNSLKGNNGKNWVSDILNARETSKKDISRKLIERKGSLPKRFETKYNEKIHKNG
FT                   LFYKSNKIMDRNDDLVDQNFSQKSGVGGKRLLEKDCDQDNGNKTLESSSDEIFDSIYIP
FT                   YSLVKSNSLEEISTYLGVKTDKILDMIQNKSDSKDMINNKNNIIARAIGFDLTPGIRRK
FT                   TGELVREQSPFLDKITPNTLREGGSNPNIYFTPNSLIHGSCKEGNDCGEYYTPIQEFGD
FT                   SIIDQNGYGSDEYNTENQGVTYRIINQIKPKPYLKRKSKSIVPSKGTDIELDKVTSKVK
FT                   ELYKGKNLVEKKVLRKVPVSGVYELSGSRIPSISSTLNIVSDSPSSRNSSSKVSRIPKY
FT                   TGTISRNNVLKNSQNSKGMDNSSTPQIIRSRYSDF"
FT                   /protein_id="XP_628296.1"
FT   gene            complement(<276800..>278029)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1110"
FT                   /db_xref="GeneID:3371844"
FT                   /locus_tag="cgd7_1110"
FT   mRNA            complement(<276800..>278029)
FT                   /db_xref="GI:66362661"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1110"
FT                   /db_xref="GeneID:3371844"
FT                   /locus_tag="cgd7_1110"
FT                   /transcript_id="XM_628295.1"
FT                   /product="shares a domain with the CWFL/SRm300 family RNA
FT                   binding proteins"
FT   CDS_pept        complement(276800..278029)
FT                   /locus_tag="cgd7_1110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="shares a domain with the CWFL/SRm300 family RNA
FT                   binding proteins"
FT                   /db_xref="GI:66362662"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1110"
FT                   /db_xref="GeneID:3371844"
FT                   /translation="MYNGVGLRTARGSGTSGHVQKNLSAYIPKQWERKNNKDGINSKSG
FT                   PRIPRTTRHDPELIEHEKLRKMELEILQFTEEQESKGLKGADLEEAVDRKREELALLLK
FT                   KNSNSIRNYKDCNGSFDSRKEIGFVSSQFGDNVDKLDSNQLSRLKEEELKVFRSALGLD
FT                   KPTRGRYKQRYNNKRSRNEITFRNKMTNEDWENEQERERNERREGVSSKKGDIFTQEVN
FT                   NEDGLGQRNFENLREDFGNYNKDNQDNIDEFEGVNKAQIRRKLGLQSQMNSKSYFESSP
FT                   KPRSHSYSYSCSRSHSNSSPHSYSNSRSYSNSPSSSQSKSNSYSRSRSNSYSKSRNSYF
FT                   NNYKQKSSKKKVKREAYSSSVRNLAELDSLERKKKHRYRKPRRSRSPSTVSRYRSFSRS
FT                   LSPQHLALAG"
FT                   /protein_id="XP_628297.1"
FT   gene            complement(<279030..>280805)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1120"
FT                   /db_xref="GeneID:3371778"
FT                   /locus_tag="cgd7_1120"
FT   mRNA            complement(<279030..>280805)
FT                   /db_xref="GI:66362663"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1120"
FT                   /db_xref="GeneID:3371778"
FT                   /locus_tag="cgd7_1120"
FT                   /transcript_id="XM_628296.1"
FT                   /product="3CCCH domain containing protein"
FT   CDS_pept        complement(279030..>280805)
FT                   /locus_tag="cgd7_1120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3CCCH domain containing protein"
FT                   /note="this domain expanded in plasmodium; transcripts
FT                   identified by EST"
FT                   /db_xref="GI:66362664"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1120"
FT                   /db_xref="GeneID:3371778"
FT                   /translation="FPDSTINNSEAKMDNAFNTNLYGVSTEPIPSMISLGGLNGNLTRN
FT                   NGERIIESLVSGGVDGNNTLGSRFDGQDDSVTADVDTEGSEESHNQYWKTKLCLMFSKG
FT                   ACKNGDNCRFAHGSEDLRTPVNLKKTKLCPFWLSSACSIGENCPFAHGTTELRVTNDFY
FT                   KTSVCRYWKMGVKCDAGVLCRHAHGEAELRKKTNKHLLRRKDDQLPPSIREDDLILPLR
FT                   SNKFNENSRFLFQVPPPPPLVYSSSGQPVSSLGKMRQSHSHSNLHSNSRTGLGFNTQSI
FT                   QAKTLPPILRYIDQEGEGDHRMKRNYSCDDIFRKGECFSNSQSHPNLQNHSHPQPQPLP
FT                   PQFNSFHDNQNSDITNVPCIRGSSSLNNLRSWDSNSKSDQLNTSQDNIFGLVGLDKDPG
FT                   LSSASIIKNRFQDDDSEKQLLDLRSNETDLSSFCSLKRMEDSSNSLVSNISDLSFGDDF
FT                   LGGVLNNKLQNHQVLKHSPGHMLNSLFNCNTDNHSGSATGHNCPPSSIVSEKKRDEINC
FT                   LDYFKNVADVVPSEGFFSKVSQFTNSSEVTHSPILVKIKFLDSAEISSLSTGEVPAILI
FT                   PSEDMKSAKVHFLSI"
FT                   /protein_id="XP_628298.1"
FT   gene            <281786..>285844
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1130"
FT                   /db_xref="GeneID:3371845"
FT                   /locus_tag="cgd7_1130"
FT   mRNA            <281786..>285844
FT                   /db_xref="GI:66362665"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1130"
FT                   /db_xref="GeneID:3371845"
FT                   /locus_tag="cgd7_1130"
FT                   /transcript_id="XM_628297.1"
FT                   /product="protein with 2 bromo domains"
FT   CDS_pept        281786..285844
FT                   /locus_tag="cgd7_1130"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 2 bromo domains"
FT                   /db_xref="GI:66362666"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1130"
FT                   /db_xref="GeneID:3371845"
FT                   /translation="MNEILENKITNGNPVPNSDEERSLGIDQESYSEISAPQKPKIEGK
FT                   EETGYGQGLNKEQDQNLEQDQEQDHVQEQDQEQEQEQEQEQEQEQDQDQDQDREQEQDQ
FT                   EGAASERIEGKTYSQKTDGDASSVVTQTSQNAVSEIRIPRGRGRPPRNANRADIGPSGL
FT                   VSITSIWADDDKPKGKRGRPRLRPLEPEEKVEPEAAPNKPLKVKRPKGPKDIMYEIIHR
FT                   LYKRDKQQIFAEPVNAEFVPDYYQVIKNPMDFSTMRKKVSQDEYKDFDSFVDDIKLIIT
FT                   NCYTYNKIGTMVYRMGLILEETWDKSLEGSRARYEQSIKNVEEYEEKKKAGEIISDSEP
FT                   ESQPVWNNTPTSPPTVESPNSSNQRSMVTRRMEARLSSSHSPWISKGSGGPGAIGGSSG
FT                   AGSGIPGERDSSTGPDFMSRRALGGHPFGGSMAYRGGELGRHPPYPGGVPGQVHQNTKP
FT                   KGPTLADICKGGVTSIKENLEKLKIDRFEPFNSLIKQLATQPCIRTPTVDDWYVFDKQL
FT                   SEIQYRNSVKRFIGDDSIQALKKIMDIETALLEIDPHPAISKLPLSDTRLLGIDTDDFA
FT                   PFNQNLSVDGSFLLGVGDNHIKVALTLQDEVPSLDLTPLKELVTKYTQHPLSTQSNGAS
FT                   ANISQGPFPNSSGVSVNGVSAGAGAGLGGGVGSGTAHIGFPKPSLGGGTNQGGLHASLS
FT                   HLQTSETKPELPPSQRPAMAGNEIKGQDLKSMHYNGFGVHRGEVLPGTTETSGVSNVPL
FT                   SQVGQTHAHGRIAYKHGYPPSLGSGPGSGTGSMPISMPVSGTPGKPSVPGTSGVGNSNS
FT                   YYEVCPPAKVQKFEQSHYPTHSGASHAFPSSHSVIPPHSVHTVHPTQTSAIPKQGVQAT
FT                   APPSGGNKPGVPLNYNQVHGRGIQHGGQMHAQGHGPGAGLGHLNGHRIQSTNLVANPTN
FT                   SNNVSPVSVGNNTNQNMRVSASSPTATTSTSNAHLSVNLNMASNAAATTTNASVSANSI
FT                   STAQTAPINSTANIASANTANNTVNTPLGNFVPSSVVPGSAVTTASISGGSKMNHIGNV
FT                   PTSAAAAPTNSSSISPTANVSNIQYLNSNDVRRISDKLNYSQNMMGSQVHHQGHLVNRT
FT                   HVSNPGSHYLQMNASSGNHIGAGAVGAAMVTNTNQRIDHAMSGNIGQQKVITSGYIQNN
FT                   EYMARGADPNVGGGTNNSTTNKNNNSGNSGNMYELYQHNAKKPEMPIDIREERARLDQN
FT                   MYMVEGMGVNGMNMRSRQQILQMQSHQNSVKPPHYHHQYPPQSQIPIHKSHVNNGNVSN
FT                   ANGSNNFYQKYNNNTTNSNSNIQYHNRNISPMGQASSNIPNIANPINNLTSGSSQYPQD
FT                   GINHLGQKK"
FT                   /protein_id="XP_628299.1"
FT   gene            <286524..>289948
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1140"
FT                   /db_xref="GeneID:3371872"
FT                   /locus_tag="cgd7_1140"
FT   mRNA            <286524..>288821
FT                   /db_xref="GI:126652501"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1140"
FT                   /db_xref="GeneID:3371872"
FT                   /locus_tag="cgd7_1140"
FT                   /transcript_id="XM_001388336.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <286524..288821
FT                   /locus_tag="cgd7_1140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126652502"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1140"
FT                   /db_xref="GeneID:3371872"
FT                   /translation="NLEFLPNINRLSNEPIDIANVSKQKLQKQLSDLRRKSVNVENIPS
FT                   RSQQEDPLSFNELNNGYTGVLINTSGSLGVNSHGFGQKYGSAISNLQAELVSLKKEYSQ
FT                   LEKQYKQELLRRSDLEELKRTIKDQKLHIRELQNELSDEKRRSKTREMSIKNKNNSESV
FT                   TNEQWKDMLARSEQEKRQKQTQLTEKEAECSKLIKQIKSLNNQLEELRELECISKNKIS
FT                   KFESEMSNNMDNLEEIKRLSEENKSLTEKTDKISNELNEILYNREFLVQENEDLKHLNK
FT                   EINEKMELISKERDRVIMEKNDLQNEVNERREENARLATIVEELSEKRKDFENTVFDYK
FT                   LRIDVLESESKDKSHQIEVLTNSNDQYKEKETSYVKQLDEKIQTLDKLKKELDILRKDK
FT                   SNTICSLEDRIKMLDISNKKSEEIISELTKKNEELFRKNNLNNEISEEKNEAIAKNIEL
FT                   IEINKNMQEQINEKIKENQELLKEIKLKSQALNDGENRFKKILSEKEEIINQLNQDLDY
FT                   AQKQMKSLRMNEESGLEKINQYIKEIESIELEKESLNQHIQDLNLKCFKFETARNYLES
FT                   KLRNYLENHGLKSLEFEINDNDSNDNNSEVKNKFIGHGIDIIMEEFRCLKENNEKNESI
FT                   IKEKDEVIETISKEKEEKIESIIKEKNKEIEIISKEKEEKIESIIKEKNEEIEIISKEI
FT                   DAINKERKEQKFLNNWKNCRKLLLKRKKLWITQKEKTELEISLERKKKNLTWLLWKRKK
FT                   RKTMNPKPKLSI"
FT                   /protein_id="XP_001388373.1"
FT   gene            <290391..>293966
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1150"
FT                   /db_xref="GeneID:3371843"
FT                   /locus_tag="cgd7_1150"
FT   mRNA            <290391..>293966
FT                   /db_xref="GI:66362667"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1150"
FT                   /db_xref="GeneID:3371843"
FT                   /locus_tag="cgd7_1150"
FT                   /transcript_id="XM_628298.1"
FT                   /product="uncharacterized conserved protein"
FT   CDS_pept        290391..293966
FT                   /locus_tag="cgd7_1150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="GI:66362668"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1150"
FT                   /db_xref="GeneID:3371843"
FT                   /translation="MINLSGKLCNLENYKKLCGEILAYSGNLKRSRKLTQIEQEHSCSD
FT                   LSFDPENYHLTNLEKPCSEKELVENIRTVAEVLIWEDQNDEQGYFEITCKFEIFPTLVE
FT                   LVIHIDVNYSIKKQSLQTLSIILQNIKNINTLYYILSNNIISKLLNNTFKSGNLQNVRK
FT                   DSYEIDLNISIINKEEEEEDELLSYYIVLLRTLAFRLNGETLRLFLNQSNEFPLWKNAC
FT                   MYINHRDSMVRNTSRNVLLNILRTREKEIIDYIVLEEIKQFNHQGHLEEAMRYIQLDPN
FT                   LIQDLFNQSLSSDQNHSTSIFQILISSIIKQIHQIGELSENLDFQWPEILEYIGIITND
FT                   YQESSHNYDDETTETKESINTSSITATSPITLSYTETESPDEYKSPIINQLNPTFYDRL
FT                   IKPLSKQIELILDLMELFHEFVFLQIQSVSWLFCNSLIHQVFEMVLFQKITNEITYINQ
FT                   GITKNTLPIKIYLYITYQIILFLYNNNQNKIYDLLISNIWDKFLKLGNQQSLFGNIFST
FT                   LINYLEDDSELVLIFGLLSLYSIWGKKQKEVKESQILDHSTNINSFKTVETNQKIKEMN
FT                   FTKKSPETLTLDVVPSLFQSFITNFSSFFQQKDDQEFLIQEIYRRKNIKDISLIEIELM
FT                   NSISSNLSQRQKLINQRSFLHRRCKSIPSHWKYSQEDENKVLYDLESSNTLMKACINEQ
FT                   ILRKDFKSIISNSELLIKKEFQNFYSKLNFEILSQELKKNQKLEEFFLFFAQFLEKIVH
FT                   ISEKNKNIIKLRPLCLFVITFLTFGVIQDHETVRQSNYFNDFCLLLDSFMKYFTSITLR
FT                   HIGDLLRRDLNSGEKYSVFENIGNLNYMICEHFLEWKDEDELLILRMFENYEKTFLWTQ
FT                   KVISNFCILPLVEDSCKRQETRRYIWNLIDTYPIFRWFPNNCCDFFFEEERSIKSRSIF
FT                   IDKLRSNYNNLQILETFCKMIKRFRKDNNERELEEKLKLDENNNSKLISRKMRILIESK
FT                   PYRVSIIRASKGKSDSKVTKNIQCNVIFDLIRGNIVLTSFQIKPEKKSIMLAKFKIIRC
FT                   KPVPILTRSYKTAIRYLVALLVRYRKYELEEDVILEDILYELPLREDLLNSPNISRGAI
FT                   IQPRETKVNKRVYHLKNLLLPYYTRVGMDIRKDEFCKDLNFNDYALYIEFESKKKSEEF
FT                   IRRLNELRYDKHIEKMFEEYWKIFK"
FT                   /protein_id="XP_628300.1"
FT   gene            complement(<293959..>298149)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1160"
FT                   /db_xref="GeneID:3371847"
FT                   /locus_tag="cgd7_1160"
FT   mRNA            complement(<293959..>298149)
FT                   /db_xref="GI:66362669"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1160"
FT                   /db_xref="GeneID:3371847"
FT                   /locus_tag="cgd7_1160"
FT                   /transcript_id="XM_628299.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(293959..298149)
FT                   /locus_tag="cgd7_1160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="PRP2'MLEL1 maleless.  DSRBD plus helicase (similar
FT                   to animal versions)'"
FT                   /db_xref="GI:66362670"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1160"
FT                   /db_xref="GeneID:3371847"
FT                   /translation="MSKKTEKTTNPDPKMKKGISNSGTKNISEENQGKKLSSKTNVNSG
FT                   STKGEEIEVKKIPLFEMKPYMRTPKVLLNNYCQKEKRPKPIYNKLVANKGMFRYVVILN
FT                   DPKGKEENSMRFETKESFINNDLAQHYAALLALRHLEGSRPLYKLFPAPLDEAWLSMDT
FT                   NNPLVSRNNEFVSQKEKALFKSEKKRMQAEKKNKIDISDQKQKLEIPRLSMSYNIRKKT
FT                   IGIVTKHFPMLSKSYSFKSWLFDNCNNFSGLPRLVSRPKLVSLNLERMNDIMKEKYSSF
FT                   LKSNGLNVKMILLSLKYWCGIDNKDKEGIIKLIESCGFDNERSLTALNVVMKEIDEYNK
FT                   SMKDSFKLQKGVYMDHFRISNICIVTDVEISSYPKHYIAWLCIMWLSIHLKENDLPQLI
FT                   TPKKAQIEVKDYSNSKESKNEEIDLISDKIKNLFVSKLENNSKSDYEIEEISKNSPKPP
FT                   LESANLFKARRYDHLSASMNAEKIIEKLKSNQILVVKGETGCGKTTQIPILVYEGITQF
FT                   TEGMIYCSEPRRLAAISVSTRVRNEAIKENQHVKKHLVGHSVRLDHYVTNSTKLVYCTH
FT                   GILINIIKSELMGISSSDIDTNQFKIPANSVLILDEAHERSLDVDLLLYFMKQLSYKRS
FT                   DIKLVIMSASIDVFEFVKYFNKSYNDKIESNTIITAIQEQINKESVFKIDTINLPGRTP
FT                   FPIEVSYLPLKQKKQQNTQSQNNNGVSSTQDDDEYLDLGSNICKPLDIPKLKDHVLNII
FT                   KSLGNQEGSVLIFLGGIGDVNHLTKLLKREFDENEQDQEGFEDFKEKVQLPIPLHVLAC
FT                   HSNVNYNDQLEIFKPVKGKRKVIVSTNIAEVSLTIEDIRFVIDTGRVRISIYDPIRHVT
FT                   SLQEVLISKSSAQQRMGRAGRTAPGKCFRLFTEEELQSQSLEITPEILRLPIEHIILDI
FT                   LCYLGNLPPDKDSNLASSRGLRNSFKLIQLIHSLQDFFTPPSLSSIENSLLSLRNYGAL
FT                   DDQFRITPLGELLSRWPVDLSIGILFIYGLIFDCIDPIVTIASFLTCEIPWKLEERHLP
FT                   KSSTNCDYMIFIKVYNFYLEHFKSNSKYKTPRLISNLENIENHQLPFDPKCLDISKMET
FT                   IYQTKNHLLRVLSIQETTNEKIDEAQIFSKWNLIQTCLAASLYPNVACIRLPKRIKYVE
FT                   SGNGLFAETIQFNKLLLFRKNRLSKKSIGHFFTPQPKEKPITISQAYDIVKESQDVSRV
FT                   FLSESTAIYNRMYDLGTYHCIMYMSLFQSFAQKKTVLRFPISISMYSLLLFASDSLQLN
FT                   PLSLINQMKKISLNPNHPKSKKDQPNDQNHIDPEDSLNHILIDDWILLQCPGQIQSILW
FT                   YFRYVVRDFIQFLSQKLLESKSLTPLSSNHSEVNTLFTVKETNEILELLHFLI"
FT                   /protein_id="XP_628301.1"
FT   gene            complement(<298845..>302069)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1170"
FT                   /db_xref="GeneID:3371846"
FT                   /locus_tag="cgd7_1170"
FT   mRNA            complement(<298845..>302069)
FT                   /db_xref="GI:66362671"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1170"
FT                   /db_xref="GeneID:3371846"
FT                   /locus_tag="cgd7_1170"
FT                   /transcript_id="XM_628300.1"
FT                   /product="protein containing ringfinger+4xC2H2+littlefinger
FT                   domains"
FT   CDS_pept        complement(298845..302069)
FT                   /locus_tag="cgd7_1170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein containing ringfinger+4xC2H2+littlefinger
FT                   domains"
FT                   /db_xref="GI:66362672"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1170"
FT                   /db_xref="GeneID:3371846"
FT                   /translation="MKGKPKGRTEPRLFAKDIKQWVNTNILDHKYEKETIYGGKFGKNK
FT                   DNLASKDKLCGICMSNLVVFGLDFSLKCFHAICWCCTLRLRYLLKSKECPFCKNTIETL
FT                   FFTSNPRYFEYLIDDSLEGVADRSLDSDKQEGMNIIEANLGHPKLEQVPKSLIDEKIGV
FT                   IYESFACRWVFERILEYRCWFPNCRPKFPTKDSEDLHNNLKSYKNTKALGEHLFQDHHV
FT                   KCCYVCIEKRKTMLLPEHYLYGVKDLSRHLKKGEMFLKPPILPHISCPICKVWCLDKED
FT                   FSDHVRNEHFSCQICEEKELSRQSGLFSESSRNEETDLNENNQEGVDELDDEEESTNRV
FT                   GAQESNSLTRENRLPKITYVYRDYQALKEHWRQKHYPCDHENCMFIVFENESELIFHKA
FT                   THHSAVNRRGNVTVPIVNSYRQQSQRRVNQLNSSQTTNQRVSNPIDISTPSLCAMDELS
FT                   NTILTRIKREKPLLWRLVLIHDLNKCIQVVGDEITVKLGLEEKCRDFSSWSLQVINDLF
FT                   SRNETMIGIIQKLGSTYIKREISAKSFIIEMVALLWGSSHNHSNNTNILQGVKKQFKSI
FT                   ATSPSSFKIFFSPIPEPITIFEDTLKERSGTYKRIPAQLVDRILAEEANWSLLYSDVIS
FT                   MILIALILGLPNIENRRELIKALTSLKDDIQEKNITIISNTSFPRFSFGNLQSSIEIER
FT                   LKIHPQENTENQIQENINKKQIKQKFISFEKLIKPDEMLISQKVTFLESLNSFLTACFS
FT                   KISLSQFSEFLPEASDKEKIFDKFKILIGSQTSTEINALSSLYQHTSSLVSSANTIERI
FT                   LGLRAPFYRLAMNTTTFPEDSQTPSTITESLAHRQWLNICTKAFNKICLYDVEIILIYC
FT                   KACIKTLNDPNFLLLEKQKEELYEKNKEENSSESAPKTVNAHSGVISHSKSLAPSLTSL
FT                   NSLKINTSGNWTSKTYLSSNSSAPKTVIASSSPIQSGTSFSSTTVSSSSATSSSYQPTT
FT                   NKPNSIGKTANYAQALKSKESTAKPANENESKPKGIFEFPELISKGENKGKARMKPENP
FT                   PKWVCILCTHVNSGTRNRCQICSTRK"
FT                   /protein_id="XP_628302.1"
FT   gene            <302385..>303068
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1180"
FT                   /db_xref="GeneID:3371848"
FT                   /locus_tag="cgd7_1180"
FT   mRNA            <302385..>303068
FT                   /db_xref="GI:66362673"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1180"
FT                   /db_xref="GeneID:3371848"
FT                   /locus_tag="cgd7_1180"
FT                   /transcript_id="XM_628301.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        302385..303068
FT                   /locus_tag="cgd7_1180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="Trp and Cys-rich motif similar to step II splicing
FT                   factor SLU7"
FT                   /db_xref="GI:66362674"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1180"
FT                   /db_xref="GeneID:3371848"
FT                   /translation="MNVQRISNKASVFLNHKHFHPGNSKNREKVWLAEEKLKEEERKQE
FT                   ELLKKRKKEWEIEELRRDLRQSNKKVKNQLKVQSEVEEVIDKSKQLHDVLVDKARANKS
FT                   WVKSELYEEDVFLGNHSSVWGSYYDPNVKKWGFKCCKNLKRSSVCSAYNKSKSQISNSS
FT                   YNTSISELFNSDTKYQSKSDTSEHNINNNAGLLLLNQGKPFSKQQKGVSEFLNILKQSQ
FT                   PKSSN"
FT                   /protein_id="XP_628303.1"
FT   gene            <303626..>306109
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1190"
FT                   /db_xref="GeneID:3371849"
FT                   /locus_tag="cgd7_1190"
FT   mRNA            <303626..>306109
FT                   /db_xref="GI:66362675"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1190"
FT                   /db_xref="GeneID:3371849"
FT                   /locus_tag="cgd7_1190"
FT                   /transcript_id="XM_628302.1"
FT                   /product="Ser/Thr protein kinase"
FT   CDS_pept        303626..306109
FT                   /locus_tag="cgd7_1190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ser/Thr protein kinase"
FT                   /db_xref="GI:66362676"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1190"
FT                   /db_xref="GeneID:3371849"
FT                   /translation="MDDFLNYKNLENDSVGKEFLANPSHSSFDLATISTMTSLQGLETS
FT                   LFHDQFSPILGISSNTLDSLGKTKSKRIITEDVTINSSKQQDNPNQNRDSGTKLKNTNS
FT                   INTSSISEKKDTSIKPNYPFENGVQTLYQIESKSTKNLKNPLPLKVTKIRVNDLEMKVI
FT                   PSLKISTDNHHRELPTGFKNSDHLVDFFLGKVLRSSNSLFYIEKKLQQALYGAVFLAFE
FT                   LEESKRNENVERKEISHCIGSGTSVFLQDYDLPSFIFDPHKSKVAIKISSMSLRRRKPS
FT                   LKENMEAEIIYSDTMTGHKNVLEYSEIWQDSFKNIYIKMEYAEYEDLFEVMRRRRPLTE
FT                   NEARWLFSQIFNAVINLHNKNMALRDLSLENILMFNQEPHFFDLSQEHNFIGIIKPGDS
FT                   MIIPKITDPGQACKIFPKDKDEVSNIWKVYQRHPRDSGFQLQKVDFLFGKSFRPPEAYE
FT                   TGSLYDPTKVDVFCLGWMLLFTLTKYQPFETCRLITDNLNQNPVKNEGFINTLFGKIIP
FT                   GNNTDYKITKINGKSYIHKDQNWSLIVNGRILELFRKIKATNLSSEAQDLIENMLLPDY
FT                   KERFSMQNVIAHPWLKISSNKASKYFTPIMASTLSPIKSYKKMNKQIKQSSNIVNPSKF
FT                   FDKVDNNNEITIKNNIKTTFDESNSVDSANSQANILISKINNDYLCSMVKRTNDRLNMT
FT                   RVNISRKKDSEIESLIRNLNSNSISDSRQINPNFPDNDILSQLSISPLLSKVTKNKDGS
FT                   LVTKNLPLSSSSSSSSSSPKNAIQAKIPSNSTSRSSQNVKVRKKNFESNFIFDLWSFLN
FT                   GGGGNGNTHDHIIIN"
FT                   /protein_id="XP_628304.1"
FT   gene            complement(<306249..>309290)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1200"
FT                   /db_xref="GeneID:3371850"
FT                   /locus_tag="cgd7_1200"
FT   mRNA            complement(<306249..>309290)
FT                   /db_xref="GI:66362677"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1200"
FT                   /db_xref="GeneID:3371850"
FT                   /locus_tag="cgd7_1200"
FT                   /transcript_id="XM_628303.1"
FT                   /product="cyclin"
FT   CDS_pept        complement(306249..309290)
FT                   /locus_tag="cgd7_1200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin"
FT                   /db_xref="GI:66362678"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1200"
FT                   /db_xref="GeneID:3371850"
FT                   /translation="MTELEDSHNEISSHEWESNLAKIICGSLLSLNGLIEDISDEDLQK
FT                   RLNNQSMFCIFECFFEPLLYYKNKHNLPPNLPKLNDESMEGQFILENPLYSESENRDLS
FT                   ELFRFGKTPKVSIQELFGFVLSVLHLGGFNVSSFVLSVINMVKFVEKIKIPICQHNWRP
FT                   IFITSLILSDKLWDDSCAKSGDLARTIGFISPKSLKYLELIFCEELDWKITFKLDTIKS
FT                   FISKIVDSKLDPELIQRVISSETYQSYCYEGIHDPNTQAKQDTCAEEKLENKNMMNSVY
FT                   SSDLININKQKISQKFNQNINNYPKKSESPLFFNNQNPRMPPSMLQQPQLQRRVSLHPN
FT                   HLSFNAQSASSAFFNNLNMNTNATTTASTSNAMRNQIGAPINLNGTHQHQISHLSSNMK
FT                   RPSVPTITLTGGSSALNNRSFYSPARNQMNINQNHNNFAHGSSLSLNHIANLTSPKSDF
FT                   TNKTQKYPILSTMGQTPSSKASTSGRSYTSENLPSIGSHARSTTPDVNSSTVSNFNYFG
FT                   VSLSNERGRDTSCLSKLKQPNPSQINTSMNSNLNIFEKKLNNHSRQSNSIKRSSSEHSR
FT                   LNPANFQANQNNLQQLSRPPHVPQLIRGGRGEGESAGFFSMARNKVSSAFSSITRTFGL
FT                   SSPQSNQINENGDQRSNISSANLNQINPTNNLNNIEPKSALFDQSPTSPAQPQKIDPNS
FT                   NHHFNQQNKLQEYSHQNNSTKRNFSMPPKSNPVFSQLSENKQKSPLLSSIGVSNSPFTS
FT                   ATKPNSGIEKKPPLTHGEYNLRSLSTDRAYNVNHPSLRQNLASNAYPQTVKNGISSSNH
FT                   LPEKKPTLPSSMPWAPNSSSFHIPQNSLHNPSHVSDRLTANMHATLGRHSVGRGASQVR
FT                   NIPAQNSNPSISSGFFGKTIGTGAGLTRNMSLVGKSVHSQKSSTGESLLSSFFGGKSRM
FT                   QSPCPSSNSTNTGLKPTLSQLNNSNGSTSLSSSIFSMDSFINPIGNLLKGKKPSVVSSS
FT                   TSIKAPGTQIGSLPISGVGLSFRR"
FT                   /protein_id="XP_628305.1"
FT   gene            complement(<310203..>310814)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1210"
FT                   /db_xref="GeneID:3371851"
FT                   /locus_tag="cgd7_1210"
FT   mRNA            complement(<310203..>310814)
FT                   /db_xref="GI:66362679"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1210"
FT                   /db_xref="GeneID:3371851"
FT                   /locus_tag="cgd7_1210"
FT                   /transcript_id="XM_628304.1"
FT                   /product="hypothetical protein containing a signal peptide"
FT   CDS_pept        complement(310203..310814)
FT                   /locus_tag="cgd7_1210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein containing a signal peptide"
FT                   /db_xref="GI:66362680"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1210"
FT                   /db_xref="GeneID:3371851"
FT                   /translation="MKFCLIIVSIFFVFLNHFLGFSADVQIAGNSFLKIRVKSGNQDLN
FT                   SNSESDDKKGSESNSGASEAALTSQPPPPPPPPSLPPPVVCKKCNLTPKQEIVITASIT
FT                   KLKRFLQRLEDLEKELSPEIKILYSKLKKILLKLLQCLESCLVDISSCIKCLESVEEEL
FT                   EKLIKEAEKDVDEDFLEVIREILKFVQSVKQYKHCNLPQI"
FT                   /protein_id="XP_628306.1"
FT   gene            complement(<311031..>312818)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1220"
FT                   /db_xref="GeneID:3371852"
FT                   /locus_tag="cgd7_1220"
FT   mRNA            complement(<311031..>312818)
FT                   /db_xref="GI:66362681"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1220"
FT                   /db_xref="GeneID:3371852"
FT                   /locus_tag="cgd7_1220"
FT                   /transcript_id="XM_628305.1"
FT                   /product="hypothetical protein containing a signal peptide"
FT   CDS_pept        complement(311031..312818)
FT                   /locus_tag="cgd7_1220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein containing a signal peptide"
FT                   /db_xref="GI:66362682"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1220"
FT                   /db_xref="GeneID:3371852"
FT                   /translation="MNSYKYIFCHILPLLLFIILAILFNSNVPSHGKSIQYKHSFAKIR
FT                   DDYTRLDIERGSELVRKSREALQVSIFTYFMAQKKLSEMRILGAHPNSSEYRIAEDYYR
FT                   YALNSMKMAKDDWENNLKSAPIFTYRKDHITNYKTRGANNYDLNSLFLITGRDYSGDRG
FT                   IDFQIDTYEDSEPIYLPIPTQKKLNKDIINNLNLGFEFSDLPFKLTKSINDRENNRKQN
FT                   RLGNKGRQIKNSYKNIPALEKLSYNNKLSGDFFSFEKLIGNHKDDGSLLSVDKYIDDTS
FT                   PTNQFSTPDFIKSKEFLDIKSMNNQNLMSKGLKSNEMPIKQNKDENLKRRRSRGVLDRE
FT                   PEIPTDVSIQIERKLGGPLKFIDLSLKDLNKDIDLKIIFMQYIKSTLRCIQLYESKSVF
FT                   EELFHCSKNQLDLSFKLLQKLADLKINYDYHKNDSTYIKKKFNINYVDWPESTDKTEEN
FT                   EEFFNHLVSCGIFHSNTTNTTNTSNTTNNNIIDNRIKHFNDKPDSEDTSTFDYKPGYLD
FT                   RFMDRYGFTEDEYIANKRLTRAVNHLAALEAEFINRTENNERVEHNKIYDYKMLTDFIP
FT                   IEILNWRARKPLFNETEKN"
FT                   /protein_id="XP_628307.1"
FT   gene            <313066..>314439
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1230"
FT                   /db_xref="GeneID:3371853"
FT                   /locus_tag="cgd7_1230"
FT   mRNA            <313066..>314439
FT                   /db_xref="GI:66362683"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1230"
FT                   /db_xref="GeneID:3371853"
FT                   /locus_tag="cgd7_1230"
FT                   /transcript_id="XM_628306.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        313066..314439
FT                   /locus_tag="cgd7_1230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362684"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1230"
FT                   /db_xref="GeneID:3371853"
FT                   /translation="MHLKEFILSLDDVRALVERKLERNREFKPKISFIKHLASYSVTIP
FT                   SLTKISDEALKIAKKDGNEKAIYMDTIIVPALPRSLKREDNLSSLQCRFSYSQKPCSIS
FT                   PTTHYDLLSNIFGYENSQDANIFADRFCLRRLIDFSLGSISSENADIMVSTKLRIDDNG
FT                   ELERISPIKMLPINITEGFPSVGFQFETYLTRSEIGLGLNPDATLKMADSCFVVDEISF
FT                   GDLRLIRRCEIDAVSKRHVYGDSKERSKQEEYKNSLCHKSWEQKIYNTDTEFMERRMSP
FT                   PCRVFLSDNFKSSKLSPENRVEIKSISCRNTHNFSWVSVYFQMLIGSTPILIRGCHNRG
FT                   FFTQRSITSFNLDQVKEFSEKELTARKIPNLDFSESNWDTITSAIAFSEAILTYISNDL
FT                   LELIGSYLFKENGPGDHFVNFTIKKKENNIIFQILNPNENLPNIAGPINYWNDYLSNK"
FT                   /protein_id="XP_628308.1"
FT   gene            <314708..>315694
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1240"
FT                   /db_xref="GeneID:3371854"
FT                   /locus_tag="cgd7_1240"
FT   mRNA            <314708..>315694
FT                   /db_xref="GI:66362685"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1240"
FT                   /db_xref="GeneID:3371854"
FT                   /locus_tag="cgd7_1240"
FT                   /transcript_id="XM_628307.1"
FT                   /product="hypothetical protein, transmembrane domain near
FT                   N-terminus"
FT   CDS_pept        314708..315694
FT                   /locus_tag="cgd7_1240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, transmembrane domain near
FT                   N-terminus"
FT                   /db_xref="GI:66362686"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1240"
FT                   /db_xref="GeneID:3371854"
FT                   /translation="MNIEDKSGNKLKKKINILFERLFSNDGISHIYLLLVIILLVNLGI
FT                   GLFFCGRNLNKQSELISSSIFDININFPKGDKDTNNNNSVYVPRDEILNQNKPQDSKST
FT                   TTTTTTKKVSTVITASTTTTTTKVDTKNYNVQSPTDNSIPTCLYSSKFPTKYDLNGLLF
FT                   WNVSSDTYIYWGYQNKTGTVYILGNNKQINSSVQLTDNISSKSDLDQPKLIEFKESNIV
FT                   DSKVKIGQVASSKVIAIGERILPPYWYMNWVEQTSTRSKERFKPLFQPCLGSLYTYSNK
FT                   NLQGFFQDQGVVYMCGFKSYTVEKDLIELKNTPFIKLKTNIQGKFTK"
FT                   /protein_id="XP_628309.1"
FT   gene            <315812..>316117
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1250"
FT                   /db_xref="GeneID:3371855"
FT                   /locus_tag="cgd7_1250"
FT   mRNA            <315812..>316117
FT                   /db_xref="GI:66362687"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1250"
FT                   /db_xref="GeneID:3371855"
FT                   /locus_tag="cgd7_1250"
FT                   /transcript_id="XM_628308.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        315812..316117
FT                   /locus_tag="cgd7_1250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362688"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1250"
FT                   /db_xref="GeneID:3371855"
FT                   /translation="MIIKCQEKQGNYKYVVTYSSNISRSIKEEDCEENHDSWLMYKSGG
FT                   SLFTVSKEGSGDWQMRTETGKFESLTETGELKKEPCFSSWWTTYGGVTSKQYVPST"
FT                   /protein_id="XP_628310.1"
FT   gene            <316366..>319494
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1260"
FT                   /db_xref="GeneID:3371779"
FT                   /locus_tag="cgd7_1260"
FT   mRNA            <316366..>319494
FT                   /db_xref="GI:66362689"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1260"
FT                   /db_xref="GeneID:3371779"
FT                   /locus_tag="cgd7_1260"
FT                   /transcript_id="XM_628309.1"
FT                   /product="calcium/calmodulin dependent protein kinase with
FT                   an EF hand N-terminal to the kinase domain and 4 calmodulin
FT                   like EF hands at the C-terminus"
FT   CDS_pept        <316366..319494
FT                   /locus_tag="cgd7_1260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calcium/calmodulin dependent protein kinase with
FT                   an EF hand N-terminal to the kinase domain and 4 calmodulin
FT                   like EF hands at the C-terminus"
FT                   /db_xref="GI:66362690"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1260"
FT                   /db_xref="GeneID:3371779"
FT                   /translation="KMTVATSSRRNSRRSSLSSESSLTSHTSSTKPKNSYIQKNSSVSG
FT                   GNGTSHNCYSHKGRSGSGFGSSSSYENRAYLVSGGGSCIGNNTSMGNANGSLLAPNVQL
FT                   DNLPSERVGNGSPNWALSADVCSLKDFKELIECKNEHAESVLRKYSGIKSVNGGRGIRQ
FT                   VLASIVRGSRTSKNRSSSVDSGSCGMVSSSTSTTTSSAALVSNLNRKNTTGGDINNTRI
FT                   KIEDSIDGNGTIINDNNGSSTSNRECNILTGQPIQKAILTQRDIMELRGKIDKVLSTED
FT                   SFVRSALQSFQQFDFDGDGNLTIEELLDLLTTLGEHLALPPINRKVVANEISIRLNSKL
FT                   TVDSSASESKMLISFPFFLKYYLSVLTTIRQKHFSSVKINGELQQNKAIRKHLVHEDDI
FT                   NDLYTFHYQLGTGTYGEVFLVTENYTRQRRVCKIVDKVKCRRKLDEIDHEVEILKQLDH
FT                   PGLVHIYEVYEDRLNLYFILEFCAGGNLFHSLQDAIQSGFRFSEFHVSRIIQQILLAIR
FT                   YLHLKRVVHKNLKPQNILLTNSFGSGNTSVKLVDFGLAEIFSSDEINLPELTTSNVSPS
FT                   HFHSPLKSLPLSSSSSSSYITQDHIKTHNQAQPQAQIQGHTHNTSLSSISNQNRASEEG
FT                   YLFASVDEVTGIHKSNSSHNSSPSSNSSLAQNLHQEESLASYPKYLDFTAPELLKGETF
FT                   SYSLDVWSVGVIMYSVITGRHPFSGRSRAETRHNICFGIPAISEITCVSNACKSLLGKL
FT                   LEKNPRERITVDEALSHDWFSISHSSYCEVDIGMPLLAHLKVYTRQSDLRHILIHMLSH
FT                   QLALDTTQINMATSVFKSLDTDNDGVLSISELGSGLQKLGISSRESSMIIKAMDIDGNG
FT                   IISYSEFITACHIWRRNEIRQLKSFFMKIDRNNQGKITREEFKQLLKAQKSKLLSNITK
FT                   SFSSTNDVNYRTILPSSNQGVYTEWDSVLDEIDTNRDGLIDWKEFCTFIVDYFNTSRES
FT                   LRACYNNSSISNISSTFSIDPPSVAGLSRRRDSGICPVQEANQHPPPHPSQLD"
FT                   /protein_id="XP_628311.1"
FT   gene            complement(<319876..>332349)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1270"
FT                   /db_xref="GeneID:3371856"
FT                   /locus_tag="cgd7_1270"
FT   mRNA            complement(<319876..>332349)
FT                   /db_xref="GI:66362691"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1270"
FT                   /db_xref="GeneID:3371856"
FT                   /locus_tag="cgd7_1270"
FT                   /transcript_id="XM_628310.1"
FT                   /product="large hypothetical protein"
FT   CDS_pept        complement(319876..332349)
FT                   /locus_tag="cgd7_1270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large hypothetical protein"
FT                   /db_xref="GI:66362692"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1270"
FT                   /db_xref="GeneID:3371856"
FT                   /translation="MHAEFVAIQEEKMWTPFNALRSRKVGFLAVFLLNIIFFDANIGLF
FT                   KNEGICGVGFVVEASESSPSHSMGKLDAERRKKHPDTGKLPRYPIPGMRYDELSESDAG
FT                   SKKVTHGRKKKKSTKSKKRAEERSKSNEREEEKVSKKKRSRSGSGSKPRKSSSGSTSSD
FT                   SKEESSMPSGKSKKSTQTDQAIGIGNNSLNHKSTNTDEKFTKRERRKIDKSKLSMSEYK
FT                   SYLPGTDSIWQDPSNRKTYKHLNPQYGDYFPKIATKPYRKSNECSALFDSAKKAFENKE
FT                   IKIHPADFVGLSLTFAVKLREVLGHYVTIQETCLMLRMLLHLYSGMRTRTQFLNIIAAV
FT                   LQNDILLGRISDDSGIINEVMYILDYFLQLPKHRADTKSKQMSAIEISDYFHLEAFPKD
FT                   NSFESRILPFYRRIAEKLMHEIEKRLGIVIARDEVMSMVYIMLNFIEEERSQEQCTEVI
FT                   AAVIGATYTNPLTTDQLTEIANMARDILGCKASSGKTMDRTQIMDIFGPERTVIEMRQT
FT                   ALVGGPMSDTVRIWKEIGILDYLGRVISVRFNDCNGIKAWEMNRICSMLEVMNKKLIKT
FT                   GSSSDIITLEELCGAFKYKKRHPGTKWPLAINTTLQKRQNGLPVKIDKLFSHFLAHEKR
FT                   KLASLEGSTKTRMEKFYMIPEFPKPSFLDSIIPSSPAQGIPPADHLKPDFFYAFNSMPG
FT                   WIQNRFIFASAFMEEILVKHGNFVHISPVRLYNALGGRLDENSDVSLVIQGLGLTQEQY
FT                   KALPKAFCGYEKKLFNEHNSSFSPISIDNYFEALYEYPLASYVEGKYLIEAAVNVLDIM
FT                   NQYLEAANEGVMTEIFPQLVTQERLQRVYLFQGFINSRIKAYSNNNISFITTEEANRIL
FT                   QGCVDNNKVSYVNEMRSNLNPEHFTDSLIEILAQEWSNYESFILPQVLDLDSDGQGALG
FT                   SVYSMEMTFAALTLDGWELLIDPTIYLRNLANGESLFLNYSANSVKETTARENRSRLIY
FT                   NWMQQYFIYKLRKIPKFNYEELRTLVEALPNEANLSEDIIKQIIQGNQSLNLSDSLAED
FT                   LTFALMAYLIFEKYFLYTRNPDLEGGFATEIDLVNGKIFIPSCVWTFVKDRDDYSSSDI
FT                   ENQSVIHFADLTLAYLTRLFQTQPQSQDLFIKVLKWANSQNLNDDSIFFDYLLSIEDFK
FT                   LYIQHNTRLSHNSHIFLVPWVDHLPTNYQFRRLRSLPSGTSPGLPSEGPGQDQDGDQAQ
FT                   RSQRAAQILSEIERLSLEHSALLDELNAQVNKEDTALFVVEKIRNDIHNLLLELGTLSS
FT                   TLLSSAMMILSKRMIAPSINISDTHNMSNLGVHIGENGEITFDEELAEKGLSGVFIPAL
FT                   VLGNINPETGILEPPPPGFDPELSCSTQNINRMQAFRIWLSSVLPRMPFHCSDPLLARD
FT                   LLSVRNLLPAFVTFGFSQDSNILATSLVGFTSSHPFPMALSSLNIIVKYFIADENSVFL
FT                   ALDRPATNLEEAYQDLRMIAGFYKKKTTLPLLEIPTIFSFTPNLELLGSTNSNDLGNHS
FT                   QANARVNFLDYLERITAEYFASSPRRMPTIAIPRLTNLAMNFSNDFEKLVFLITSIFGP
FT                   MSPYISAPSIGASANSLAEFYILNLPFSDIMDSHYIENEFKNTHLEFGSPINKILLTSV
FT                   QSDDQLLDFKHTFLSAHFFSSDEAYFGSFLAMSDLISLALSYTTSKTGISADLNSETFK
FT                   QISFSFITGQNLLEIVRTSIDLSGQNLENLAGNIFYSTFAKSLSFLISQFTPYVESSDN
FT                   RIVAEEILQSAISDIYTKGFYPENVRYELVNRITLFIDFDSDKYQFMFADLEESLNSRE
FT                   LSFPRNLSTHSQKLNQRFLTQTSEVALVSGQNHVTRTPICNYALVFSYFIVKVLEKPQN
FT                   KDKIGKLDPLDYSNVSIWSGFCGLKNFEYLSYRSVLISIIKNLSMKIFGPLDASEIDKL
FT                   VILIDFFDQNVRKIVLKYNPNLSQDCSNETLFSNLDACLAAMSRYMSENDIILDDLQLS
FT                   NSSTLQFSDEISSNHFSLLSSQEESMARVMFRSVLESVFFSNSFSELEDVPGINRQISF
FT                   DFFSEAPLDSELKPESIVIESFDDLYRKLPFNLKPIKLNSGSKSQSSIAISYLDVEEIP
FT                   RGERYELKNSFLHDKKIICVNRAVFFLHWWLITWPKIPFYANDFVLAELLSNIEILAQA
FT                   FQTSCMMTSPDVIFSSISKQISGISGVSLKKRHIYLMIDSFLNFENKALKFSGAKDLES
FT                   AYSNDTGMLNSIFSIDLKIPEIPIPKGNLVTSVRPENKNLSQYLFRIISEYFAANPRNY
FT                   PTIIIPNTSFIAKHFDLNRNSLAYVLYIWSEFEESNSIRIFFQAPTIGASYEDLADFII
FT                   ENFELNFLNFSSSNSYLQFFTDQIFSTFFKFGSPLFRVKNIPLRLSCSRIEDSCNPFIP
FT                   KLGLSEIEEELLGENIKLIVSRSSVIASQKMSLSPTSEIITSFSTSDVSEAIMLGINVL
FT                   DAVRVHGFGTIKLKENLVIINKFSLLFSKIFSRFISRLLESFHIPNFNKPALDLRFTQL
FT                   KTLSARTYNVFSQFTSDLISLTLFSNEDLNSLLKVISLDDLIPAEKYQAFYAVSTSDSS
FT                   RGMMTVYTKSTGIPLNLQITRFNYIYCFIHYLLHILSRIGMSHFYISFKHHNLLNFENV
FT                   VRATAISIHEGIPESVFTLISHKDKFSLGNFTIDDIRRIYIQYKSHTNNFFSGGSIQLA
FT                   FASSENLTPFIQSLFAATKYDQNNDSVPLIFLNEFENKEFLHFSPKSQSLSSSITTEEI
FT                   LNNNFHLNNAFYSFKETSFITGSFVKPWVPFVMGLGSEKHSSVYSEASNDHLVRFDPGH
FT                   VQLRKKLKQVYSLNQNLDLSSDYNSLVDLGQATFESGVISLHNGQDSPDENQFRNNFNG
FT                   LRLHVLNRAVLFREWLIRIWDISPAIGRDPLFVDFLNDFKSIIGIFEGAEIRQGASLRI
FT                   DLQTQLIHKTGRFLPKLLSPIIAAYNEFEERMVEESGGSNISKILESGIAGLFLLSLPI
FT                   NDPFQRKRCQIKNKAWGEGHDSYRRSQIHDFVTQKLVEYLSAAPRSAFTIDIPDVSVIL
FT                   DNYSIELPHKTKCAIEFWARDRPDLISAPSLGLDPDSIFSFLSSFLTTKELDQDNLEIP
FT                   IERYILSYGLLNEYPIQDAYSYYGDLTFAFREYDNLHETLVASMLSDSVTINAAVDLFR
FT                   IIAANVLDTYDFNHYASEDIEDEQEYENGDSYIDYSLGLDYKTFSMRVLLGVSESFSAR
FT                   KLFEPIQILKSAKDLNKISSDFLRKISVLKLCVYDTNPEFLFYEYYSAEIILSLQRSGL
FT                   KITETDMFSLLLNHILINFAREFISKPQLIADCFSNFKFKQRPSYFSTVPEFGHVSQNT
FT                   GLITSSFKNLGFTGLQESFVPHVNLLVYYLKSLNSIVNHPGNRIILSIPASINFMSTSI
FT                   LLRASSCSQVTNQGFLCIAQMILNSLVEIGSDVGNLTVDALTEILDSLFDIVGDISYSS
FT                   YSKLDSPIKDIDPTKNRKYQKSIYSNYNQNLLSLLFGNIESLERIINSKFERGFFDIRT
FT                   LSKSLGDSYNTDPLINAQLSIVQSSYYRKKDPFKLIAVLRIIPTFNVDSSKKREPLTLN
FT                   KFLAQMNLLEVLDFTVGIFPTVLLISKLDGNMIISNDGSFPPTSIKIANRAATFHSFIH
FT                   ITTHQYSDNVSSFAILPNNGGGNNRAGISLEDCINFFSAYSGMDILESTPKISKYFKNI
FT                   EFYKAYLLLDSFYAIEKQLFGLDAIKETAEDGYFNVGRVIGIIDNFIPLRLNLEIPKFE
FT                   GEEAKNLGRIIFYLGLRFIKNEKVRAELTLGKCISIARSFWPSESDYNYTTSKHSNTGY
FT                   YALLSIFENLSSIRKFPMLAQEFLIMLNWYIYNAMGSDPSIRDFSNPLQIFRKRVEFLR
FT                   KAFSKPFVCSEKDLPWLKPGLEYSGVSFQEFNFIMYVATAWRTYLESKVYKGPINIDND
FT                   EWSEILKHARPGLISMLDSLSHGISLKSPFSISIFNFLTYNLIGEHSPDIYEDEEMLKH
FT                   IEVFLDQIQRFARIRHPGIINVSFLWPAVDCEPSPTNSKSTSSVSSGKMVVPGLTFPLA
FT                   LNSIGSSDNLSRSRLSKSTTKEIFIDSFGEFFQEKEIPSGLEDYNTDAGTVTTDTYSDS
FT                   DIDTNSIDAYSGDSTDTDNRVQDEIRRGFKLEDLPYDNISS"
FT                   /protein_id="XP_628312.1"
FT   gene            <333347..>333910
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1280"
FT                   /db_xref="GeneID:3371857"
FT                   /locus_tag="cgd7_1280"
FT   mRNA            <333347..>333910
FT                   /db_xref="GI:66362693"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1280"
FT                   /db_xref="GeneID:3371857"
FT                   /locus_tag="cgd7_1280"
FT                   /transcript_id="XM_628311.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        333347..333910
FT                   /locus_tag="cgd7_1280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362694"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1280"
FT                   /db_xref="GeneID:3371857"
FT                   /translation="MRFYLFFFALLVFFVATNAVRIRGGEQNKLESETPEETTTTTTTT
FT                   AQPDSTSDEDTTTTTTTTTTTTTTTTTTTTTTEAPEPVETKEGEETDENTDETTTTTTT
FT                   ASPKPKSPSYKDRLLSFFGSNGGSMFGLGKSSTTTTTTTAPVSSEDNKPEDSEDEKESE
FT                   SESDSSNEGSSNSEDSEEKTRKTE"
FT                   /protein_id="XP_628313.1"
FT   gene            <334718..>336457
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1290"
FT                   /db_xref="GeneID:3372257"
FT                   /locus_tag="cgd7_1290"
FT   mRNA            <334718..>336457
FT                   /db_xref="GI:66362695"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1290"
FT                   /db_xref="GeneID:3372257"
FT                   /locus_tag="cgd7_1290"
FT                   /transcript_id="XM_628312.1"
FT                   /product="hypothetical protein containing a signal peptide"
FT   CDS_pept        334718..336457
FT                   /locus_tag="cgd7_1290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein containing a signal peptide"
FT                   /db_xref="GI:66362696"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1290"
FT                   /db_xref="GeneID:3372257"
FT                   /translation="MLRFFLNFVITFLSLSFIINQAYCIRVEPRVTSLLNTPINENISE
FT                   SQSCVLQTLKELVSSNGRIPPKITKKRIQQAVLTCRKKLAACEYPTIAEETIFITLGQY
FT                   GHLSQIDTVKALSFINEIQKGITSTVGSYTRMYKLSQNNNFCKLYDDFILSAYPKEYYV
FT                   SFLPEGGERCQELLNRLKQNAFYSYWGQGGIVADQAQPIVDDKVSNDPIKTKDMVINNI
FT                   FENPPNKETQIEEFSKPESETNNKTDYNNENEYENVIHTKQEIDHFEQEIVEDSGCCSC
FT                   CSCSSKRTKTKKGENSQPPKLVDSSMTEEELELIRLEQELEKENSGCCSCSSSNKKKKE
FT                   KKQVNGNEMSNDILQDGIINNELKMHEDNKNEEDNSCCASCSSKKEKKSKTKNKEKEVQ
FT                   NGETQRMDEQTPKTLVETSMTEEELELIRLEQELEKENSGCCSCSSSNKKKSKNEKKDK
FT                   KQKKGKDEQDKKEEKFDQLLEEQQEGEEPIEGNKKSKKDKKAKKDKKDKKSKKSKKDEN
FT                   GVLVNSLPEDKMEGKKSSCCSSSCSSSSDKASDEELKELAELEKRLQEEEEMLLQKKNG
FT                   LKT"
FT                   /protein_id="XP_628314.1"
FT   gene            complement(<336939..>341390)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1300"
FT                   /db_xref="GeneID:3372258"
FT                   /locus_tag="cgd7_1300"
FT   mRNA            complement(<336939..>341390)
FT                   /db_xref="GI:66362697"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1300"
FT                   /db_xref="GeneID:3372258"
FT                   /locus_tag="cgd7_1300"
FT                   /transcript_id="XM_628313.1"
FT                   /product="hypothetical protein containing a signal peptide"
FT   CDS_pept        complement(336939..341390)
FT                   /locus_tag="cgd7_1300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein containing a signal peptide"
FT                   /db_xref="GI:66362698"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1300"
FT                   /db_xref="GeneID:3372258"
FT                   /translation="MRIRKKILHLVYSFCLVLCPITRSIYAEGSIRLFGLHGSENEVLL
FT                   EEKNNSFQDDGLVVTMDKLRRINLCFIPEGQENTWYAPMVFYKRYKHLSQVYKKCSILR
FT                   LKDFCNEFSGIIDCPKVSSTGELLVSSQGKEASTIFAMIKSPVEEVDEEEGEGRDEGKE
FT                   SDEGKKSKEEEGKEGKEEGKDEGKEKEEKEKKERFELFTGCVYELGKKSSLRVRCLHSN
FT                   KAKKFPLKIVAKVDGRTNDFLYHFNHELIIYSRMASSTYGASKSKLHPSIYSVFLQPNR
FT                   KMISRNVLLMEFIDGPAISSIISELIDYPNLLNYLKNRVNAILEESIRIYDSKFPSLRS
FT                   DEKINVESKARLLENSINIWINNYTDKTIIFSVNLYRRLLYLLDLFHRGGTSFYPEELE
FT                   DFSRGKWKRFRSFRIHCDFHQGNILVNISKQFKTENNVYNLTYKDILDIDFYKDLKIID
FT                   LEDAVELKESDFPVPIDKLVGTHPCPVYLTDAEGFSARLLSNIILISNTLSQTLNTLQD
FT                   FFLKETKNLIFGNNIVSDWITSSNPDRISEFSDYSFKLKDSILKKLKIHSDNWDRYVDL
FT                   ITNDEVLKPCTSYYHLKYGRKLPPKSQLPCSWLSNILFSKKVCHYLHLSHADSDPSLLK
FT                   SEDSVIEAELRELFRVSNLTKCHIEENEALNISINNVSSTIQEFLPVVTKINETYWGEW
FT                   SALFNNQTFDRKFTNINKNFDNTNNEIGITVNSNSKKISDHNSLPCSNHLSVINSKSNM
FT                   SRNGNKDKILKYDKNKLIFGSIDVPKEKNPSNVLDWVEVNQLVVTENEENNKNLIGKNH
FT                   SKSEMILQNDTFSKEFDKILIDLMGLAALQRIISFCLKFSSEIDCDNVSSSKIIRDGPI
FT                   SSYIVRTIQNNNSTQLKNSSSDFIQFLDPCVLYSNETNLSNLETQNSMGWLCSKQTQDE
FT                   SLTNETVFKIIVDGRLFLNMNMTFVNQSNNTFAFNDVLWYFGINDTSKYTYKFNNEAVS
FT                   MIEKHKKDALEFWKLESKIRNMDNIILNPEIDLKDDISLKTVPVLPKMFIFHSKLNTRK
FT                   VHARVISTLEKEELFVTDKNLYFLPLSEKRSDLSKQISSIVQTGLLSENVFFMINPSNH
FT                   RVSNLVSKVTNFQNEVFSMVWISYPTLVLSIIESILRSHSYQILISYRALEFLQRFRFK
FT                   RDYDISIIRTPKNTYSANIQMKNDSKPVICNFSLEKIIIQPYGNNEILKILGELNKFTL
FT                   YNTSGAKFMKISQVLSDFCSSEKLKNKSDIQSLIKDLVIPSLDPLFTLNNAVDTLSKIK
FT                   YNSSIEVRRSNWFVKHVCSFISQKLNEINKSNISNEALPTLIQSLNFIIQLKNKIFLNS
FT                   EFSKCINIDSNNNSNIEFNNNCTVGEYISISEMISSELLDLFIKERNIFKNLTSVNLAQ
FT                   ELISYTNDHLQIPPPSQDPPFGGLGHLYKKDYNESYTGSENPNTNSTILYNRNKTIAFD
FT                   VKWPIIANISDLISSEKNLTKF"
FT                   /protein_id="XP_628315.1"
FT   gene            <342595..>344232
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1310"
FT                   /db_xref="GeneID:3371859"
FT                   /locus_tag="cgd7_1310"
FT   mRNA            <342595..>344232
FT                   /db_xref="GI:66362699"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1310"
FT                   /db_xref="GeneID:3371859"
FT                   /locus_tag="cgd7_1310"
FT                   /transcript_id="XM_628314.1"
FT                   /product="extracellular protein with a signal peptide
FT                   followed by a family 2 glycosyltransferase and ricin
FT                   domains"
FT   CDS_pept        <342595..344232
FT                   /locus_tag="cgd7_1310"
FT                   /gene_family="HOG000202111" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular protein with a signal peptide
FT                   followed by a family 2 glycosyltransferase and ricin
FT                   domains"
FT                   /db_xref="GI:66362700"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1310"
FT                   /db_xref="GeneID:3371859"
FT                   /translation="YFTLRSEIKGIEVIHRGIFDHLAPKLAEHSRNLIESGEGKFEVIS
FT                   SNRNFDGISLIIPIRDEDEFISKTISFTLGLNNKNLLKEIIVVDDCSKREVSDLLNKEL
FT                   PSSYLKYIKVIRLDKCEGLIRSRILGADASKSSVIVFMDGHCRPKENWIEPLINRLKEK
FT                   PKAIVCPMIEDIDRYTWKDLGTFGLKMMFDWNFEFNWYEDFTDVIPIASGGLYAITREW
FT                   WEESGKYDPGMLEWGGENIEQSIRIWRCGGEIVAEKKSRVGHIFKRDPKPNPENKLVLQ
FT                   VQRNQKRAAMVWLDKKRYKYFETIHDVVKSLNETQSGVDLEQRHSIKERLKCKPFSWYV
FT                   DKFRASFDRGGLLLDNFRHFKHRKSGLCLTASLNEVVTGTEDKAVVFKECNERDDTQKW
FT                   NVILGRRLILNRRVGLGCLTRGPSNVVENSILRVVPCEFKKALEGYNDSQYWNIDANDD
FT                   LLFDHGYEDLSPMESSKLRNSLRLFNRINSIPFSNDGNDRISVNGEYAFNPSNRCVTNL
FT                   NDKAVMKSCPHEENEDYIFDPIKMGKFM"
FT                   /protein_id="XP_628316.1"
FT   gene            complement(<344622..>346184)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1320"
FT                   /db_xref="GeneID:3371780"
FT                   /locus_tag="cgd7_1320"
FT   mRNA            complement(<344622..>346184)
FT                   /db_xref="GI:126652640"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1320"
FT                   /db_xref="GeneID:3371780"
FT                   /locus_tag="cgd7_1320"
FT                   /transcript_id="XM_001388337.1"
FT                   /product="casein kinase II, alpha subunit, putative"
FT   CDS_pept        complement(344622..346184)
FT                   /locus_tag="cgd7_1320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="casein kinase II, alpha subunit, putative"
FT                   /db_xref="GI:126652641"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1320"
FT                   /db_xref="GeneID:3371780"
FT                   /translation="MFRILLILYILLVILQKLSFSILSHSYNENYTNKEKDNKIPKSNH
FT                   PRNIVESHEDFSSLENILEMSRLSRKNFYIKGNTIGTGRYSNVFFAWKIDLSPETKNKI
FT                   GEETLVIDPYFLNLTDHQISSLRGFPVALKELKNVQEWKIIREVSILKLLNGYSDNHVN
FT                   QTLLLENSQLYDQIQGKNSIIKLLDIVKYHNPIKNLNQKSISVKKHIGLVMEYINNEQF
FT                   YSLLPKLTYIDLQNYMRQLLQGLSYANSLGVFHRDIKPQNIVIDINKESLKIIDWGLAE
FT                   YYSKDDPDFSPRVASKYYKAPELLLGIRNYDYSVDSWSVGCLFSQMLFRLGTLKTNYFT
FT                   RVFTKYPKTFVGIFLKNSLSPDVLFPGWDNNDQIVKIASLLGGDNIISISNKYNGTISD
FT                   DITFSYLKRTKKIFNSTSPIFTDPRTFDFLITQENQDLVTVQALDLLSKLLTLDYKFRI
FT                   HPKDALKHPFFTIHPSKHSWVVSKSSSYYSNSSPMISPKTKNNCGNKDFCPFMSFFPIT
FT                   YAN"
FT                   /protein_id="XP_001388374.1"
FT   gene            complement(<346374..>348836)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1330"
FT                   /db_xref="GeneID:3372259"
FT                   /locus_tag="cgd7_1330"
FT   mRNA            complement(<346374..>348836)
FT                   /db_xref="GI:66362701"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1330"
FT                   /db_xref="GeneID:3372259"
FT                   /locus_tag="cgd7_1330"
FT                   /transcript_id="XM_628315.1"
FT                   /product="protein kinase with possible transmembrane region
FT                   near N-terminus"
FT   CDS_pept        complement(346374..348836)
FT                   /locus_tag="cgd7_1330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase with possible transmembrane region
FT                   near N-terminus"
FT                   /db_xref="GI:66362702"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1330"
FT                   /db_xref="GeneID:3372259"
FT                   /translation="MSLTRENKDLGVESKKDDYETIGEDGKGVEKAENTLEEEEKGVGQ
FT                   VLEEEEKTLEENRKVLEENGKIVEGERKTIEKSVKAQEKSYIENGKSSLESFEFVVPER
FT                   KKEKSQEEKRGRMRELFKVGNLIEVVYNQEEEGNKGICNSNSISSNEQRLVVFSISNIL
FT                   GMGAYGIVVLADICSPRKKKSRNSITVEITDSDIKEILEKLEPRASISLAKTRTKGTGW
FT                   ARKGGGGGGVGKKLAIKIVDLEANDTAELEDPLATARKETSIMSELQDCEQILKYYVTF
FT                   SSDSFLYILMEYAEGGSLYGLYSKYGSFPEELLASVTQDVLKALIRIHGRKDGNHSNSQ
FT                   NYILHNDIKSANILLTENCVAKLADFGVSRKIKSEIKSNRQEDSESITKVNDIMYPFSN
FT                   DQEILGSPFWMAPEIILGSGTRIQTKTGAGIGIGTGEPGASDIWSLGITVLELAFGRIP
FT                   WPNFDSLEELLEYILRSPPPQKTVREEIKGLFSPEFWDFIDSCLTKDPNQRKNANFLLK
FT                   HPFILLKAKRPNSLGIFIQMISGVQQNYNNSKYYIQSIFNYVNHFFSHENKAKVPTKFQ
FT                   SLSNQNLIKKISTSVSISRYFSRKRSTITIQNIPISSNKSSKTYLKDSENNQKTINNHY
FT                   NQSQNSKSSNSLFSSTFYKSEQEQEQEQKYCNDESSLMNKKVSVGKMHKCLEYSLIEFN
FT                   QLDLKDSSSHFSSNSLPSSNELVLNSKYKLSNSEKQDSRKSNTKFFGAKKHSREKIISW
FT                   SKNKGKKNKLVKEKVQINCKKTYQKKNSQNTISNHTETALLSSNRKEKTKLKTQKFFFS
FT                   SCCSKNAI"
FT                   /protein_id="XP_628317.1"
FT   gene            complement(<349543..>352797)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1340"
FT                   /db_xref="GeneID:3372260"
FT                   /locus_tag="cgd7_1340"
FT   mRNA            complement(<349543..>352797)
FT                   /db_xref="GI:66362703"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1340"
FT                   /db_xref="GeneID:3372260"
FT                   /locus_tag="cgd7_1340"
FT                   /transcript_id="XM_628316.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(349543..352797)
FT                   /locus_tag="cgd7_1340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with signal peptide and 2 cryptosporidium-specific
FT                   paralogs, putative secreted protein"
FT                   /db_xref="GI:66362704"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1340"
FT                   /db_xref="GeneID:3372260"
FT                   /translation="MKLIFTISTALAFVGACLAENFDQFYMPTQVVPGLHPPSQHSAAL
FT                   TGAVTNMYMSGPWMSPLEHKKWVDSLREYRLPIGYIPIARRYQRVKESAVLERARQWAE
FT                   IAAWRFQSDPKYSNSPFKYTVKDFETMFQKFSTFGWSQEACEQVLLDMGIHSENTETWC
FT                   SNIEPWGHDECADLAWPDFVLVDDIENRFRGKLEQQSICRLVQLVRPSQLPNVKYRTVY
FT                   DVCQQNILALRDPLTVETVTQEDAETICKMMDFTMTPECKRVPPRHIQKAQELSVAFGE
FT                   AIFPRLLDFRVSDACKVVSAMKDEESQTLEFCRNEMISLLWNRAANMGDTVSPWGWDIV
FT                   SQFVEACQEVYKKHSKRQKELEEKAVILTGGFFNPTQTYTTRWWKTSPIGQKLAVLLSS
FT                   EPALSQSLQEGIISPTQLMWAYNIYDEYKAMGFNVYSLIEVVNMVREFNINEPQITCES
FT                   ILNSYLGKFENNDENAPREQFTGAEVRKMCSAMEKQSVEICRRFLVSPLIGIARDVRSY
FT                   FLKELRGNTLMQLEDVCLLVAAMNVPKISPSKGSVQRRCSHAMNRFVLKNVNLTFAQRY
FT                   GLTATQQEEICIRMDFWGSESCDKLPMTRRPIIHPFTRKIYDLSKRYGILEYRFDEICK
FT                   AFELMGDNPPREKCEFVMISEFFGRWLDTSNSLFQLSHHACSSFFERRTSGKELNEIKK
FT                   ALNSIKDFMDGKGEYQLPSAEKTYQQFMDDKIKATKTKTRRYDVMPSLTEGSQVESLPG
FT                   VLKTLESIEASNSPGIDDVRGKYYSALTKVQLEMLNRIVSHKPTKDEKRTTVEAFAKVI
FT                   YKLNQFTVLESCTGQLVDDLGYSIESAKSICALIDPLQSESCLSAQRIDFITAKQLHQK
FT                   LASKTGFSQFINLSHLCDVVNYVNILKYANKVKQGRMRIATPSCRNAVKTILFPKYLSA
FT                   QSNQMLSQICSILDITSDQNFNGGVLKTNLERYYAFKLADSYGHRLDLLPKKRTHPITW
FT                   QLIMGVVRRIKPTGQAKVTRSQCTSAMQAVFGKFRQFSPVESTEACCLAFGCPDFVVNG
FT                   DFLSPPASNEASAQQDTSVFATTGRTLESPTQDFSQ"
FT                   /protein_id="XP_628318.1"
FT   gene            <354235..>355443
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1350"
FT                   /db_xref="GeneID:3372237"
FT                   /locus_tag="cgd7_1350"
FT   mRNA            <354235..>355443
FT                   /db_xref="GI:66362705"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1350"
FT                   /db_xref="GeneID:3372237"
FT                   /locus_tag="cgd7_1350"
FT                   /transcript_id="XM_628317.1"
FT                   /product="hypothetical protein with a possible
FT                   transmembrane domain within N-terminus"
FT   CDS_pept        354235..355443
FT                   /locus_tag="cgd7_1350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein with a possible
FT                   transmembrane domain within N-terminus"
FT                   /db_xref="GI:66362706"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1350"
FT                   /db_xref="GeneID:3372237"
FT                   /translation="MQPIGAFGMVPQLINPPVMMVPGRSSGKGSSGNCCGGSNSKRKGS
FT                   CGSCGRCFGSLFIILFAFICTSCCYAYPIYNSFTNPEYFKKQETPIWTWETAFSKAKEI
FT                   GYSMSLTKSPEDGNGTSENTARSREMDRVQFLKLNSTDDNNRNASTFINLENILGQNSS
FT                   KIFFPPYNNTYISSLLYSNPERKLSIRGGVGGLNLVKDLAIGVKTKQIPNKYFNKEYCD
FT                   RGREEKSEGVWNEFCNYKHNVTNLECIDMMNGPAICVGIRNRKYEVFSVSKQCKFIDPE
FT                   IPVEIFPTISDICYSGKYLNSSLATFNITKPICPCMISSSPVDNLELNENTTIATTLTG
FT                   NQKTRDFILQDKANPETQKMLRGPEGISDSSSNSGLIHSTAKTLNHAIPGNNTNSTLKM
FT                   LNS"
FT                   /protein_id="XP_628319.1"
FT   gene            <356988..>360026
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1360"
FT                   /db_xref="GeneID:3372261"
FT                   /locus_tag="cgd7_1360"
FT   mRNA            <356988..>360026
FT                   /db_xref="GI:66362707"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1360"
FT                   /db_xref="GeneID:3372261"
FT                   /locus_tag="cgd7_1360"
FT                   /transcript_id="XM_628318.1"
FT                   /product="protein with signal peptide and Sec14d domain,
FT                   probably secreted"
FT   CDS_pept        356988..360026
FT                   /locus_tag="cgd7_1360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with signal peptide and Sec14d domain,
FT                   probably secreted"
FT                   /db_xref="GI:66362708"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1360"
FT                   /db_xref="GeneID:3372261"
FT                   /translation="MMTTRYSFLHALICIWLLFRIILEPVNGKNDSKFKFGPQHPPHDR
FT                   TVITDFDNYAIQYCGLKDSVFNVAHCIFHAFVEILEERELKYEDYESVINLLLQGKNLA
FT                   SHQKLISSTNSCQSMVVPYIKFSKPKSSKSIMGVKISTKIEDYCKFAFRCISNGSNTLV
FT                   KSKQSVMQEHLGKWIGTSLKENEGFGIVIASRLDFRISQLKVRSKEPNELLKIGCKLAS
FT                   ESPSKRESLCMEIFNNKEICSIVAPYKLSFKGWSHPPIDPIQNKPFKFNPKTMIDEKIK
FT                   SIVNIQVNEELPPYCMPQEIFSYKPPPETYTKEKKIIHFYTDISQTEKAIIDQFLMHFV
FT                   INYGKIPRVIFDRRSRYAIEGWLSHKNKSPIISVHNSMYSLGRKLHYKDAMSGMLYSNS
FT                   GYKKETYPYNLPQFKIFSVYSDKTHTFDISDTNPLISTCLKEGCAYFIGRSASMTPVLV
FT                   IRASTIISIKSFKQSSASFLVMFLMEFAEKYLFFPGKVETIDIIVDCRGFSLTNFSTLL
FT                   RIKPILLYWQDEGIVNQYPLRFNNIFIIQQNDIWTTLKDILGRFWLEETVKSVQVISNV
FT                   SNNPKDNPDLKLLWRYISPHLIEIDIGGSRPKLQSGQFYPFKILPGPYKPFNTNLLDPK
FT                   VTPTLSDWPSPDFNSPKNLYKLLPKNFFHSREKTLDGNENVAPINWKESKQLLNSIPKN
FT                   LWPEMSTPTSEFKSEDNLENKADSKGSLVSENKGEKNDIEDPQDTQNRNDTSKTTIDTE
FT                   KLTKSTPRSINTLSSGKDRDLLLQLLLTQKMLGNLKEFHSLRLEKIKNKRNLEEQCIQL
FT                   ATTHITFFSKLVDKAHIEILSKVAKMKQNKKAPNMPQVDKRLSIFEAYKDIASTLNLSR
FT                   AKNMLSEKSLSYLEQIGRKISGIETKINKARQEIRILLKEDPSVLKEKASSAWNELLTA
FT                   LNELGELRKGMSDIEIKEKKINIRLRQMCEQLTSSMGVTKSFLDSYSKYDHYSMFESSL
FT                   LYNMINTIIKGQEYSFENSTNGK"
FT                   /protein_id="XP_628320.1"
FT   gene            complement(<360653..>361234)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1370"
FT                   /db_xref="GeneID:3372238"
FT                   /locus_tag="cgd7_1370"
FT   mRNA            complement(<360653..>361234)
FT                   /db_xref="GI:66362709"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1370"
FT                   /db_xref="GeneID:3372238"
FT                   /locus_tag="cgd7_1370"
FT                   /transcript_id="XM_628319.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(360653..361234)
FT                   /locus_tag="cgd7_1370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362710"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1370"
FT                   /db_xref="GeneID:3372238"
FT                   /translation="MPYIYNKGFKWFFIATLVFIFGLLILSCRAEEIEGEDIVKLVEND
FT                   HKQAEDNNQESQKPSSEKVVELEGADLSNETSEVQNPEQIYEACASLQESFEKECSGEQ
FT                   MDKSIQKLVEVCSDPVPDTQEVLTAASEITRNYSDSNFSETTECWAMVYTTSLYISSNS
FT                   QAVEQEDDESLEIESLETDDSQIESEFENN"
FT                   /protein_id="XP_628321.1"
FT   gene            complement(<361355..>362371)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1380"
FT                   /db_xref="GeneID:3372239"
FT                   /locus_tag="cgd7_1380"
FT   mRNA            complement(<361355..>362371)
FT                   /db_xref="GI:66362711"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1380"
FT                   /db_xref="GeneID:3372239"
FT                   /locus_tag="cgd7_1380"
FT                   /transcript_id="XM_628320.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(361355..362371)
FT                   /locus_tag="cgd7_1380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to bacterial SbmA transporter protein, 4 or
FT                   more transmembrane domains, 4 paralogs in cryptosporidium"
FT                   /db_xref="GI:66362712"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1380"
FT                   /db_xref="GeneID:3372239"
FT                   /translation="MIRKFLFSSRYSASTWFYCFLLIILNVQYSKLHLKVTKWFSEIYN
FT                   LLVSSFNSKPGESYEDEIREKMLNLPLFLIFLCVFRVLSNFFLTVILLNWRNYESKYLF
FT                   DNWRFIKGVEGVSQRIQEDTLQVLKLILNLFFKVVISISRSLVHIPILIEHSRKVSGIP
FT                   PFPSGFEYSLISYLAISISVSILGVYFTSRKMSSKIMRKEIVEAEFRKQLILGEEGIPR
FT                   LNLSLIEDTLVDELKLIHSDIYLYSFRYSLISESLGSLVGFLPTILLIPAIVRKDITIG
FT                   GRATIIRCFNTVTSGITCFFFNWDDISELYTAIKRLYNLEQRINKCKLEPSTLLNEA"
FT                   /protein_id="XP_628322.1"
FT   gene            <362520..>363521
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1390"
FT                   /db_xref="GeneID:3372240"
FT                   /locus_tag="cgd7_1390"
FT   mRNA            <362520..>363521
FT                   /db_xref="GI:66362713"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1390"
FT                   /db_xref="GeneID:3372240"
FT                   /locus_tag="cgd7_1390"
FT                   /transcript_id="XM_628321.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        362520..363521
FT                   /locus_tag="cgd7_1390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to bacterial SbmA transporter protein, 4 or
FT                   more transmembrane domains, 4 paralogs in cryptosporidium"
FT                   /db_xref="GI:66362714"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1390"
FT                   /db_xref="GeneID:3372240"
FT                   /translation="MILFSGLSRRSLIKLFLFLAAISACSVLLLYLEFSGNSQLKTFGD
FT                   VLQAAVKDRSSVSASDLYTSFFALISYKLAVVFLKSVSSFLSKKSIFFWRLQLTEYFLE
FT                   NWENIYLIEGVSQRIQEDTMRYCRLFEKFSIFVVQDLFKLFIYLPLLLDLSKHITRTWF
FT                   IPNTRHLLLVLIIINSIIGTSIIIFPSKYLSRLVYNIDKEEAAFRKNLVLFELEERDFS
FT                   NFDFDGNYISVDNTHRSYYRRYYFIKILQLLHFRLSMITYWLFAHPSMVPPYTLGLLKQ
FT                   TMHAFDEVSSVFNFVVSHFKSLVEYIAVFLRLNLMVKQTIKAKETDKSGIYH"
FT                   /protein_id="XP_628323.1"
FT   gene            complement(<363648..>365840)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1400"
FT                   /db_xref="GeneID:3372242"
FT                   /locus_tag="cgd7_1400"
FT   mRNA            complement(<363648..>365840)
FT                   /db_xref="GI:66362715"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1400"
FT                   /db_xref="GeneID:3372242"
FT                   /locus_tag="cgd7_1400"
FT                   /transcript_id="XM_628322.1"
FT                   /product="signal peptide containing protein"
FT   CDS_pept        complement(363648..365840)
FT                   /locus_tag="cgd7_1400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal peptide containing protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362716"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1400"
FT                   /db_xref="GeneID:3372242"
FT                   /translation="MNQGKILRGLGFLILAICLNVEVKSQQVSTTIESDLSLNSDISKN
FT                   GGAEPIKEVASSNGTMNSTSITESSEENLGNKLSNPEIIPVNMNFTEDSCFNRTLPINC
FT                   DNSNSTLLVPITSRFTTTIVGDSYKFGMSYEFKSEDDSELISFKLGSKENSAIVKISSL
FT                   VNGTQVNDGITTLELKGCQDDFTIANDATNSTLGIGRMTFVMVLTNTTISFTLNNLVYN
FT                   ILNINLAEKPIRISKIQTSGLENVRISVIPFIENNEMENCVLSVPVTGSSISNLNISPY
FT                   SKTCLSSNVIIPKSTLIPGSQILLGIPGSVSSKSVKMPSTTHVILNSNSGLILFHLIIN
FT                   DNGLFLKGTSGTDIIRSKGGYFPLQSYGFQSYAIKLVFTSLFVTISVNGFYAFDPIVIP
FT                   NGEIPYGITFEGLHRKPTSTVLPTRPCTRYSYSGSGTCSIDGILPVLKSSNSQSKDNHG
FT                   QTFVAVRVASDSTEDKKKTMISFDNNADVAEFLVGVNGKSAVLITNLTNLDKVDYENIP
FT                   QNDTFVLKDENAGGLRRNYFNNLENVKSTKVSKTLGDYSVNINGDNIDKISSEFQPIRK
FT                   SCVLEQHRGSYISTVCDSNRLCFTSASTGSPVGGVLHFIGGFSNGALKVDIYTKKEGFS
FT                   FQIEYTSSGNINVFRTSAIKENEPIYKGHYISSATSSSGRGVISVKDLGQFLLLSIDKM
FT                   EVTKISKGGYGPDGNISCVQFFANESDDISIFFEVQ"
FT                   /protein_id="XP_628324.1"
FT   gene            complement(<366909..>368792)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1410"
FT                   /db_xref="GeneID:3372241"
FT                   /locus_tag="cgd7_1410"
FT   mRNA            complement(<366909..>368792)
FT                   /db_xref="GI:66362717"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1410"
FT                   /db_xref="GeneID:3372241"
FT                   /locus_tag="cgd7_1410"
FT                   /transcript_id="XM_628323.1"
FT                   /product="AAA domain containing protein"
FT   CDS_pept        complement(366909..368792)
FT                   /locus_tag="cgd7_1410"
FT                   /gene_family="HOG000231291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA domain containing protein"
FT                   /db_xref="GI:66362718"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1410"
FT                   /db_xref="GeneID:3372241"
FT                   /translation="MFFSGFGGRQGSPNPDSGSGDKDSGGKYTGGNGGGSINGNFDPTA
FT                   LERGAKALKQLDSSPNAQKAFEIIKLQEKTKQKELERDIEQSSAYRSKANLERTRIEAD
FT                   ERRKTITHQQEEERATSQYKAKLETEAYYKKLKEQESQNARMLKQQHDKFLEQEEIRKK
FT                   NEREILEMKRRQSEYENKLQQENIKVRIREETIGRIKAERENADIRLGEIKAKAKESRT
FT                   THLESIKTIFGGIREMGSSLYQDKSKLTMLVGGLTAMAFGIYGAKNTTRVVANMIETSF
FT                   GRPSLIRETNMSFLTRHGLKVRNNFFSPAIAFRLLGLRNKLVKKPKVFENIVLPSELEN
FT                   RLNWTVNTLVNSRRFDVPFRNMLLWGKPGTGKTMFARKLAKESGLDYAIMSGGDVGKLG
FT                   KNGVTELNKVFDWARKSNKGMLLFIDEAEAFLSKGRESTTSSKSENSRNALSAFLHQTG
FT                   TESKDICILLATNVPGTLDSAVIDRVDEVFEFPNPGFNERLKLIKQFLELNFNCSYESG
FT                   KFINLPSLYNSIKIHPSLDQTFLDVLARKTEGFSGRQLFKLVLGMKSIVLGSGVESLTR
FT                   EIAESALSWKLDGENNLNLNSSYSSTSSKSSANQSSHINCDNSNSDLTNLE"
FT                   /protein_id="XP_628325.1"
FT   gene            <369293..>369670
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1420"
FT                   /db_xref="GeneID:3372244"
FT                   /locus_tag="cgd7_1420"
FT   mRNA            <369293..>369670
FT                   /db_xref="GI:66362719"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1420"
FT                   /db_xref="GeneID:3372244"
FT                   /locus_tag="cgd7_1420"
FT                   /transcript_id="XM_628324.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        369293..369670
FT                   /locus_tag="cgd7_1420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362720"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1420"
FT                   /db_xref="GeneID:3372244"
FT                   /translation="MSDSSILLYENKSQRESGRPWKDTPNLKSKLQKRVTGKKKTYEER
FT                   IREKKEIQRIRGIELAEKEERAKARKEAKERKRLKQQAKMNREILSSGVQVITRTDKIK
FT                   NWNKKARKMLRKVSLESLNSR"
FT                   /protein_id="XP_628326.1"
FT   gene            complement(<369854..>371245)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1430"
FT                   /db_xref="GeneID:3372245"
FT                   /locus_tag="cgd7_1430"
FT   mRNA            complement(<369854..>371245)
FT                   /db_xref="GI:66362721"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1430"
FT                   /db_xref="GeneID:3372245"
FT                   /locus_tag="cgd7_1430"
FT                   /transcript_id="XM_628325.1"
FT                   /product="possible phosphodiesterase/alkaline phosphatase
FT                   D, of possible plant or bacterial origin"
FT   CDS_pept        complement(369854..371245)
FT                   /locus_tag="cgd7_1430"
FT                   /gene_family="HOG000282866" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible phosphodiesterase/alkaline phosphatase
FT                   D, of possible plant or bacterial origin"
FT                   /db_xref="GI:66362722"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1430"
FT                   /db_xref="GeneID:3372245"
FT                   /translation="MPSIFWIYLTFHLFIGVFAEDSSSEKLLKSLVFISCVDGQKQDKS
FT                   GNYVSQEYWKAIQSDKPDALFWMGDSVYTKCGSPVCVSKGYLVQSNNSFYRDLLKTGLF
FT                   VDGTWDDHDYGVNDGGKYVAFKDESQQLFLDFISLPKDSPRRNRKGVYSSHTFGPPGKQ
FT                   IKVIILDTRYHRDNYYVHERYGILSFAHLDTPFTSIFAASLRFFASIFGYGHSYQGDML
FT                   GKEQWDWLEKELSNSKALANIIISSIQVTTQYPIVEGWGHFPKSRERLFSLIKKTKPKG
FT                   LFFLSGDVHWGQIFESDDSQKSLVEITSSGMTHSVSDRILDSFVISTTLPIFTGWSLND
FT                   KSPNYFIRENYGKLDFEYLCTDSKECSGIIVKATIRDLNGDIKLKKIFKFDNESNENHI
FT                   EAISKIPQMIVEKSARQIFGRLCIIIVSIIWGIQIVIVFLYFILRIITSFTRLFSKNNS
FT                   KAKSE"
FT                   /protein_id="XP_628327.1"
FT   gene            <371387..>373336
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1440"
FT                   /db_xref="GeneID:3372246"
FT                   /locus_tag="cgd7_1440"
FT   mRNA            <371387..>373336
FT                   /db_xref="GI:66362723"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1440"
FT                   /db_xref="GeneID:3372246"
FT                   /locus_tag="cgd7_1440"
FT                   /transcript_id="XM_628326.1"
FT                   /product="protein with 5 TPR domains"
FT   CDS_pept        371387..373336
FT                   /locus_tag="cgd7_1440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 5 TPR domains"
FT                   /note="no plasmodium ortholog"
FT                   /db_xref="GI:66362724"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1440"
FT                   /db_xref="GeneID:3372246"
FT                   /translation="MAMDILKACFRFSFLGLRSNEQWLGELFSLSSDDQLGSQKVELNL
FT                   DGQIFGGLSVKQSLALLRARSYFESLEFTRAFGVLNDEISLNKSGIAMFMKNYYQLLSL
FT                   ERQNTKTDRLEDLVVPPSEASMTSLKYSKIEMEVLNFLTCLNNSNMDEKPEVVGLLEWL
FT                   VSIVIYRQNRYMEALEFQINSLKKDPLNWSCWQDLVRNFISNGQGNIVSSFKPCEDVEK
FT                   SDLSQNDTFLNENLHRNLGLQPFKKKQSSGLSRSLRDSSFKDFLNSLGLNESLYAHLAY
FT                   ALYLETTGKWKEALCEYNQISMEVKDNSPYIESRIARCNRELGDLETALKAHDSILSKD
FT                   KAYLGNAIELASIYSESKNIKELNLLAKRCVELSKYSVDTCVVLGIYHWLTNDKYKALR
FT                   FYKRALLMDSRSSQTWVLCGYALHELGDIRSSLFAYRTALNLDSSNVQAIFGIAQIYSR
FT                   LNLHAYSIKLYEKALNQSPGDAFLWYNHGISLEKAGNYQEASRSFYKALSCESSKNSSS
FT                   DSEIKYMGKLLKLETDQWNQAGSLYWARKIIIKAIELGFLEKASSKTDSTFDTSYSTYS
FT                   DENEFFSNWQRLRWSIRMIPQKLPLDLIIALECVLQLHSTPIDEKNSVKSELLVENIRE
FT                   LLNNPKSFQISKDY"
FT                   /protein_id="XP_628328.1"
FT   gene            <373631..>374740
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1450"
FT                   /db_xref="GeneID:3372247"
FT                   /locus_tag="cgd7_1450"
FT   mRNA            <373631..>374740
FT                   /db_xref="GI:66362725"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1450"
FT                   /db_xref="GeneID:3372247"
FT                   /locus_tag="cgd7_1450"
FT                   /transcript_id="XM_628327.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        373631..374740
FT                   /locus_tag="cgd7_1450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362726"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1450"
FT                   /db_xref="GeneID:3372247"
FT                   /translation="MRFVFTSDYNDDNSLSHSSYLNRPNAYGYSRKEFKARSLEHSSKT
FT                   AKRILSHIIPELSISQFNESVRIFNAYLESYKNTPKSIPRIESLISASAYISVRKDGGY
FT                   LSLLDIASRLKSKNYRSFASLIKRICTRLRIKNLPNPSIEESLNHLCYKVEKFLKEKTI
FT                   QNANEQYQKETIIFQNPEKETDDIRNLMLDSLIKDSSIDLESKKLRNYNSNPGSFLNSM
FT                   KHLKTKTEAKTSLDSLIKAKNFSLLILKTIALDQDHASLNNHDDILNPLWLSNGVSSTP
FT                   IISASLYFSFKLYCRNISFNDLLKATGVSKSSIIKARRSLSHKLRLISQKLFPGWLSSD
FT                   MLNCNSELPPTIIESLTKLIQSYYSNLKT"
FT                   /protein_id="XP_628329.1"
FT   gene            complement(<375157..>375417)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1460"
FT                   /db_xref="GeneID:3371860"
FT                   /locus_tag="cgd7_1460"
FT   mRNA            complement(<375157..>375417)
FT                   /db_xref="GI:66362727"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1460"
FT                   /db_xref="GeneID:3371860"
FT                   /locus_tag="cgd7_1460"
FT                   /transcript_id="XM_628328.1"
FT                   /product="ribosomal protein S27"
FT   CDS_pept        complement(375157..>375417)
FT                   /locus_tag="cgd7_1460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S27"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362728"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1460"
FT                   /db_xref="GeneID:3371860"
FT                   /translation="IKLIMDINLLNPDPRVEAQKHKLKRLIQSPNSFFMDVRCPGCLQI
FT                   TTVFSHAQSVVFCGNCSAPLCQPTGGRCKLTDGCSFRRKND"
FT                   /protein_id="XP_628330.1"
FT   gene            complement(<375651..>376685)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1470"
FT                   /db_xref="GeneID:3371781"
FT                   /locus_tag="cgd7_1470"
FT   mRNA            complement(<375651..>376685)
FT                   /db_xref="GI:126652715"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1470"
FT                   /db_xref="GeneID:3371781"
FT                   /locus_tag="cgd7_1470"
FT                   /transcript_id="XM_001388338.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(375651..376685)
FT                   /locus_tag="cgd7_1470"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126652716"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1470"
FT                   /db_xref="GeneID:3371781"
FT                   /translation="MSNKDENDGSVLYEEVLPDSFYDDPEFMKFYSLKLPMKLANEFSR
FT                   FVNNDQFTKRFPHIKRMRKVVIKENDLELRNFSSSSNDIRVEILIGETQECLPVEADNY
FT                   LKENHIDKIWNVIEVPKNPPLTREKFSQLSKIWPLSFLKPRFTPEVLSDQVQHESDKFV
FT                   KLACKVGEFAQSIGNPPRGCVITLKGKIVAIGEDNRNSDYPWMHSVMKAVDNFSKRVCS
FT                   SSLSMPKMTNLLDSKIQDENQGSQNNEDHKDHLIEIKSKYNISEDQILSDSELKDQYLC
FT                   TNGIAYLSHEPCISCSMALVHSRISKVFYMHKDKERGFLGSNHKLHCVSELNHHYRVFR
FT                   ANID"
FT                   /protein_id="XP_001388375.1"
FT   gene            complement(<376707..>378212)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1480"
FT                   /db_xref="GeneID:3372248"
FT                   /locus_tag="cgd7_1480"
FT   mRNA            complement(<376707..>378212)
FT                   /db_xref="GI:66362729"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1480"
FT                   /db_xref="GeneID:3372248"
FT                   /locus_tag="cgd7_1480"
FT                   /transcript_id="XM_628329.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(376707..378212)
FT                   /locus_tag="cgd7_1480"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362730"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1480"
FT                   /db_xref="GeneID:3372248"
FT                   /translation="MLKDFLQTFERYSLPEKSEYLEISILVDQDLDPKEYSKLSEAHFL
FT                   QLLILAQNQLKLFLESRFIHEAVPENSKIIAVSSNLPLLITLSFLLEDKKKSLLVYDEL
FT                   EDCFIGSFTCFDALLIFYILYILVKNENSEEIDDNFPFKTLEELSKCSIKHWLKKVLDT
FT                   NEALSKKLITMSETLYEGLKLCLDLESNYKRIKLKDQEFNYNDLGTWVIEDRNDLSESK
FT                   SFKEELGSKSMGLYPICYFSPLTILSDLVQNLQICSGSIPKEKFQPEDEVATAAEKDDP
FT                   DCDMTPQGSVFGRVFHNKVLKHLGMGKKVPKSLKASSPLRLALEMFLKEGLTHIPIVFE
FT                   EDNTFTGTVLTMEKCCMYLARCVSNQEKALMEDSIENIFNIYNKEAYDTLGNTVIQLSG
FT                   LNCGKGCFEYNNNSDISTSKIDTRKIGDEKEFKEENQVKDNTENDGCNSSFLVDICLSG
FT                   AISHILLSEDQCLILVDKKTNQVTALLTALDICKLLTGAQTQE"
FT                   /protein_id="XP_628331.1"
FT   gene            <378391..>380172
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1490"
FT                   /db_xref="GeneID:3372249"
FT                   /locus_tag="cgd7_1490"
FT   mRNA            <378391..>380172
FT                   /db_xref="GI:66362731"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1490"
FT                   /db_xref="GeneID:3372249"
FT                   /locus_tag="cgd7_1490"
FT                   /transcript_id="XM_628330.1"
FT                   /product="tryptophanyl-tRNA synthetase"
FT   CDS_pept        378391..380172
FT                   /locus_tag="cgd7_1490"
FT                   /gene_family="HOG000224742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="GI:66362732"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1490"
FT                   /db_xref="GeneID:3372249"
FT                   /translation="MSTKNPILFSALCVVKGSISTLFGLSGKVSKLKFKNEKVSFNYSL
FT                   SKEIEMNDDTLEELNNIISYKIKENSFFQVFKILSKEAASIYGSEHLESDQAIPDDIEL
FT                   RIVTLRNFYLSATRNPVLRNTKDIGNVLIENISLDHENSALLVNFKVENPLVRASEENF
FT                   KDLCCEEYSIQDIKDGKFIVPSLEDSLPISINLDIIGDELVNPWEVKADNAYGIDYNKL
FT                   IDKFGCKLITKDMIERMERLTGQKAHHFFRRNIFLSHRDFEKILDVYEKGELFYLYTGR
FT                   GPSSESLHVGHLVPFLFTKYLQDTFKVPLVIQLTDDEKFIFKSNLTLEETHNYAYENMK
FT                   DIIACGFDPELTFIFTNLEYIAELYPDILRIEKKISCSQIKSIFGFKDSCNVGKFAFPA
FT                   VQAAPAFSSSFPHIFGGRTDIHCLVPHAIDQDPYFRMVRDVAPRLGYLKPSSIHSIFLP
FT                   SLQGSQTKMSASVQNSSIFVNDNEESIRNKIMKYAFSGGQATEEEQRRLGANLDVDVSW
FT                   QYLRFLMEDDEKLEEIGKKYSSGEMLSGEIKSILVQELVKLTKNHQKNREAINDDVIAK
FT                   FTNKSREQLLKLFINKK"
FT                   /protein_id="XP_628332.1"
FT   gene            <380465..>383509
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1500"
FT                   /db_xref="GeneID:3372250"
FT                   /locus_tag="cgd7_1500"
FT   mRNA            <380465..>383509
FT                   /db_xref="GI:66362733"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1500"
FT                   /db_xref="GeneID:3372250"
FT                   /locus_tag="cgd7_1500"
FT                   /transcript_id="XM_628331.1"
FT                   /product="conserved protein"
FT   CDS_pept        380465..383509
FT                   /locus_tag="cgd7_1500"
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved protein"
FT                   /db_xref="GI:66362734"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1500"
FT                   /db_xref="GeneID:3372250"
FT                   /translation="MSKFYILGNGKYTLGVCAMENKVESPPMKSILNRITETGEFTIIV
FT                   FMQDMILNEDILNWPKVDCLISFYSTGFPLNKAISYAKLKKPIILNDLEKQILMRSRLE
FT                   IYNVLDKWKIPRPECIIINHSELSEENHDIFYEEYDFITYKGHKIQKPFIEKPIFSDNH
FT                   DNWIYYPENSGGGCKKLFRKIGDRSSEYDPSLWKIRKDGTYIYEKFLPTFGTDIKVYTV
FT                   GPMFAHAEARKSPCLDGKVQRTEKGKEVRYSVMLSYEEKLIAHQIVKAFNQTICGFDIL
FT                   RTVTGKSVVCDVNGFSFVKGNEKYYNDCAQIITSLFIKKLFKKNKIIPMIKFEKKKNMI
FT                   SLTKKFNEKNSEIQDDSKFNSNVKQEQQKDELSTVIVIMRHGVRKPKLKLKFETQDHRI
FT                   ISLISDGKEETRLKSPEELSLLLVKNTLILENLFMYLEDHSKILSDNEIHTICKVLNNH
FT                   LKLQAFLGDGKGFSGVNRKVQLKQIVHAENSLNNKKTVLLVAKWGGELTRIGCEQAEEL
FT                   GKHLRATLYPGDSEGLLRLHSTFRHDLKIYSSDEGRCQVTSAAFTKGFLDLEGDLAPIL
FT                   VQLVIRDSFARNLLDDPHLTIERKKCKEIIEELLNIDKVVGYEEILEVWKNYKSDLKED
FT                   FPSEQVIRTLMSCGNPYSTLKKLHMLMKELVMKIHIDQDEENNIVIYQGFRQSLDSLFK
FT                   VHSSEKNDGFPVSQEMMQRWNQLTTSFFNEETQKFLTAKIPDIVDNAMYDIYYNVNFIK
FT                   NEVSLLLYEIYETVVPVGEFVSLFQYGLSGDQKVSIGKAITENLIEKLLQDVKYSYLKK
FT                   LQCENNERKENENQDKTAGFNFKNGKKIFNKAVASKKNGSFNFHKVHPEEHIRLKEEEA
FT                   KAFGIKSPWRIVRSRFYVTSASHIQSLANIFSSMYKKQISLNDKTSLLDLENTFSELNY
FT                   LSHLVIRVWESKSVSESNQDRFKLEMFVSKGVKNKIGHIFTTGIEADNQITSQRISELF
FT                   PLKKVTLKNFNITEFENKIRELIKD"
FT                   /protein_id="XP_628333.1"
FT   gene            complement(<383579..>386374)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1510"
FT                   /db_xref="GeneID:3372251"
FT                   /locus_tag="cgd7_1510"
FT   mRNA            complement(<383579..>386374)
FT                   /db_xref="GI:66362735"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1510"
FT                   /db_xref="GeneID:3372251"
FT                   /locus_tag="cgd7_1510"
FT                   /transcript_id="XM_628332.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(383579..386374)
FT                   /locus_tag="cgd7_1510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362736"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1510"
FT                   /db_xref="GeneID:3372251"
FT                   /translation="MKVKVILRAPKSQIPLYMTLNDAKFGNEEVATSLNVVESDEVVRW
FT                   VNTTNEKSPTNLQIAPQKQLVISDDLARSITNSISDIIKNKNKANNSMENRVRDLKSNS
FT                   ILSSERHKYNVSHVKDALLVKKTVPELPIKNDNDNVEANSNETITVEKNPEIGKIEKLL
FT                   SQDLDKCSSPNSGPMGVSVGSKYNGKELKSNIRKKYFKSSNLKGNKSDYEYNKKFRSNE
FT                   DFPEYYHDLFPQFNDSSEEKDVSDSPKDSDFDQFRNSEMISKKIQDEIDHASKIESIQC
FT                   EIVKTFKNLTLSPCLCKSQESPNNPYDRNKVIIQKSLFINELREKVPLKNNYVSPKNDS
FT                   RNMYLLIHGSGKEAESAVLSKDLKSKTVCNLTDKLSSIDQAKISKSPKSSNPKNVSHEL
FT                   NSNQKFEHVFDNNYKETNHIHLEGQNKSKSQDQSKSGAQDENIGEYDHTNDYLDKDETK
FT                   VKNEQKSQKEDLDPKSQLFQALSRLSLELSNTNLALDQCLKEKEDVISSMEGVLIKGLQ
FT                   DKLDNLELLYKKIQIKQDQDELNEDLNQVENLKKDFQSTYYQHKSQNDNEASIFFSEDE
FT                   HRFEQNNHDSYEVTFNKNNSGKLPNTDLPLLRDEMLSQEEEQTNFVTRKPPIQKIVQSY
FT                   NESFKFKPLSRIESKRSISVPVQENQLSNFHCEKNTKSIEEIPSLCELQDKYYRDKNLS
FT                   SSIGSFSSINSNNSITSKSPLSKVGLKPNSSSERLSPNIEEGSRGRTKFQGNHHSRAAT
FT                   RDFVAENKSNVILNAAKSSSSLFQNNPNKKNTKLIKKKSPNGKANQNSFNNDDNNGKVN
FT                   ATNHKYHLNQNGPNNFDSGNEIYPSLEVGGPIARMNGACGGFVPCFPGPYLNMHYDPHF
FT                   GNFSGNNYNRSNYQYMNNHNQFPQYQQPNYQKMNGYIGANAIVDNNTPRCPYWCNLICR
FT                   T"
FT                   /protein_id="XP_628334.1"
FT   gene            complement(<386993..>387298)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1520"
FT                   /db_xref="GeneID:3371782"
FT                   /locus_tag="cgd7_1520"
FT   mRNA            complement(join(<386993..387166,387221..>387298))
FT                   /db_xref="GI:126652717"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1520"
FT                   /db_xref="GeneID:3371782"
FT                   /locus_tag="cgd7_1520"
FT                   /transcript_id="XM_001388339.1"
FT                   /product="peptidylprolyl isomerase, putative"
FT   CDS_pept        complement(join(386993..387166,387221..>387298))
FT                   /locus_tag="cgd7_1520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidylprolyl isomerase, putative"
FT                   /db_xref="GI:126652718"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1520"
FT                   /db_xref="GeneID:3371782"
FT                   /translation="SSSCMIKLQEYKSVLKYCTETLKLDKNNVKALYLRASSYLKLDDP
FT                   DEARIDLYKAATIEPQNIEVRTKLQQVSLILSFLLISP"
FT                   /protein_id="XP_001388376.1"
FT   gene            <388447..>389661
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1530"
FT                   /db_xref="GeneID:3372252"
FT                   /locus_tag="cgd7_1530"
FT   mRNA            <388447..>389661
FT                   /db_xref="GI:66362737"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1530"
FT                   /db_xref="GeneID:3372252"
FT                   /locus_tag="cgd7_1530"
FT                   /transcript_id="XM_628333.1"
FT                   /product="ART-4 protein; PIN+Zn ribbon domains. involved in
FT                   RNA metabolism"
FT   CDS_pept        388447..389661
FT                   /locus_tag="cgd7_1530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ART-4 protein; PIN+Zn ribbon domains. involved in
FT                   RNA metabolism"
FT                   /db_xref="GI:66362738"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1530"
FT                   /db_xref="GeneID:3372252"
FT                   /translation="MGRYIILDTGAILRLGKHDFMDDVLLTVPSVIREVKDKKALEKMF
FT                   YLQDRIQVMEPSEQDCGFVKKFSKETGDFGFLSETDFQVIALTLSYHKKYDEISKLNSK
FT                   PREISLVTKSEEVGSCEKGMDKDLQEVEMETGEQKEQSTEDEDDWETANGQSSRREEVQ
FT                   SGEDEEEEEECEEEECEEDEDVSKGLEDDVFSGGWITKANITSVMGGLSSGSQSHFVVA
FT                   CMTTDYSMQNVLLQMGLNLVEIHGLSVKTIKRWGLLCCGCYTYERDTSRKFCGKCGNAT
FT                   LDRVPIKVSSDGTIELDCYRKKVNLRGTIYSIPKPRRGVRNQEIILAEDQLMMGGRQRL
FT                   LNHQRKKWEKACKERDPFSNSGADLESSWGKQFGSFRYPEIKIGMGRGNPNSNSWQKKR
FT                   SGKKK"
FT                   /protein_id="XP_628335.1"
FT   gene            <390384..>392595
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1540"
FT                   /db_xref="GeneID:3371783"
FT                   /locus_tag="cgd7_1540"
FT   mRNA            join(<390384..391602,391832..391935,392320..>392595)
FT                   /db_xref="GI:126652719"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1540"
FT                   /db_xref="GeneID:3371783"
FT                   /locus_tag="cgd7_1540"
FT                   /transcript_id="XM_001388340.1"
FT                   /product="aspartate--tRNA ligase"
FT   CDS_pept        join(390384..391602,391832..391935,392320..392595)
FT                   /locus_tag="cgd7_1540"
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartate--tRNA ligase"
FT                   /db_xref="GI:126652720"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1540"
FT                   /db_xref="GeneID:3371783"
FT                   /translation="MTTEPEVKEQVLSKKALKKQEKQALKEAKKAEAKSNQQQQQQSVH
FT                   WSSVIVHSTEASPYGVIPFNCKIENRTFSKIKELNSNQKGEKIWLRGRITESRCKGSLG
FT                   FVLLRQTFYRLQLVVDANNGSSKEMIKWLGCLPIESMIDVYGTIVVPETPVVSSTQDIE
FT                   VLVERVYCVSSACSELPFQLKDANRVETEDEDSTIIKVLQDVRLDNRVLDLRTYLSQAI
FT                   FRIQSEVCRLLREFLIEREFIEIHTPKLLPGASESGATVFKVDYFSNTACLAQSPQLHK
FT                   QMSICGDLERVFEIGPVFRAENSNTHRHLCEFVGVDIEMNIENTYHELVDVFDAMFRHI
FT                   FQGINTHCKNELLIVSEYNPFTPFVISEKTPRLTFEEGCNLLKEAGAEIPEDLSDFDIS
FT                   TEQERLLGSIVKEKYNSDFYMMLKYPLKVRPFYTMPDFDEPEKWSNSFDFFMRGEEILS
FT                   GAQRVHDYDLLVKRCQECGVSEHSLRDYLNSFKLGAPPHGGCGIGLERVIMLFLNLGNI
FT                   RKSSMFPRDPKRLSP"
FT                   /protein_id="XP_001388377.1"
FT   gene            <393422..>395944
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1550"
FT                   /db_xref="GeneID:3372253"
FT                   /locus_tag="cgd7_1550"
FT   mRNA            <393422..>395944
FT                   /db_xref="GI:66362739"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1550"
FT                   /db_xref="GeneID:3372253"
FT                   /locus_tag="cgd7_1550"
FT                   /transcript_id="XM_628334.1"
FT                   /product="uncharacterized protein"
FT   CDS_pept        393422..395944
FT                   /locus_tag="cgd7_1550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized protein"
FT                   /db_xref="GI:66362740"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1550"
FT                   /db_xref="GeneID:3372253"
FT                   /translation="MEEGYDWDQISSFQIVDGMNISSSSLLDDELLITSPDSSNNGNSV
FT                   SLEQREFSRPICSPLSQFLVGSDGSNSKNVGQKHFSQHQHTNSAGGAGGSNFNLNNSHS
FT                   SIVGESQHYGLQSGLTNSGNNIRDNSIYNTGYQFNDTEKISTTEKEFTKRKRPYSNNSN
FT                   NNINVGSNSSNRIGNCTQNSLSGITRSVMGIGGIGAGVTNNSLTKTPSKTRTRKVRESS
FT                   DDFGNSSSGPSVHSKSGYSSNSSGESCSFGSSSNVSEDLNSVKYYEGFKLPLGDLGRKM
FT                   LLKKLREIHTQNPTKMEKALTDHGLSYTRIRFASVQQLFKISYVCDVFDYALSIHCEFG
FT                   RPRHRDSSKSVQLSSVNSNSNMMQQQSHSNISSRRVLDSQQHNNGLGGGAAVQGGISEK
FT                   FESHSSIGNTNGGVIPRGQGLLDDSSKVLGKLETDLDTYTPETSPCSHRSYSSSKSLYS
FT                   KDSSLISNTPLNKIEHDITSPISIFSTTSGSPASQRKRRGSAKSSYNFSPPPIPVTNSP
FT                   IQSGDPKDISSLNPELSNFMNNQNLINYNIIQGNVSNNNMNGNSSVSGFSTQSDVCTSH
FT                   FPDHQQQLHHNIGHYNNINNHIQNGGRAPHHPPPSYHKKHEEHEPLDSMISMNSGSDSV
FT                   LQKPAKRQKIRSKKKNALADIRSEPPTQATYSYSSSTQPGINNGSSIFVCGDIDEIYCT
FT                   STINTEVTPFYQPESEIAHLGEFETSHHSHNYHNHHQDSIHFISSTESHDQNIPICSAF
FT                   GSPFDSSLIISSSLDTESSQNSGIITCDSPTSFYLYSQPNISSNYDEYMDSSCLNGFLT
FT                   QGLNSIEMLNSSELEMDNFDIGCPLISI"
FT                   /protein_id="XP_628336.1"
FT   gene            <396599..>397402
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1560"
FT                   /db_xref="GeneID:3371861"
FT                   /locus_tag="cgd7_1560"
FT   mRNA            <396599..>397402
FT                   /db_xref="GI:66362741"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1560"
FT                   /db_xref="GeneID:3371861"
FT                   /locus_tag="cgd7_1560"
FT                   /transcript_id="XM_628335.1"
FT                   /product="DHHC family palmitoyl transferase with a signal
FT                   peptide and 4 transmembrane domains"
FT   CDS_pept        <396599..397402
FT                   /locus_tag="cgd7_1560"
FT                   /gene_family="HOG000242943" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DHHC family palmitoyl transferase with a signal
FT                   peptide and 4 transmembrane domains"
FT                   /db_xref="GI:66362742"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1560"
FT                   /db_xref="GeneID:3371861"
FT                   /translation="NRHSGNKTMSDSQKLDSRYLKILISAILIIGPCILYFISTSKWLF
FT                   MQHNYLLITLSYILFIIMTTSMVFTFLKNPGVIISQSKLSNPPCSIDLQINAQIVKVKF
FT                   CSNCKIIRPPRTVHCNICNHCVDRFDHHCPWVGTCIGAGNYKLFMLFISTLFLLELAML
FT                   LGSCKMVNHFTYEASHILNLGNSTKIFVHTMNHSAGAAVVIGFACFTILFSLSLLIFHL
FT                   YIGAMNKTTYEEIKKLYSETSNPWYSGISRNIAELFLSPSPKFNY"
FT                   /protein_id="XP_628337.1"
FT   gene            <397602..>397985
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1570"
FT                   /db_xref="GeneID:3372255"
FT                   /locus_tag="cgd7_1570"
FT   mRNA            <397602..>397985
FT                   /db_xref="GI:66362743"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1570"
FT                   /db_xref="GeneID:3372255"
FT                   /locus_tag="cgd7_1570"
FT                   /transcript_id="XM_628336.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        397602..397985
FT                   /locus_tag="cgd7_1570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362744"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1570"
FT                   /db_xref="GeneID:3372255"
FT                   /translation="METSYNEETGEKNLLQLNLANRVSEKLAKTGLWKNINVKWSHNIH
FT                   LHIVTAVQILFSSKQYLKLSTFIPLSDLDHIDSSFFENLQQDSKIILPYINSKISHHYV
FT                   LAIVSSDDELILQSVNFDLKKIV"
FT                   /protein_id="XP_628338.1"
FT   gene            <398814..>401279
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1580"
FT                   /db_xref="GeneID:3372254"
FT                   /locus_tag="cgd7_1580"
FT   mRNA            <398814..>401279
FT                   /db_xref="GI:66362745"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1580"
FT                   /db_xref="GeneID:3372254"
FT                   /locus_tag="cgd7_1580"
FT                   /transcript_id="XM_628337.1"
FT                   /product="mbl domain containing protein"
FT   CDS_pept        398814..401279
FT                   /locus_tag="cgd7_1580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mbl domain containing protein"
FT                   /db_xref="GI:66362746"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1580"
FT                   /db_xref="GeneID:3372254"
FT                   /translation="MSEIHFQRIGSKHLLSPPSLVLTYNGNKCLINVGENVQRYCFEHK
FT                   IRLSRLRNILLTNISVETIGGLPGLLLTLIGVGVQKLRIVGPEPITRYLIMFGYIIRTQ
FT                   KKYENSINTVVSINSQEFLDNFDGIKSDLEIEIIELMPSSSSEPLKLELDHELFLECYL
FT                   NHSFSGSQTCLDFEHNQIPNSKKRCTENYLSCLSNLSILYMFEFPEKRGKFDVIKAKEL
FT                   GIPPGPLYSKLKNGESVQISESRIIQPSDVCSPPIKLPWSIIFHTLDPTEFDFFYFRIS
FT                   QILKLKGFDLTETAQNSSNCSSEQYESCSNFYIFEFQACFDSFLDFNNNFLKLDSCFIQ
FT                   NKCYLSKGTINVIRLNERLNLLKDQEINPFVTSQFLQEFLSHISPNLFPLPSAKVDEFT
FT                   WNQQFFISSNQKSLQNTNSIANIHKKKAKFAPISQESDDQILFLKQEFQDIFSNYIENN
FT                   EKTLFPLLYVLGTGSAIPSPYRNVSGYLLRLDDNTSMMLDCGEGSMSQLFILCKFDFDL
FT                   FSKIIASIKIIFISHPHEDHFLGIFNLLKLKNSINIQQKVENSSELVKNDNFYHIKYDE
FT                   NLQRVQEVYFNNEIKSKDFKNLLIIGPRKVEKLYNLFQEKIIQDKGNRIRNCEISFIAI
FT                   EKRINKSFDKISDQSKLVLDDFFLKLEQFPVKHIKSSYGVKVTFKLENSLKIRDGYSLF
FT                   KIVFSGDTATPCTSLEYASKDCDILIHEATFEDSLSKDAQEKNHSTISGAIGTAYNSLA
FT                   KFLLLTHFSQRYFSMPKVEMKNEDLKRYFLNNTLCMMDLMIIPLKMVGKLIERFHNLND
FT                   LIRDYLPQV"
FT                   /protein_id="XP_628339.1"
FT   gene            complement(<406926..>407561)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1590"
FT                   /db_xref="GeneID:3371784"
FT                   /locus_tag="cgd7_1590"
FT   mRNA            complement(<406926..>407561)
FT                   /db_xref="GI:126652721"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1590"
FT                   /db_xref="GeneID:3371784"
FT                   /locus_tag="cgd7_1590"
FT                   /transcript_id="XM_001388341.1"
FT                   /product="uracil-DNA glycosylase, putative"
FT   CDS_pept        complement(406926..407561)
FT                   /locus_tag="cgd7_1590"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uracil-DNA glycosylase, putative"
FT                   /db_xref="GI:126652722"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1590"
FT                   /db_xref="GeneID:3371784"
FT                   /translation="MSQTSILSYLNKRSAENICKDSIECGSDLNRDSAVKNRRICVKET
FT                   EIKSSKEAEEENQEYYPSESELREYFGDEWFEALKDELRKPYFVKCMKKVQERRNYAKV
FT                   YPPSDKMFSCFKATPLNKISVVILGQDPYHQPGQAMGLSFSVPKGVPVPPSLRNIYKEI
FT                   GKGNPGHGDLSSWAEQGVFLLNSLLSVEEGKPMSHXDLCKFDSNNYSV"
FT                   /protein_id="XP_001388378.1"
FT   gene            complement(<407841..>408509)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1600"
FT                   /db_xref="GeneID:3371731"
FT                   /locus_tag="cgd7_1600"
FT   mRNA            complement(<407841..>408509)
FT                   /db_xref="GI:66362747"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1600"
FT                   /db_xref="GeneID:3371731"
FT                   /locus_tag="cgd7_1600"
FT                   /transcript_id="XM_628338.1"
FT                   /product="ribosomal protein of the PO/L10 family"
FT   CDS_pept        complement(407841..408509)
FT                   /locus_tag="cgd7_1600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein of the PO/L10 family"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362748"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1600"
FT                   /db_xref="GeneID:3371731"
FT                   /translation="MAKSKRVKKVLMTKDLKKKRKDKSEIIENVHEYIGKFKFIYVVKL
FT                   KNQRNAALKQLRVRLEPGKLLVGKNKLLQVAFGADSDSESAKNAHKISSFLRGERGLIF
FT                   TDLAPSNLNKVLEESSTMEFGREGSLSDITCVVEPNTELECLYKNAEFYMRKQFPQLKP
FT                   TLLGSDQGKVIICEKGNPLNKYQYLLLKHLEIPSVKFEIKPIACLHNEELTHFENADME
FT                   "
FT                   /protein_id="XP_628340.1"
FT   gene            complement(<408797..>411805)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1610"
FT                   /db_xref="GeneID:3372256"
FT                   /locus_tag="cgd7_1610"
FT   mRNA            complement(<408797..>411805)
FT                   /db_xref="GI:66362749"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1610"
FT                   /db_xref="GeneID:3372256"
FT                   /locus_tag="cgd7_1610"
FT                   /transcript_id="XM_628339.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        complement(408797..411805)
FT                   /locus_tag="cgd7_1610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66362750"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1610"
FT                   /db_xref="GeneID:3372256"
FT                   /translation="MSNFSMDINSSLERAYRTVPILKPVVWSGIKELLDVSRDSLGSKQ
FT                   KEPGYFGVSKRASSGKGIVNDLGITTLERSIQYLSSRLESYDSKRRYLAEAFNFKRAPH
FT                   RGGCGQDKDNYSELGSGGLPKYLQTSYSNFLSYLIDESTTSIFQIYYSEVFDLFFTEWN
FT                   ERKSKILDGQKQDIVSGYCNDNSHLSTKSEFGLLLNPRKPHFETIQEQGVGGSRRTEDS
FT                   INEYYYVLSEIIPNVTVSDLASDKYVSIQKMCLSSFNSRIQLIQEMGSLLAPVEYKEEI
FT                   SLLWRLLTLLVGNSSKNNYTTRQMISNSIRALEVSAVDNVLYHNSNIFLGNRYGSGVGS
FT                   SVLISLKNFTNFCRKLFISESTDQRNINYNMNFPCEQVHYWFLAYWAFRIGSGQILWDM
FT                   ASKFSHIPQHFSLVCKCLAAILLSTSSSLLISQTYDDIVQGEENWIKQCVQFDFNRDLY
FT                   SSREYRELNSMFYSKPSQDADFREQAYYQVIFSIINVSSQSLNVMKLLPNTNMEDYIWY
FT                   QLHIILKTNDDNESAKELNTLYNRLRNQVDQFSYGGESSSRDLSIHSQEEVSPFLLTHT
FT                   SRRGDAHAGSTKLSLNRSQNSHLHERTISRQEDKNELNQNDRMVKEQTNLNMARLMCYT
FT                   LHFGEAMRWIYSCHHELKIIQLQWVLYLAVAGLIPLWKKIENDQFGVFSSFSDKIEPED
FT                   RVLSLYEVLEKSIKNFNIPFPFVAKLARLFPESMRTKILQDYVEFSLLHDIVEDDYTDS
FT                   ASFHTYIEQGKSFVKFDTYESMNTSEYSEICEEINSIIARLAKNRGHYITSILFFMEAN
FT                   LLEEVLDTILDCLRLPVCYSFTTLNTRQQLFFDKLQTIINKVFTDSSYLQQGLAVQTKL
FT                   DEVRYLNEIVHAFVLIQKGFYRSAKEYIESKNFIPKSESGINSSNVGFLPKIIEAYVVS
FT                   LFELCRNDNAGSSIPDDVHNAIFCNFHIINSLVNSLTSMYSIQSSSAEKIHKLLKEMLV
FT                   LVSPDQLAHSKHS"
FT                   /protein_id="XP_628341.1"
FT   gene            <412387..>412857
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1620"
FT                   /db_xref="GeneID:3371786"
FT                   /locus_tag="cgd7_1620"
FT   mRNA            <412387..>412857
FT                   /db_xref="GI:66362751"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1620"
FT                   /db_xref="GeneID:3371786"
FT                   /locus_tag="cgd7_1620"
FT                   /transcript_id="XM_628340.1"
FT                   /product="nop15p/nopp34; nucleolar protein with 1 RRM
FT                   domain"
FT   CDS_pept        <412387..412857
FT                   /locus_tag="cgd7_1620"
FT                   /gene_family="HOG000242795" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nop15p/nopp34; nucleolar protein with 1 RRM
FT                   domain"
FT                   /db_xref="GI:66362752"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1620"
FT                   /db_xref="GeneID:3371786"
FT                   /translation="VLYIFIYMSKAKRERAIVYVGHIPFGLFEPQLKEYFSQFGKILRI
FT                   KLSRSKKNGHSRGYAFIEFESMEVAQIAASTMNNYIIFKRSLKCHVLPKESIHPYIFIR
FT                   SKKKNSSESNNALTEDEKQAKIDKSVLSKKKKLLKINKILENNNINYKLPSV"
FT                   /protein_id="XP_628342.1"
FT   gene            <413086..>415227
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1630"
FT                   /db_xref="GeneID:3371787"
FT                   /locus_tag="cgd7_1630"
FT   mRNA            <413086..>415227
FT                   /db_xref="GI:66362753"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1630"
FT                   /db_xref="GeneID:3371787"
FT                   /locus_tag="cgd7_1630"
FT                   /transcript_id="XM_628341.1"
FT                   /product="Ncl1p/MJ0026/YebU-like.  SUN family RNA
FT                   methylase"
FT   CDS_pept        <413086..415227
FT                   /locus_tag="cgd7_1630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ncl1p/MJ0026/YebU-like.  SUN family RNA
FT                   methylase"
FT                   /db_xref="GI:66362754"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1630"
FT                   /db_xref="GeneID:3371787"
FT                   /translation="IYVGFQTVYTGVLAPTSGVKIDQGKVGLLVKMVKEESNKRKRDNS
FT                   RRSELENVSVEGELKNNDSFTPFEKSNPIFENYYRLQQICTENEFQDFIHSLSSQLPTT
FT                   LRVNISHPLHSLLEFLLNAETEKLYNNNAIFNLKRLSKNCKLYLITEYSRKMLKKESQL
FT                   AKLHSFIVSQDEFGTLSSQELVSMLPCICLDPKPGHFVLDLCSAPGSKSTQILDMILSS
FT                   RDDQLGIACKKGLLICNDVSSKRLDTLSSRLSRIPSPNVLITCIDASFFPTFKPSKTTI
FT                   TSPFQFDRILVDSICSGDGTLRKNPDIWTIWKPEKALSLHKKQVSLLSRAFKLLKNGGK
FT                   LVYSTCSLNPIENEAVISTLLRKFPDAKLISPTNLDEREFEISKGLRTWGVHFELKEQN
FT                   KLQLFDTLDEVPDTPFKEKLTESMFPDKEWYESDNFMRCFRVLPHRNDTGGFFFAVVQK
FT                   NGPDEIPQIEQRSESSSCKYETVETKDLEPILSFYGLDNQNIQGKLMKGIENFPSKIKN
FT                   HLNSINSIEKSSFVKRKSHDKTIYLIGEDVSKLIMNYNLELDLRSVGIRAFEYLKGKIS
FT                   GDGRCKWRINQNSSSYLVRLMKRRLIFVSISLLDLLDDENKFIGGKEILDLEKKGELLG
FT                   LKELCSGISQEKKLESGGILVVILPPSIINYGGNSKVNPNFKELDQGVPLSGILYEDSG
FT                   INFFVSKNEIKSIKELILI"
FT                   /protein_id="XP_628343.1"
FT   gene            complement(<415311..>416858)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1640"
FT                   /db_xref="GeneID:3371788"
FT                   /locus_tag="cgd7_1640"
FT   mRNA            complement(<415311..>416858)
FT                   /db_xref="GI:66362755"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1640"
FT                   /db_xref="GeneID:3371788"
FT                   /locus_tag="cgd7_1640"
FT                   /transcript_id="XM_628342.1"
FT                   /product="SRP54. signal recognition 54.  GTpase."
FT   CDS_pept        complement(415311..>416858)
FT                   /locus_tag="cgd7_1640"
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SRP54. signal recognition 54.  GTpase."
FT                   /db_xref="GI:66362756"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1640"
FT                   /db_xref="GeneID:3371788"
FT                   /translation="TPLYPKEESYFKVFLMVLADLGGQLASAIRKFQSSTIADEAAIDL
FT                   CLKEIATALLKADVNVKLVAQLRNNIKKAVEQEDSVGGSNRRRQIQSAVVEELVNILTP
FT                   SRTPYVPQRDKSNVIVFVGLQGSGKTTTCTKFANYYQRRGWKTALVCADTFRAGAFDQL
FT                   KQNATKVKIPFYGSYTETDPVKIARDGVREFRKEGYDLIIVDTSGRHKQESSLFVEMEQ
FT                   VVMETNPDDVVFVMDSHIGQACYDQAMAFCNAVDVGSVIITKLDGHAKGGGALSAVAAT
FT                   GAPIIFIGTGEHFDEFEPFETKGFVSRLLGLGDISGLMAKINEVVPLDRQPDMVNRLVQ
FT                   GIFTLRDMYEQFQNMLNMGSPSALLSMIPGMGPNILAKEDEQAGIERLKKFMVIMDSMT
FT                   ESELDNEKTINASRVERISRGSGTSNQDVQELLSQHKMFSKMVGQIGKLGLGKKGGLDM
FT                   SSIMKNPTQLIQKMQKAIDPRIFKHMGGAQNMMNMMREMDKFQGSPDFQKMFGGMGF"
FT                   /protein_id="XP_628344.1"
FT   gene            complement(<417424..>418458)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1650"
FT                   /db_xref="GeneID:3371732"
FT                   /locus_tag="cgd7_1650"
FT   mRNA            complement(<417424..>418458)
FT                   /db_xref="GI:66362757"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1650"
FT                   /db_xref="GeneID:3371732"
FT                   /locus_tag="cgd7_1650"
FT                   /transcript_id="XM_628343.1"
FT                   /product="protein with signal peptide and 6 transmembrane
FT                   domains"
FT   CDS_pept        complement(417424..418458)
FT                   /locus_tag="cgd7_1650"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with signal peptide and 6 transmembrane
FT                   domains"
FT                   /note="no close homologs"
FT                   /db_xref="GI:66362758"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1650"
FT                   /db_xref="GeneID:3371732"
FT                   /translation="MLAILKGASCKKVIFSCFLLVIFLANISQILAEDQGTTSTQNSSQ
FT                   NESSNKKNFLFLSLNKYVWVHDACSWFHALMCITCYGVITFKVYSDRSALGISMQTLCA
FT                   LCFSEFCGALLNVWFSLYTGITLDWSFQIDIISTFLSVLCLYTVWKKFSNSIEDQYDTF
FT                   GLNILVRILSIMGSKSVDKDAMRNGERAGKIKPTGITGLISGSLYWLVLYILAIPLSFI
FT                   FLMFRTRRRLGLITSLLAYDDAVRALALVPQLYMFHIKSPRKVSEHLALFVVFEFILKV
FT                   LALFYWISMPLFRMPHESRNYNIAVQIFNIGILLDFAYHYFRAKFNGEKTIQYASDLII
FT                   PFSL"
FT                   /protein_id="XP_628345.1"
FT   gene            <420621..>421355
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1660"
FT                   /db_xref="GeneID:3371789"
FT                   /locus_tag="cgd7_1660"
FT   mRNA            <420621..>421355
FT                   /db_xref="GI:66362759"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1660"
FT                   /db_xref="GeneID:3371789"
FT                   /locus_tag="cgd7_1660"
FT                   /transcript_id="XM_628344.1"
FT                   /product="STOP repeat protein involved in microtubule
FT                   stabilization (possible variant metal binding site at
FT                   N-terminus)"
FT   CDS_pept        <420621..421355
FT                   /locus_tag="cgd7_1660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="STOP repeat protein involved in microtubule
FT                   stabilization (possible variant metal binding site at
FT                   N-terminus)"
FT                   /db_xref="GI:66362760"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1660"
FT                   /db_xref="GeneID:3371789"
FT                   /translation="KINFNYLINFYLQKSEHLLSRGRKVGRCPDEHCRSKSPSGQPGKS
FT                   VEELCTCGKHICPAPLHDSISFQAESSYNTEFKQWELPTFPKPVPEELPKSIPFDSDSS
FT                   YHMDYRKWDLPKKIVRPPEQFSESPENRDFMTSYQSNFKQWELPKFKKPQPPPEVVSSP
FT                   YGNINSVYRENYQQWDLPKKIVNPSEIYSPSKEDRNFETVYRNSYQGVQPPVCPVSLLP
FT                   PIPHPPPGRHTMFWDSVSKNWY"
FT                   /protein_id="XP_628346.1"
FT   gene            <422500..>425898
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1670"
FT                   /db_xref="GeneID:3371790"
FT                   /locus_tag="cgd7_1670"
FT   mRNA            <422500..>425898
FT                   /db_xref="GI:66362761"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1670"
FT                   /db_xref="GeneID:3371790"
FT                   /locus_tag="cgd7_1670"
FT                   /transcript_id="XM_628345.1"
FT                   /product="nuclear pore protein RBP16/17 (RAN binding
FT                   protein 16/17)"
FT   CDS_pept        <422500..425898
FT                   /locus_tag="cgd7_1670"
FT                   /gene_family="HOG000282847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nuclear pore protein RBP16/17 (RAN binding
FT                   protein 16/17)"
FT                   /db_xref="GI:66362762"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1670"
FT                   /db_xref="GeneID:3371790"
FT                   /translation="NCRGDVNQQKQAHEVLLPLTCNLGCLTQLQALLAQSSNPHALMFA
FT                   ATGLSKLFTSCWAQIPDNQKEETKTFLLNYLYKCGPDMLRSAPYLVGHYVRLLAQLVKF
FT                   GLLDSLSPRPTITDQVGQFLSASTSHWIIGLIIFTTLTQEMQTSTGLYFAKYRRAAILF
FT                   RDTSLPVIFQIAIKTLRQFHLGSVSVSTQHEEYRLLRQVLQLTLCCLSYDFMGTVPDET
FT                   SEEQNTVMIPHSWTILREEYIPIIFFDIYAKCCSPNSSMPDCASICLQCLILYSSVRRS
FT                   FFPTQADRTRSLAALMTGTAGIIQTKMGLEHESCYHELCRLLGKLNTANQLTELSSSEA
FT                   FGLWIDQVYNFTIKSLEEWSVLPNSKHYLLGLWSHMVIPLLYQGDRAPQNLEKYIHHIT
FT                   VTFIQSRMKLAEAIARGSDVEDPLESEVARTEQLDVLSQLSRCQYHETAEFIVQLFEQV
FT                   TDAAKNGSISQDCFISQITWCVYMHGALIGGHSIKLRRPLLPSGSSSSSGTSRPDQKNQ
FT                   VSHHVLNGKLARLVFGLSQQTDQLPETPESLELAYLYFLEQFRKVCLGDYAKQFIQPET
FT                   EDATLASILGVQSDDDVLSLIISKIGRNLQAKSNMESVVQKTLSLFHELVAGISIVQYT
FT                   DRTTHLIVSGRLLLKNEQVKKILCNHASPEFAFLNNPRYGRHRTSYYFTLSKLLFLESK
FT                   EEEPGTQPITTFEDFMKPLEKVFTLIWDEIILGNNSSNGGGYNIGQFRVPLMALARDLR
FT                   GICMACVGPESYNQLFNWLVNRPKQLGQSRIHLFTWAADKLWEDSDVMNALLKFMAEFV
FT                   DNKSQRINFDKASPNGILLFKEVSSLICTYGSRILSKPDSSFQNIYKEKYKGLATTLAM
FT                   LCHALSGGYTNFGVFEVYQDQSLENALQLACRMCLVIPEHDLQSYIKSLKSYYEFLELA
FT                   TRCFMSTFITSLEPQNLATICYSIESGLCAVDNVVLLACCATLDHFVSFIFTTLEKEKI
FT                   VLPNGMGVSRNNDNMNYELGGGSPSLVQQGSTPEGKAVYRFMTEQPNALIRIMQLMFNL
FT                   ITTGDLSTWTFSRSLLGMILLFNNEFQNIQQQLINQQVDEKKAKYQSLIQDLLKGTDGT
FT                   LSAVSKDAFTRNLHFFAHSIRSNSL"
FT                   /protein_id="XP_628347.1"
FT   gene            <426170..>427124
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1680"
FT                   /db_xref="GeneID:3371785"
FT                   /locus_tag="cgd7_1680"
FT   mRNA            join(<426170..426367,426675..>427124)
FT                   /db_xref="GI:126652802"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1680"
FT                   /db_xref="GeneID:3371785"
FT                   /locus_tag="cgd7_1680"
FT                   /transcript_id="XM_001388342.1"
FT                   /product="Rab7 GTPase, putative"
FT   CDS_pept        join(426170..426367,426675..427124)
FT                   /locus_tag="cgd7_1680"
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rab7 GTPase, putative"
FT                   /db_xref="GI:126652803"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1680"
FT                   /db_xref="GeneID:3371785"
FT                   /translation="MSMVQSKSNRKRVLLKVIILGDSGVGKTSLMNQYVNSKFSTQYKA
FT                   TIGADFLTKDIVIDNKLVTLQIWDTAGQERFQSLGVAFYRGADCCALVYDMTNPKSFEG
FT                   LDAWREEFLIQATPKDPNSFPFVVLGNKLDLDQKSRKVSSQKASAWCKSKNIEYFETSA
FT                   KNATNVDAAFEEIGRRALYRETSEDQVYIPEPLTLNNNNQQHHEIGFGGCSC"
FT                   /protein_id="XP_001388379.1"
FT   gene            complement(<427236..>428264)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1690"
FT                   /db_xref="GeneID:3371733"
FT                   /locus_tag="cgd7_1690"
FT   mRNA            complement(<427236..>428264)
FT                   /db_xref="GI:66362763"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1690"
FT                   /db_xref="GeneID:3371733"
FT                   /locus_tag="cgd7_1690"
FT                   /transcript_id="XM_628346.1"
FT                   /product="meiotic recombination protein DMC1-like protein"
FT   CDS_pept        complement(427236..428264)
FT                   /locus_tag="cgd7_1690"
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="meiotic recombination protein DMC1-like protein"
FT                   /db_xref="GI:66362764"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1690"
FT                   /db_xref="GeneID:3371733"
FT                   /translation="MSAFCQSKSVAKQVSAKGVEEEAFVEIDKLQSAGINVADINKLKT
FT                   AGLCTVLSIIQATKKELCNIKGLSEAKVEKIVEAAQKLDQSSSFQSGSEVMSRRQNILR
FT                   ITTGSEQFDKMLMGGFESMCITEIFGENRCGKTQICHTLCVAAQLPLEMNGGNGKVCFI
FT                   DTEGTFRPERIVKIAERFGVQGDVALDNIMYARAYTHEHLNQLISAAAGKMIEEKFALL
FT                   IVDSIIALFRTEFSGRGELAERQQILNKTLSKLNKLADQFNIAIVMTNHVMADPAGGMS
FT                   FMPNVAKPVGGHVIGHASHVRLSLRKGKGEQRVCKVYGSPHLPESECVIQLSDGGIIDP
FT                   ID"
FT                   /protein_id="XP_628348.1"
FT   gene            complement(<430055..>430450)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1700"
FT                   /db_xref="GeneID:3371734"
FT                   /locus_tag="cgd7_1700"
FT   mRNA            complement(<430055..>430450)
FT                   /db_xref="GI:66362765"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1700"
FT                   /db_xref="GeneID:3371734"
FT                   /locus_tag="cgd7_1700"
FT                   /transcript_id="XM_628347.1"
FT                   /product="histone H2B"
FT   CDS_pept        complement(430055..430450)
FT                   /locus_tag="cgd7_1700"
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2B"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362766"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1700"
FT                   /db_xref="GeneID:3371734"
FT                   /translation="MSGKSGKSIKGPAQKQQAAKKTAGKSPADGGKRKRRKRTESFALY
FT                   IYKVLKQVHPETGISKKSMSIMNSFINDVFDRLSAEAVKLVQYNKKRTLSSREVQTSVR
FT                   LMLPGELSKHAVSEGTKAVTKYTSASA"
FT                   /protein_id="XP_628349.1"
FT   gene            <431391..>433682
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1710"
FT                   /db_xref="GeneID:3371735"
FT                   /locus_tag="cgd7_1710"
FT   mRNA            <431391..>433682
FT                   /db_xref="GI:66362767"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1710"
FT                   /db_xref="GeneID:3371735"
FT                   /locus_tag="cgd7_1710"
FT                   /transcript_id="XM_628348.1"
FT                   /product="threonyl-tRNA synthetase (RNA binding domain
FT                   TGS+HxxxH+tRNA synthetase)"
FT   CDS_pept        431391..433682
FT                   /locus_tag="cgd7_1710"
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="threonyl-tRNA synthetase (RNA binding domain
FT                   TGS+HxxxH+tRNA synthetase)"
FT                   /db_xref="GI:66362768"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1710"
FT                   /db_xref="GeneID:3371735"
FT                   /translation="MDPKRIQKGTEKTLSSVGKIGGEFKVEKKPEFINRRLSLFKTLYE
FT                   KQCALLQEKASKNEPIKITLQNGDQRDGVKFQTSPMEIARQISKKLAESCIVAKIRYNK
FT                   SLFIEDDEVRGIEEDEEETCCQGHENQSDGWRLWDATRPLEGDCELEILTFDSLEGSGV
FT                   FWHSSSHILGQCLENEYGAQVTIGPALNPGFYYDSYMGTHSVSNTEYSDIENCAKTIIS
FT                   EKQQFERLQCNKEEALELFKDNPFKVSLIMSKIPDGAQTTIYRCGSFVDLCTGPHIPHT
FT                   GIVKAFKVTKNSGCNWLGNTENDALQRVYGVSFPDKKRLDEYLNMLEEAKKRDHRLLGS
FT                   NLQLFFFDSNVSPGSCFWLPAGARLYNKLMDFIRNEYRIREFTEVITPNIFSCDLWKTS
FT                   GHYFAYKENMFIFDVEEKEWGLKPMNCPGHCVMFKHMNPSYRQLPIRLADFGVLHRNEF
FT                   SGALNGLTRVRRFQQDDAHIFCTPEQIQEEVFKALDFLFFIYGQLGFTFDLFLSTMPKE
FT                   HLGTEEQWKEAENALKSALDKTGRDWKLNPGDGAFYGPKIDIMLWDALKRQHQCGTIQL
FT                   DFQLPIRFNLQYRTDENISEESTNQEQPPSHQNADQNPDNSLKQGYRRPVIIHRAILGS
FT                   VERMSAVILEHTGGKLPFWLSPRQAIVLSISEKTVEYAKSVERELCRRGFDVSGDYSAA
FT                   TINKKIRESQLLQWNYMLVIGENEARDKKVTLRCRDTTIPQELLTLDQLILKFSSMGFP
FT                   SSIDSNSSNQ"
FT                   /protein_id="XP_628350.1"
FT   gene            complement(<434856..>435630)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1720"
FT                   /db_xref="GeneID:3371822"
FT                   /locus_tag="cgd7_1720"
FT   mRNA            complement(join(<434856..434924,434978..435050,
FT                   435129..435253,435331..>435630))
FT                   /db_xref="GI:126652804"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1720"
FT                   /db_xref="GeneID:3371822"
FT                   /locus_tag="cgd7_1720"
FT                   /transcript_id="XM_001388343.1"
FT                   /product="endonuclease III, putative"
FT   CDS_pept        complement(join(<434856..434924,434978..435050,
FT                   435129..435253,435331..>435630))
FT                   /locus_tag="cgd7_1720"
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endonuclease III, putative"
FT                   /db_xref="GI:126652805"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1720"
FT                   /db_xref="GeneID:3371822"
FT                   /translation="RFHVLVAAFLSSQTKDEVTAACMNRLIDNGLSPEFINNQSVDSLR
FT                   DMLYGVGFYNTKAKNLKEISRIIIQNYSGKVPEKYEQLVMLPGIGPKMANLILQIGFGI
FT                   VVGISVDTHMHRIFNRIGWVKTKNPIETSKEMEKMLPRIYWNDINKVFVGYGQTICKPI
FT                   NPKCQECNIRDYCSHGMKWKKKASTK"
FT                   /protein_id="XP_001388380.1"
FT   gene            complement(<436358..>441028)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1730"
FT                   /db_xref="GeneID:3371736"
FT                   /locus_tag="cgd7_1730"
FT   mRNA            complement(<436358..>441028)
FT                   /db_xref="GI:66362769"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1730"
FT                   /db_xref="GeneID:3371736"
FT                   /locus_tag="cgd7_1730"
FT                   /transcript_id="XM_628349.1"
FT                   /product="CpCCp1/Cpa135"
FT   CDS_pept        complement(436358..441028)
FT                   /locus_tag="cgd7_1730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CpCCp1/Cpa135"
FT                   /note="secreted protein with the following architecture:
FT                   signal peptide sequence Ric, disc, NEC, LCCL
FT                   domain,levanase, apicA"
FT                   /db_xref="GI:66362770"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1730"
FT                   /db_xref="GeneID:3371736"
FT                   /translation="MRWKTFSFLLAFLSISLIVTAKDGESNYYFFKKAISSSTLVGSSF
FT                   NGEFDPSNALNMGNSEWRSASNLSAEQQIVYTAFISATAKAIGLKIVWSSSPRETQIQV
FT                   SPDGINYEIVVPNRRATQNEKEFTEDFMFDHSRDVRAVKIQMKAKPSQYIGIRQLVALG
FT                   SGSPLAMIISGITDEKGDNCLQVIGGRVQDDFAQVDLDSCVYGISAGDGRELWKMGPNG
FT                   QIISAASNPPKCLIVANGDFSGSSPLLIQDCEIAEQAEDGRSFWEFNENSQLQVKGTNA
FT                   CVNQINKAGFGVGTTKLELSGTASSTMDALHTVDAAIDSDIATYWASAAFESTGEHKVS
FT                   INLSANMTYQLKNLRIDWEFPPFTYSIAAKVDGEMKQITKVEGNPSNTTLNEMNGVISD
FT                   FIQIVMEKPHPRYGKYSNKYLYGIREIELMTNNLRSVVSFCRDAALSKDARDKYFLNYV
FT                   EDFNSKASEMVKSAARDVLSRTKNLGVLNDRVNTLLPSIDECFTDKKEYVSRLEDYISN
FT                   AKQLKEGLGAVKDEISVGVGNEPGDEPNLPAEDCFSIASRNPNAISGFYWILPRCAPEP
FT                   IRVWCDIKFGASYYIWNDGGNPGSYISVTSVSDIRKYCAHVGMEPLVLRNIEQISGIKS
FT                   ALGIMGFKLSEGSGIPLAVDYGCLDGKCTGSYQDLRDGTTDLTSLVLSLASPESTATTL
FT                   FGNDAVGLGFSENYLSFFNLKNSNIVGIVCSTNVVPTQKQINHVDIDCDTVAYKNPIFE
FT                   GPINTNIIVQCPPGCAEYKTKVYGSDGVYSEKSSICKAALQVGVISTNTGGMFNVALEG
FT                   PKNSYEGSTKNEIESEKLSGIPTRSLRISTISKECPIDVISKGGNDLHQLSTATTLNQQ
FT                   AKQGQKLQNPVKVSTPVIKTDLWEGKTNEPFISKILKEASQYIDESYGVDPSLSFATQE
FT                   ESKMAILEMRRKLKPAEMLTKSQSPKIMDVVDNVDHIANELLKVTGVYKSITKELLDKL
FT                   DDVEAIHSSQTGFQSFTLDTQKMPFEQTFSVYDMPRTQRGPSDWGYTTTAINGRTKLLG
FT                   QNSPITGSSEHSPRGTFAQIKNRRFFDFTLTTEVYPPVSGIFGIAFRVRDLSNYYLLEF
FT                   NQEEERIRLLRLKEGITYILDTKEDFKFKEGEFQKVEITVQRDRIYAKIGHVKLQVVDE
FT                   GLLSGTVAFYSNGVVGGVYFDNVSIKAKSCKKFFMSPAPRSPRCSNYKQCYLSTFETTY
FT                   DIVKNNDVNGNWEYIKEYKGRTNAMVVKTSGESRILLKETHTCKNGYFSFDFNPPCSNG
FT                   KVSGIFRYTDNDNYYQVIVSNTSTTLVKKTKAKTTLLKKVMFGFTQNEWNRILVNFEGT
FT                   TIYVYSTKYNGNTKEIIKVTEKDTQVSHGRVGLSVKNCSETAFDKVSLEPFRVDSNKDV
FT                   ENSTDKEKTDSIYKSCTLNTHILQREQHCETMFGSNSQKSVTCTNNYCTECCDYYTNMI
FT                   TDRTYYNSCKSACSINDSYAENSTKEYINQLATCISGTSKAFDICTETDQKCKIEVCDL
FT                   CCNSAFDGVQKDIQGIVVKACQAQCSHRFDTDKVLA"
FT                   /protein_id="XP_628351.1"
FT   gene            complement(<441433..>442788)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1740"
FT                   /db_xref="GeneID:3371737"
FT                   /locus_tag="cgd7_1740"
FT   mRNA            complement(<441433..>442788)
FT                   /db_xref="GI:66362771"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1740"
FT                   /db_xref="GeneID:3371737"
FT                   /locus_tag="cgd7_1740"
FT                   /transcript_id="XM_628350.1"
FT                   /product="Ing1 like PHD finger protein"
FT   CDS_pept        complement(441433..442788)
FT                   /locus_tag="cgd7_1740"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ing1 like PHD finger protein"
FT                   /db_xref="GI:66362772"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1740"
FT                   /db_xref="GeneID:3371737"
FT                   /translation="MSDSSISSDESDWDHSWGCPGDFSDLPGLNQDHSYPYMFSSSWYS
FT                   PEDQEKKEPVYQTEFYSNNITTGFPNSVKTVPGNVVESEKEDVTPDYLDNSEFNNQGVN
FT                   FFDSQIPNCRSQRLQYNTKLCIEYIEDDISRIMWNLEQQFQECVLTKDSKRQRNHGFSI
FT                   EEVSEIDSVEQKKYKLRSYISILRYITMMIENCASIEMQWAKDELEMTNLLRNNISEAF
FT                   MKLQKVNLSNESSNHDTVKSNDLQKNSNSLKVRKSKRIQAKVLEEEVCTVQAGSPKIEV
FT                   NDFHSISDETSKFCFCKQPVLDNMIRCESGNQCIYGVWFHFLCLKIINEPQKTWYCPGC
FT                   TRDEEYRALWSHIFQREALKKSIEANISKNQDETKANATPILTNSKNEKKKNSCKKERK
FT                   RSKSVDGYPKKKQSRGSFFDRNNEISNYTESLNNSYDEIKREAEYKEIPQNT"
FT                   /protein_id="XP_628352.1"
FT   gene            complement(<442872..>444089)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1750"
FT                   /db_xref="GeneID:3371823"
FT                   /locus_tag="cgd7_1750"
FT   mRNA            complement(<442872..>444089)
FT                   /db_xref="GI:126652806"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1750"
FT                   /db_xref="GeneID:3371823"
FT                   /locus_tag="cgd7_1750"
FT                   /transcript_id="XM_001388344.1"
FT                   /product="step II splicing factor SLU7, putative"
FT   CDS_pept        complement(442872..444089)
FT                   /locus_tag="cgd7_1750"
FT                   /gene_family="HOG000194391" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="step II splicing factor SLU7, putative"
FT                   /db_xref="GI:126652807"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1750"
FT                   /db_xref="GeneID:3371823"
FT                   /translation="MNLDERDDSATEEIGRDDVRGANTTSDDALNPHIPQFIAKAPWYI
FT                   NQQESSLEHQRLRADEARIDLDSGIKKGVLGEAHVKYRKGACTNCGSMTHQARDCLERP
FT                   RKVGAKWNNLDICPDEIIPEIRKTTNLDEKRDRWRGFRPEDYKPIIEQFEAVEELARQK
FT                   RAKKVEESLSNNKNNPEDKNEELDEKDELKLGDFDETTFGASSDKTRTNVRNLRIREDT
FT                   AKYLRNLDLNSAFYDPKSRSMREDPFHKSSNIGNTYRGDNAIRNSGEVSKILLMEAFAY
FT                   NKHKQGESIHLQALPTRSEMLYKSSISNKDNDNLKKLEEISRKYERNNQPSISKLELTE
FT                   RPTTVGDLSSMNTKTTKKFVSSIYVEDEYISNHTQVWGSYYDLEAKKWGFRCCKQTCRF
FT                   SKCTNI"
FT                   /protein_id="XP_001388381.1"
FT   gene            complement(<444239..>448075)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1760"
FT                   /db_xref="GeneID:3371791"
FT                   /locus_tag="cgd7_1760"
FT   mRNA            complement(<444239..>448075)
FT                   /db_xref="GI:66362773"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1760"
FT                   /db_xref="GeneID:3371791"
FT                   /locus_tag="cgd7_1760"
FT                   /transcript_id="XM_628351.1"
FT                   /product="P-type ATpase (calcium/phospholipid-transporter),
FT                   9 transmembrane domains"
FT   CDS_pept        complement(444239..>448075)
FT                   /locus_tag="cgd7_1760"
FT                   /gene_family="HOG000281038" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="P-type ATpase (calcium/phospholipid-transporter),
FT                   9 transmembrane domains"
FT                   /db_xref="GI:66362774"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1760"
FT                   /db_xref="GeneID:3371791"
FT                   /translation="LYDITSSRPRLVVINNRQVRNFSGNFIRTSRYTVLNFIPKYLFEQ
FT                   FCRPVNFYFLVISLLQIFPSISSTNGIPTLALPLVFVLFVGAVKDGWEDLNRHQNDRIE
FT                   NEREVIVIKRFPFINYIHGRTLACDLEEAEKPKNKNPSLKHVISFKSENDKQSNTSHSW
FT                   FLGIEGSERSSSSELKVGDIVLLRNHETIPADIVLLSTSSENGDVFIDTSSLDGESNLK
FT                   RRFSHKESTKMLGNNIHDVIKRARYLEGLIECSPPGKDLHNFDGTAIIRLPPISEGLVT
FT                   QGNTITQFPINLDNIVLRGCILRSTEWAIGCIVYAGHESKIQMNSLKPTKKMSNVDKFT
FT                   NKMVLVVLVILFCLCMTGSLLTYKYIFDGVFDHLDYLGVSDVNEISYRATGQAIPISFV
FT                   PVVRFCTWIVLLANIIPIALVVSMKIVKAIQGQFISRDRAMYDAVNNTYAVARNSDLNE
FT                   DLGQVRYIFSDKTGTLTRNIMEFKSLSVGGVHYGSTETSSSKEDNLIREIEIPQVNIKD
FT                   ENILLDIKSRNSQSIKIGNLLIGIAVNNSIVIENQSEMFSMLYNSGRIEPDILPETFSP
FT                   STYLTGLNSDITLNPDNKPKSRLGSNFMTSIKSISSQSSKSASNNSSNTKQKPKSNFPL
FT                   YSAQFPDEAALCYGAQYLGVSLICLNPKTKHLILDVFGELLDVEILAKIPFTSDRKRSS
FT                   TVVRIKRLNSEHNMKDLRIMSELYRERIMVFSKGADSAMIPLLRQSNMEKFQKDLEIGN
FT                   KMANQALRVLCITEKEISEDEFADWNQKYQLAVNNVENRESSLQEAASMIEKDLLLQGV
FT                   TGVEDRLQDEVPETIKCLRDAGIKIWMLTGDKVETAREIAASAGLLSPGHEILELTEST
FT                   CSNKSEIKKRVLSICKSLGIDLESDKSERFLRKVKASGSKSEKKETNFSILIDGAVLGE
FT                   IFSGSLANNDFVSECKRFEDITSSISSIEKLFVQMCCKCRTVVFARFAPSQKGNIVRIV
FT                   RKHMDEITLAVGDGANDCNMIQTANVGVGIRGLEGNQAFLTADYGITSFKDLKVLLLVH
FT                   GRLAYRRICKLALYMFYKNLTVGIPVFIYGFFTLWSGTRLYFDYWYQVYNVILSSVPIV
FT                   VVSVFDFDVTKSESLSKPHLYSFGPENKFLNTKICLIYLLNSAWHIFVVFTIPYILFRV
FT                   NSTNLFGSNQSIVGAAIYYLVILVVNIKVLLMADHIHYLLGFAVAFSLFSWICTLFVCA
FT                   ASFSIGSDVYTIWIPLYNNVLLWITLISGLSISLWPDYFFKVLFSEWLKVDDK"
FT                   /protein_id="XP_628353.1"
FT   gene            <448289..>448609
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1770"
FT                   /db_xref="GeneID:3371738"
FT                   /locus_tag="cgd7_1770"
FT   mRNA            <448289..>448609
FT                   /db_xref="GI:66362775"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1770"
FT                   /db_xref="GeneID:3371738"
FT                   /locus_tag="cgd7_1770"
FT                   /transcript_id="XM_628352.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        448289..448609
FT                   /locus_tag="cgd7_1770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362776"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1770"
FT                   /db_xref="GeneID:3371738"
FT                   /translation="MCEKKGLSLPPKNDELRREENESLKGESLTLRLNFKDLDGIVEEL
FT                   SVNSSTEVGFVKLLIAKSKNVQAKDIRIFHNGKNMINPMSLCDHPGVSPPSVDVDVYLN
FT                   SV"
FT                   /protein_id="XP_628354.1"
FT   gene            complement(<448689..>452600)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1780"
FT                   /db_xref="GeneID:3371740"
FT                   /locus_tag="cgd7_1780"
FT   mRNA            complement(<448689..>452600)
FT                   /db_xref="GI:66362777"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1780"
FT                   /db_xref="GeneID:3371740"
FT                   /locus_tag="cgd7_1780"
FT                   /transcript_id="XM_628353.1"
FT                   /product="tRNA exportin type nuclear export protein"
FT   CDS_pept        complement(448689..452600)
FT                   /locus_tag="cgd7_1780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA exportin type nuclear export protein"
FT                   /db_xref="GI:66362778"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1780"
FT                   /db_xref="GeneID:3371740"
FT                   /translation="MWIILAKILVVIDRIMDDLEKAIKTLNSPGSTPSEKLRSLEVCEL
FT                   VVGSSEGWKICLKHFTTGTDDDVRFWSVGSLIKMIGTFPGEENKTVSCKLMIDSKKVIR
FT                   EALSDYLRDPVRMGNTQSYLKNKISELYVTMIYADYPENWPSAFLDIVSLVTAHDWMPD
FT                   MFIRILCTFDKMIVSNIGLQSAEDISIRRKIKDIMRVNGDLNHIVQAWIFVVSKHKSQS
FT                   LTKDRIQLLSSSMKMMESFIDWIDISYAVNNEVLSIILSFLNPIDSPVVVETLNFLSAI
FT                   LLKGMPPKVKIQLFKDLNISYLVENQITLNIKDITPEYFQSQILGKWPILENPETIISI
FT                   EQGPFGDIFKDFCLFLLSFRANFVLKIINELFLAIKNLFLEQESKNAEESDLAAFKTGM
FT                   EILETLLPSLNIILSIESSEFKQIKQETCKFLTHFSLVLSSNDSYLSRLSQDLNNNTSF
FT                   FSNFVSGVLFALLNALKKPDSHYFYQTGGESDTDFPGVMNRGKNSPDFGALFLSLLDLK
FT                   PEIVCEFMEMIIKNLTSDIQSVSFNQVDSVSFLIAKFGQASLAEKRKLLKSRNASLSDS
FT                   NLLISSHYIRFVGSILECSEIMYFNCKCYKPTESGIHREIFLRNSILQIFRNFTDLIGS
FT                   NSGGTLNIQTDETRKILNKILDVLLSNCGFLNPHYSISYQSSKSVVGITKSFSNCLFDY
FT                   IPKLVLLLRSHETLSLILKLAEKGTIENECLESFKSGLGSKSLNTICEAIGFLLFNKLK
FT                   SRSNITEQQEVVLQYEEIVKPMLELSHKLIEQISQNSGGNDIKNDLLKWRSAMELVQMI
FT                   SSISDALTEQIPALSHLWRASLNILLLLARCSNSVLISESGGLQISVLSPMHRFIRIMG
FT                   PEICNYIVPICSSFLASLIDSENRMQKAFQGSRYSEACEEISHLICHLVTLHGNSEDFT
FT                   NIFETLIPEIFLYILKLWLLCWPSPISLCSIDERFRQTVLEDIAFSVEAHQARMSIQLS
FT                   LVKIINQLSKGKTSLELLAKLCSTQGEKMSEAKQILNQVILNPVGVTSNFGIKSYVNLV
FT                   PSAFLFREALANIQNPILCFLISSLLPSLSTPIHWLEYNGDRHLFTEQDIYIQSVEVIT
FT                   SIYLKILTCSDLNSSNMSQELKKMGIEVATSFLWFSILNNSQKEESLLNSQLTFLKLLI
FT                   KGEAPLVLVEKNSNKQNKRTTQIGQKYQHGQDTSSIIVPLNVVVATRDLVLSGTKAAFT
FT                   QNNPNAVNNPDSVSFARRSISLFFGYHYFVLLSFMPGSGLLDETFKLLNEISQTNDLQF
FT                   KQILRKFIENYQSYVRQVL"
FT                   /protein_id="XP_628355.1"
FT   gene            <452892..>455636
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1790"
FT                   /db_xref="GeneID:3371739"
FT                   /locus_tag="cgd7_1790"
FT   mRNA            <452892..>455636
FT                   /db_xref="GI:66362779"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1790"
FT                   /db_xref="GeneID:3371739"
FT                   /locus_tag="cgd7_1790"
FT                   /transcript_id="XM_628354.1"
FT                   /product="protein with BRIGHT domain like HTH domain at
FT                   N-terminus"
FT   CDS_pept        452892..455636
FT                   /locus_tag="cgd7_1790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with BRIGHT domain like HTH domain at
FT                   N-terminus"
FT                   /db_xref="GI:66362780"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1790"
FT                   /db_xref="GeneID:3371739"
FT                   /translation="MDRTTFMDGLRAFHESQGRAFRPQKVSGHTLDPYRMFLMIVARGG
FT                   YSRVNKNSRWFVFGKPMGIDIPEGKQQEVGFGIKNYYLNWLREYEKALDDSIKLAMAAE
FT                   FAANNPDLVPNPNLALSYYTQTSTSNTNEEAPLTRSAAASLSRTRGGRSNEEMENSRME
FT                   KNQVVSDPSKVIDSADAFYLVPCESHCLHNKPITPKNLTIYDIEEPYSPKYPITDDLWY
FT                   LMAHFRNPDSKMEDKIQIINNLMAIAANKRLNLSSFPSILNEFSEIMTVCTFSIDSQIL
FT                   KKEKLQRENPLDINKLKLMIEKRVCLLDIALIQKHLLASSSNLISLILNNKENLEFIYE
FT                   VSSCSNIGKNFLRISNYLGNQPENDQETLNQNGNLPKMNDYSNQSVSESLSHSNTLKTC
FT                   YLRIPEAVKVLEQINNFYTENSIQNKELNIVRLKALLTALLTVFRTSSGIIFSYERKFH
FT                   NEVLPLVLVSSNYRQKANPHSEKVIIKFNTSSQIQYESDNKENSYNYDDFSLTKEIDPD
FT                   SMNEISFKDELRKKTKTMKHNDPDLLDQVLEYLNSETRYSWAILSSTINSLNHLIPVIF
FT                   EEKFDEVLSLVNSFIMEIFKSCRTCSQFSIPSLTNCMREVRKNSCLLPCLIYNKEGIQL
FT                   ISDILEFGCNVILNITSGQAQSKVKCNQKLLNSFFQIILKLSSTCIGFYSFLKDEENFK
FT                   SGIFSSNIKSIKYLFEELVLPISLATLVTISEHVSFGRIFQSFSNLNYHYLHHHTQFTQ
FT                   SLIENQSSNQAINQEILNISDSNDSFVKDQILILWGREIIGPVFELLKSELDEFAKNKL
FT                   EKIPVSCLMLSQYIIYISSELMSWKNSQKDPNLQKLHCKSSREIAIGILSPFIDILIEL
FT                   AWIPSTFRNLFWSIISEISNFGVSNPSVTLGISKFTIENHSTD"
FT                   /protein_id="XP_628356.1"
FT   gene            complement(<457154..>461290)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1800"
FT                   /db_xref="GeneID:3371741"
FT                   /locus_tag="cgd7_1800"
FT   mRNA            complement(<457154..>461290)
FT                   /db_xref="GI:66362781"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1800"
FT                   /db_xref="GeneID:3371741"
FT                   /locus_tag="cgd7_1800"
FT                   /transcript_id="XM_628355.1"
FT                   /product="oocyst wall protein 2"
FT   CDS_pept        complement(457154..461290)
FT                   /locus_tag="cgd7_1800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oocyst wall protein 2"
FT                   /note="CpCOWP2"
FT                   /db_xref="GI:66362782"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1800"
FT                   /db_xref="GeneID:3371741"
FT                   /translation="MRKQSMKIPVHKTGDLKMILISLSGIARICLTSVLLFFSIPTNSQ
FT                   YVRVPVETCPGNFALVNGICVHQIETQKIPVCPEGFVSKGSECYLAEPLLKECPTGFQM
FT                   QDKQCVKEVFAEKEKYCLDGLEMDYNTGKCYYKEEVKAICPPGSINFRDTCAMAREPMK
FT                   ICQEPYKFDSNTNLCIERKAALPTVVCPEPFVFDASLKMCIQDQIEPKICPEGFKDIDE
FT                   DKCATWIQPEYICPKGTQLENVRHQSLCRYINYSNPTLECPPGSFLEGQTCISMSRINN
FT                   RVCPIGFVEVEDQCVNYQEPLFHCPEGYEQTIHNGSKVCLNTLSVEPEISCPNKYSYFD
FT                   ESNKLCISEITLEKECPANSFRSKDLCLQKVKGEWECPAGTKYNPENHFCQEILSIEPN
FT                   IICPPNSKFEQSTSTCVGYERNIQVCPPGYEEIGENECASFVSPRRTCPNLQSLVNGQC
FT                   EEVILSPAETVCPSGSELSDSVCILTSENTSKRKCPLNSLDSGGYCSVIESPEKQCIEG
FT                   YKYNPETQKCTKITTRSPDLVCQEPSTLNSLGECIYTEVIPKICPEGSREDSTNENFCI
FT                   IETRAKSNCPEGYSLIENKCIKEKRAEGELNCPVGYEINELDMSCHKTIQRSKICPPGF
FT                   LDNGDECFKTSKPSSFCPEGFGREGKYGDCVQINISDSKPQCPEGTIGLDSGMCGGRKP
FT                   LPLEYKCLKGTKIGDSCLVESFIDVSYECPKGYYLSEIKQCQKLVEYDCSEVSIVPVPC
FT                   GSGVNTINTSNLGFYGQRNSGICSQAIRNHKTCTRTEAFPPKISCPQGSINIGKECMKK
FT                   EHLPMTRICSDHTKTLETCFEEFMIPKVNICPPGSSMTEDNKCASIVRKAPELICEEGY
FT                   IMEEGNCIQVTTKICPPEGCTLRNIIDSIRICPPGFVFEDGVCIFKHEVFPEKTCERGE
FT                   LSSANQQICIERIVKICSYSNCEIIHKEPPEFKCDENETLNSKTKLCEKINIGPQILKC
FT                   IKPFKLVGDQCVHQVSKECSGGNCSVTISIPPRITCKQGTLISRNQCESIKRSPSILTC
FT                   PKDFTIQDDLCAKYVYKECLNNQCEKKVHFPPIIECPNQYSLFPGGNCSKRVHHLPQLK
FT                   CPLGTNLMNSYCIREVESICPRGGCLAQETFPPVLSCPSGFQKNSQNLNYGGPICTKKL
FT                   FNNGQISCPKGSIISNGSCLTYSVKECQNNNCEELKTITPNKVCPNGTELVNGNTCKES
FT                   EIVPKDMICPSEGYILSGDKCVLYKDKICQHKDCKTQKVVEPEVSCPNGYKLDQAICVW
FT                   EKYHSTVNSCPRDSMMVNGQCFSMLKKECPNDTCENKIYLDPISRCPKGFVEAGNKCIM
FT                   IEYSGHKRICPPGLILKKNHCLRFAQAKFRCPIVS"
FT                   /protein_id="XP_628357.1"
FT   gene            <461559..>463601
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1810"
FT                   /db_xref="GeneID:3371742"
FT                   /locus_tag="cgd7_1810"
FT   mRNA            <461559..>463601
FT                   /db_xref="GI:66362783"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1810"
FT                   /db_xref="GeneID:3371742"
FT                   /locus_tag="cgd7_1810"
FT                   /transcript_id="XM_628356.1"
FT                   /product="ALG1 like beta-1,4 mannosyltransferase with
FT                   possible signal peptide"
FT   CDS_pept        461559..463601
FT                   /locus_tag="cgd7_1810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ALG1 like beta-1,4 mannosyltransferase with
FT                   possible signal peptide"
FT                   /db_xref="GI:66362784"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1810"
FT                   /db_xref="GeneID:3371742"
FT                   /translation="MILFGILFCFFVTIFFSISSLFFLLCLVIRRIYMRRLNNYATTRN
FT                   IAVLVIGDIGRSPRMQNHALCISKRFCSKLDSLGKTGKLVNRKGNKDINQKLDDKINNN
FT                   HVYLVGYNETICSSAVTGDKNITLQGIEKTFVEQYRKVLPLWAFLFMKVVEQSLRIFIT
FT                   IMKIPNLSGIVLQAPPSIPAIPIALLVSYIKGAHLIIDWHNYGHTLLIADKRENSQFSL
FT                   IRRIYQQILVNSYKILEFSLGRLSHSSFCVSKAMQEDLAKRGIQATVVYDRPNDDFKPL
FT                   DSISKRHSVLFKYFGSLENEICSENSSLGDQCTQNTFNRKAQGENKSKTKSREEKKSAQ
FT                   NNKKNNTKTKDALLYDESLTNVKDLESVSLNKSVLDMHQISESINTNLTEQGKGSARTS
FT                   LFSKSLIEEEFFFEIDSRILDEISSNFKSQDLKELLTRDDLFFDNHIFETSPVTDLGIS
FT                   CDQIDNKISLKIQLKKNRPAVLITSTSWTPDEDLNLLLEGLVEYDKLVSKQLGNDNLSK
FT                   KLPDIFLIITGKGPNKNSWLEKASKTKMKHVSIRTVFVEADDYPKLLACSDLGISMHYS
FT                   SSGLDLPMKVVDMLGAGIPIISFSYPTINELLKSEKLELLFSNPQELCSRITTLLEGFN
FT                   SSLEKEALPSPNLNKILKSNNSKKRETFYQEWNNSAVYHFDEMVI"
FT                   /protein_id="XP_628358.1"
FT   gene            complement(<463776..>464396)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1820"
FT                   /db_xref="GeneID:3371743"
FT                   /locus_tag="cgd7_1820"
FT   mRNA            complement(<463776..>464396)
FT                   /db_xref="GI:66362785"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1820"
FT                   /db_xref="GeneID:3371743"
FT                   /locus_tag="cgd7_1820"
FT                   /transcript_id="XM_628357.1"
FT                   /product="BET3 vesicular transport protein"
FT   CDS_pept        complement(463776..464396)
FT                   /locus_tag="cgd7_1820"
FT                   /gene_family="HOG000186184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="BET3 vesicular transport protein"
FT                   /db_xref="GI:66362786"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1820"
FT                   /db_xref="GeneID:3371743"
FT                   /translation="MSNSSNQYKKRSEYLRMGELAFQKTEKINGEVFSLMYGSLVAQFV
FT                   KDLDNAELINSKLEKIGYNIGIRLVDEFLAKSGISKCDSFRDTAEVIACVGFKMFLGIT
FT                   AETKDWNPEETSCVLVFNENPLADFVELPPCYSSSLNYSNMVCGVIRGALEQLQMQVVC
FT                   YFVKDILRGDATNEIYLELKERLQEEFFDDDDEEEDQENEYKE"
FT                   /protein_id="XP_628359.1"
FT   gene            <464864..>466828
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1830"
FT                   /db_xref="GeneID:3371744"
FT                   /locus_tag="cgd7_1830"
FT   mRNA            <464864..>466828
FT                   /db_xref="GI:66362787"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1830"
FT                   /db_xref="GeneID:3371744"
FT                   /locus_tag="cgd7_1830"
FT                   /transcript_id="XM_628358.1"
FT                   /product="secreted UDP-N-acetylglucosamine
FT                   pyrophosphorylase family protein, signal peptide"
FT   CDS_pept        464864..466828
FT                   /locus_tag="cgd7_1830"
FT                   /gene_family="HOG000256638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted UDP-N-acetylglucosamine
FT                   pyrophosphorylase family protein, signal peptide"
FT                   /db_xref="GI:66362788"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1830"
FT                   /db_xref="GeneID:3371744"
FT                   /translation="MFRNKSFLKFCFLYILYFFTFYFSMVVTISLRSPSNSGKKLDLES
FT                   LKESLVKGGQDHILNLLESGDSDNVNRLISQLMTLETSCVGGGLLGYINRAKKLLKDSK
FT                   DGVNPREGCYPEVPEVVNLDVGTEDFKKYEEHGFSVLKNVAFVLVAGGLGERLAFEGIK
FT                   IGIELSMASNITFFQLYTNYIREYQRRLKEAFGEDIVIPLLIMTSDDTDSMTRKFLEEN
FT                   DHFGLREDQVYIVKQLKVPALIDSDAKIALDPEDKYSILTKPHGHGDIHTLLHASGLLK
FT                   DLFEKGVRFLVFIQDTNALVFNSVLPVLGVTSMNSFVMNSLTIPRIPCEAVGALCKLRY
FT                   PDGKKITINTEYNQLTPLLKSCGLGSDFADEKTGYSPFPGNSNVLFISMDYYMKTLEKT
FT                   GGVVPEFVNPKYLDSTKTAFKSPTRLECMMQDIPLLFEADYKVGCVQMQRWATFSACKN
FT                   SLAEGRAKHSAGVSIDTASITEGDFYAAASQYLRLASIEKGVVCRIEESGRDPVTGKDD
FT                   KNSLIKHEMIAGIPVRVGAMVVLHPSFAIKYSDLLQRIQAGPIIITSRSYVHLEGDVVI
FT                   SGKFFVDGSVRIVAKNGSRIIIKNLIVNNNGTTRYHISEQDMGHATSNQKIRGYGIRHE
FT                   QIREIISDNGEEVIIDDQN"
FT                   /protein_id="XP_628360.1"
FT   gene            <467083..>469113
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1840"
FT                   /db_xref="GeneID:3371745"
FT                   /locus_tag="cgd7_1840"
FT   mRNA            <467083..>469113
FT                   /db_xref="GI:66362789"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1840"
FT                   /db_xref="GeneID:3371745"
FT                   /locus_tag="cgd7_1840"
FT                   /transcript_id="XM_628359.1"
FT                   /product="calcium/calmodulin-dependent protein kinase with
FT                   a kinase domain and 4 calmodulin like EF hands"
FT   CDS_pept        467083..469113
FT                   /locus_tag="cgd7_1840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calcium/calmodulin-dependent protein kinase with
FT                   a kinase domain and 4 calmodulin like EF hands"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362790"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1840"
FT                   /db_xref="GeneID:3371745"
FT                   /translation="MVLISWECVCDLTHPGQSLYVVGSHPRLGAWKITTEQEENKPIRL
FT                   ITDKLSYPVWRTSEPIRIRGACLLEYKFIISKETEPYENLEWEPIQGNRYLQVDENFPE
FT                   YKYIIHCSWGNISKSTIRFEEYFGNDGKVDDYSYRAKPGARYISPENAEIYSEEDEEPK
FT                   DRGAYESSVTPPLMLSRTGSRLRLLLDRSRFILSTKGDINQYYTLENTIGRGSWGEVKI
FT                   AVQKGTRIRRAAKKIPKYFVEDVDRFKQEIEIMKSLDHPNIIRLYETFEDNTDIYLVME
FT                   LCTGGELFERVVHKRVFRESDAARIMKDVLSAVAYCHKLNVAHRDLKPENFLFLTDSPD
FT                   SPLKLIDFGLAARFKPGKMMRTKVGTPYYVSPQVLEGLYGPECDEWSAGVMMYVLLCGY
FT                   PPFSAPTDSEVMLKIREGTFTFPEKDWLNVSPQAESLIRRLLTKSPKQRITSLQALEHE
FT                   WFEKQLSSSPRNLLLDNVISNFRRFQGLSRLKKIALTLIAQNIDERDILDLHDTFMELD
FT                   TSRDGTLSRAEIIEGINRTGCSPTIGIDALLDEIDPEGTDTISYTDFIAACIQERQMSH
FT                   ESACKAAFRVFDIDGDGQISNIEFLKVMSLSSKAKKSDDELAQELSEFMKSGDLDKDGT
FT                   INFDEFCHVMRRVPSKFLLGEASDDTINMMKRCSSRTNINL"
FT                   /protein_id="XP_628361.1"
FT   gene            complement(<469258..>473358)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1850"
FT                   /db_xref="GeneID:3371792"
FT                   /locus_tag="cgd7_1850"
FT   mRNA            complement(<469258..>473358)
FT                   /db_xref="GI:66362791"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1850"
FT                   /db_xref="GeneID:3371792"
FT                   /locus_tag="cgd7_1850"
FT                   /transcript_id="XM_628360.1"
FT                   /product="SMC4'SMC4, chromosomal ATpase with giant coiled
FT                   coil regions'"
FT   CDS_pept        complement(469258..>473358)
FT                   /locus_tag="cgd7_1850"
FT                   /gene_family="HOG000184777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SMC4'SMC4, chromosomal ATpase with giant coiled
FT                   coil regions'"
FT                   /db_xref="GI:66362792"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1850"
FT                   /db_xref="GeneID:3371792"
FT                   /translation="YRLLLPAVAPHYACFPANIPPHNCKQIKLGEKRLNKVNRLQGSLK
FT                   CFYYMENIESDESKSVGGEQEKPRLIIHKIVLENFKSYGGSKVIGPFHKSFTAIVGPNG
FT                   SGKSNVIDAMLFVFGKRAKHMRLNKVSELIHNSKHYPNNEKASVAVHFKEIIDVPGDEH
FT                   AYKVVPNSEIVIKREVHKNSEQTKYYINEKLSSYQEVTKLLSGKGTDLEHNRFLILQGE
FT                   VELIAQMKPKSTNANEDGLLEYIEDIIGSSRFIPDIEKHLMELEQFNELRQEKLNRLKI
FT                   AEKELNTLKGPYNMAIEFFTLEREIYIAKLLLHLEEQRDAIKHLNALKDEQNKHLDIRG
FT                   ELAHQKKALEDRRAELEVENKETNSRVNELKVKLEKEENEFKNILLKDEELRATLKNSK
FT                   KRLLKLEESAEGEKKLIPELEQKIVDLEDEVRKKQKQLPKISKDLDSAQEKLELLQKNV
FT                   KDGIEESRKKKDKAEQELSPLQKKLLDLQQSHDMLNIELDMLKQRQIQKQENEENSKRE
FT                   KENTVKRIQALNKQNKDFSKNLKDSKALLDEKSKKLEQLQKDLSENTRLLGIKKVELDE
FT                   ARSLLASNNHLETKVVSESKQKGPKMSLSETVMKYFSANKKSGVHGRLGDLGQVDDKFQ
FT                   LALASSVPQVENIVVQTTEDAQEVVNYVRKSNLGRISCIILEKLSATLIQNMEKTFKAP
FT                   EGSKRFFDLVKFKDPKFKIAWYFAMRDTLIVDDLDIATKISYNGKQRWRVVTINGELID
FT                   SSGTMTGGGPNVSVAKHAGKKLEKTSEIPTPEQLKKMETDLEACQNKCNKIKSECKDLE
FT                   DHVQNLKNDINGYTITLEKIKIELASIEETEKSRSEIQSKTGQESPSNQTEIMAEISRL
FT                   ESEIEGLKKQISTLEASLKQKQIVVDRLTNEMNEIGGPEMKKQSELVQELTKTIGALES
FT                   EISKSQVEITLSEKKKLKAIESIEQFENKSKALKEAIDKTESELVSLEEVALKIMESKK
FT                   LAEEELNSFLNEHSSFQARFEEIEREIEKLELRDVEISNKLNEISAKISEVESQNIKQL
FT                   QKKLQKVRADASCIPSIPEIEPEKSEQPAPEKNSELESLKSKFLIQDVQDAEYEKILGD
FT                   MTSKKLKPHIESLQAQLQAICEQYSNEGSVKQFRPSSDIFSQYSSQLQLFNRRNQEVEE
FT                   ATNARDESRRHLETVRQARHSEFISGFKIIASQLKEIYQMITLGGDAELELIDSVDPFS
FT                   DGIIFSVRPPKKSWRPIHNLSGGEKTLSSLALVFALHQFRPSPLYFMDEVDAALDFRNV
FT                   SIIATFIKEKTKNAQFIVVSLRNHMFEMADRLVGIYKTFDITKSVSIIPGNYSSDVKSK
FT                   TSVHRDREKAEEGAGDENILENA"
FT                   /protein_id="XP_628362.1"
FT   gene            complement(<473461..>474072)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1860"
FT                   /db_xref="GeneID:3371746"
FT                   /locus_tag="cgd7_1860"
FT   mRNA            complement(<473461..>474072)
FT                   /db_xref="GI:66362793"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1860"
FT                   /db_xref="GeneID:3371746"
FT                   /locus_tag="cgd7_1860"
FT                   /transcript_id="XM_628361.1"
FT                   /product="P24 like gold domain protein, possible
FT                   transmembrane region near C-terminus, signal peptide"
FT   CDS_pept        complement(473461..474072)
FT                   /locus_tag="cgd7_1860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="P24 like gold domain protein, possible
FT                   transmembrane region near C-terminus, signal peptide"
FT                   /db_xref="GI:66362794"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1860"
FT                   /db_xref="GeneID:3371746"
FT                   /translation="MKIEPIYFVVIVFIALFPFNTDALYFILNPGYTECIHFHAKKADH
FT                   IVGSFEIDSAYEGVRVSLFENKESSKILDKIENSGDFSINAPKDTEYQLCFKNLMNSVQ
FT                   QTVNFSIKNMAYNSNINNVMSNIESKKLIESMEKLYERITVASEKQRYALTRKRFQMEA
FT                   IESSRKKAAIWSILELLLSFGLVAIQVYYIKSYFQVKYLV"
FT                   /protein_id="XP_628363.1"
FT   gene            <474193..>474504
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1870"
FT                   /db_xref="GeneID:3371747"
FT                   /locus_tag="cgd7_1870"
FT   mRNA            <474193..>474504
FT                   /db_xref="GI:66362795"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1870"
FT                   /db_xref="GeneID:3371747"
FT                   /locus_tag="cgd7_1870"
FT                   /transcript_id="XM_628362.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        474193..474504
FT                   /locus_tag="cgd7_1870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362796"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1870"
FT                   /db_xref="GeneID:3371747"
FT                   /translation="MVFSTTHIKLLILYFFFPLRYPQNETRSQKNKNVRRPSTFIQRQH
FT                   IWTNSVRGNFSRRSKLKNQGSKVLNFSNYNKKFLIHIIRENGKFYEVRSFPFNGSDDI"
FT                   /protein_id="XP_628364.1"
FT   gene            <474516..>474830
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1880"
FT                   /db_xref="GeneID:3371793"
FT                   /locus_tag="cgd7_1880"
FT   mRNA            <474516..>474830
FT                   /db_xref="GI:66362797"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1880"
FT                   /db_xref="GeneID:3371793"
FT                   /locus_tag="cgd7_1880"
FT                   /transcript_id="XM_628363.1"
FT                   /product="60S ribosomal protein L44"
FT   CDS_pept        <474516..474830
FT                   /locus_tag="cgd7_1880"
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L44"
FT                   /db_xref="GI:66362798"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1880"
FT                   /db_xref="GeneID:3371793"
FT                   /translation="VNIPKLRNTFCKGSDCRKHTPHKVSQYKRGKESPRAQGRRRYDQK
FT                   QKGYGGQTKPKLRKTAKTTKKIVLRLECTKCKQRRFLAIKRCKHFQLGGDKKRKGGPVY
FT                   "
FT                   /protein_id="XP_628365.1"
FT   gene            complement(<475102..>477558)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1890"
FT                   /db_xref="GeneID:3371748"
FT                   /locus_tag="cgd7_1890"
FT   mRNA            complement(<475102..>477558)
FT                   /db_xref="GI:66362799"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1890"
FT                   /db_xref="GeneID:3371748"
FT                   /locus_tag="cgd7_1890"
FT                   /transcript_id="XM_628364.1"
FT                   /product="KH domain protein"
FT   CDS_pept        complement(475102..477558)
FT                   /locus_tag="cgd7_1890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="KH domain protein"
FT                   /note="possible plasmodium ortholog; transcripts identified
FT                   by EST"
FT                   /db_xref="GI:66362800"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1890"
FT                   /db_xref="GeneID:3371748"
FT                   /translation="MAKKRPNQGKGTSGKGKQKSPSNGKTNVEQKHKQEEKIEEPQVIE
FT                   ETPAVVDFSGLSATQKKNLKRRLKKKNMDSNSQEGQGAGKQRKPLTKKEIEAMLPNDPM
FT                   SKTRSEFLSKINSSLRGMLDLSVLPIEEVLSKKGEQERELNRLLSNISETLSKESSNLK
FT                   KPPKHLSVNTICEQLRDFELASKDEEGYDEEFYQHLKELLVVASLYENYRNFQNQCNEL
FT                   RTRIERKLSINKELSQAAADSNKQKRLVNRVKGLKQDSSIDNDSVETKIFELPNNKGNL
FT                   LDVLFGSSAKMAKNLEKKFGALVEKSTGNSVQITGLLKDIESCWESIRQLDFSSQETIS
FT                   LDPRVIKKLYSMTGNINLKSLQDELSIIINRMENSLTILGSPESTKAAVEIINKNSDIS
FT                   SNTVSISVSLIIAKALQFNFLPTVRSIEKETETSVRIQFGGKSREVSSLADISDSQHDS
FT                   KILIFGKPDKCEVAKNKLSNLIKGLEVESIQADSKAVRKLFSPPGKYSSDDSNARISRS
FT                   ILDEFSKLRDSNKMGIVRIGSSVVLVGPASEIKKAKPNLLDLLERAQYTPLTKTIHRDQ
FT                   LRVLNHSRREKVEKEACVEISTHKRQEGRSVVIEVLGSEQAKAKAETLIDEVLTKEAHL
FT                   ETLELDSCTYDKLYGSQRSHLRKLTSNFPNVQVIQAEKKRNSISLLGSKEEVLKLKEKF
FT                   LEFNRQTLESSSNETKEIIEIPSGKMGLIIGTKGSVLNEIRSKANCESINVPKNSSHVV
FT                   LQGTEEQCTIARNLISEILSNSLSNSNTTTCSEQSGPHSNKISAPESLKFDEKCFPTLG
FT                   GTISTF"
FT                   /protein_id="XP_628366.1"
FT   gene            <478353..>480059
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1900"
FT                   /db_xref="GeneID:3371749"
FT                   /locus_tag="cgd7_1900"
FT   mRNA            <478353..>480059
FT                   /db_xref="GI:66362801"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1900"
FT                   /db_xref="GeneID:3371749"
FT                   /locus_tag="cgd7_1900"
FT                   /transcript_id="XM_628365.1"
FT                   /product="mitochondrial NADH dehydrogenase"
FT   CDS_pept        478353..480059
FT                   /locus_tag="cgd7_1900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial NADH dehydrogenase"
FT                   /db_xref="GI:66362802"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1900"
FT                   /db_xref="GeneID:3371749"
FT                   /translation="MSNSEKNTSNIRTCSSVFAEDEKKNVSNTFSTITNKATSLTKSIF
FT                   SIFRLCSPFKTDASLGRPKVLILGTGWGFMKLAKGLDVNSNDIKVISPNKYFCFTPLLT
FT                   QIVSNRLPREVCEIPINELTYRGNKEVIKYIQGLALDIDKENKEVIYFDSEKKKQERIP
FT                   YDYLIINVGNEDSNIVPGIKEYALYLRNVEDSIKMRDAVVNCIKEVNANWDKMSDDEKR
FT                   KKLTFIVAGGGPTGVEVSGAFAELTKNFLSKNEYKKLAPFINIKIIEMANKLLPTAGDK
FT                   VSGYTKYVLSSLAGIEVLLETKLKSVSKDYVVIQKEGGDEELVPYGVFVWASGASPNSL
FT                   TKQICDKVEEQSFFKKAIVVDERLQVHGIPNAYALGDCALVRPRKLAERSKEIYQNALK
FT                   SSFGPTVKYLRDNFSIKAFPQMFNLSKVADLPKNEEILTEEDFKNLLEKLDSMYHSPPP
FT                   TAQGASQQGEYLVKLFNDYPSDKEKQECPAFIYYWNGSTCYIYDDNIAFYTPFGSMLGG
FT                   IHTKYIWRLAYTTLNPSSRSRSLLSKNWFNPFGMFAGGYKNDEIYKMNVSH"
FT                   /protein_id="XP_628367.1"
FT   gene            complement(<480221..>483031)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1910"
FT                   /db_xref="GeneID:3371794"
FT                   /locus_tag="cgd7_1910"
FT   mRNA            complement(<480221..>483031)
FT                   /db_xref="GI:66362803"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1910"
FT                   /db_xref="GeneID:3371794"
FT                   /locus_tag="cgd7_1910"
FT                   /transcript_id="XM_628366.1"
FT                   /product="coatomer SEC21 gamma subunit like (beta adaptin)"
FT   CDS_pept        complement(480221..>483031)
FT                   /locus_tag="cgd7_1910"
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coatomer SEC21 gamma subunit like (beta adaptin)"
FT                   /db_xref="GI:66362804"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1910"
FT                   /db_xref="GeneID:3371794"
FT                   /translation="ERREIKNKMDLKGDDKGVAINPFLGEKSSILQETRCFSEAHLNSK
FT                   KCCTVLTKVLNMINSGERLTDQEWSDLFFGITRLFQSNNQDLRRLVYLAIKSLKVNESE
FT                   AFVVISSLIKDMNSNNDCYRANSLRVISKIADGTMIGQVERYLKSAIVDKNSFVASSAL
FT                   LCGYNLALRGHGDIPRRWLNEISECIQGRDGMVQYHALVLLFELRNNDRLATQKIIEML
FT                   YKMPIKSVYSDCLMLRQMKNMFFLLCKQDSSWENVSWILDGFHTMLKSRSEAVSLEASR
FT                   GICDILKFLHEKQNHKALGFIDISQISNALQMILNSNISVAKFAAVRILNELANVSPNI
FT                   VFKCQHELEPLLNDSNRIMATLVLTILLKIAQENNLDKLVKQIPAFIADISDGGKKDII
FT                   RATKNLILKYPTKHKNILSFLATNLREEGSLDFKSFVIDTLFDISNEIPDILESILYHA
FT                   CETIEDCEYPVITIRILGFLGKNIPKTNTPSRFIRYIFNRLILESSAVRAASIDALVQI
FT                   ALVCDDLREDIRTLLQVCSKDNDDEVRDRTNTYSMIIDDKSTSDSLDDSDDNKCDLTNS
FT                   SLFGEHLISKEADTIRNLSFILGKVVSNEPETLLDLNSLPTDPVESTVNGSQITSNITS
FT                   VSASMEALNISRTRGNQNQTENSSDKTSTGVNVSLIYERLSGCISAQDLGSHLFTSTSI
FT                   PLTESESEYLVQLRKHFFNEGKFIVLEFQVANTLNDVLLKNVNVEFEAAIDGFSIIASA
FT                   PIPKLEPGQAESIFVLIQNSTQDHFPNVSNVIPCKLDYLYCEDGDENCGYNDIFTIDPM
FT                   TLSHSDCIIPNYLRQGEFKNVWNILETSGIEHIAKFSFSYKNIPSAVNGLLALVNAAAC
FT                   DNTENVNLESSNHTLLFSGTYFAKTPFLCTAIIVNNAELGCLVKITCRSNSESVCLDVI
FT                   KCFEAA"
FT                   /protein_id="XP_628368.1"
FT   gene            <483876..>484310
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1920"
FT                   /db_xref="GeneID:3371795"
FT                   /locus_tag="cgd7_1920"
FT   mRNA            <483876..>484310
FT                   /db_xref="GI:66362805"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1920"
FT                   /db_xref="GeneID:3371795"
FT                   /locus_tag="cgd7_1920"
FT                   /transcript_id="XM_628367.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <483876..484310
FT                   /locus_tag="cgd7_1920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362806"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1920"
FT                   /db_xref="GeneID:3371795"
FT                   /translation="ILAGEILQLPIWLARELYSRGFVGIDYPDFLSSKMSNALRTDPCS
FT                   VDLNNISPYFFQVSVIFLGLLQDELFLKVILESFRSRLEKLFLVSIYLHLPNSSESSKM
FT                   NNDHTQVFLKSLTSIEKDMLEESSISYFQSANALYCRRVK"
FT                   /protein_id="XP_628369.1"
FT   gene            complement(<484390..>487716)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1930"
FT                   /db_xref="GeneID:3371878"
FT                   /locus_tag="cgd7_1930"
FT   mRNA            complement(<484390..>487716)
FT                   /db_xref="GI:66362807"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1930"
FT                   /db_xref="GeneID:3371878"
FT                   /locus_tag="cgd7_1930"
FT                   /transcript_id="XM_628368.1"
FT                   /product="CDC68 like aminopeptidase family chromatinic
FT                   protein (possible inactive enzyme)"
FT   CDS_pept        complement(484390..487716)
FT                   /locus_tag="cgd7_1930"
FT                   /gene_family="HOG000209079" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CDC68 like aminopeptidase family chromatinic
FT                   protein (possible inactive enzyme)"
FT                   /db_xref="GI:66362808"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1930"
FT                   /db_xref="GeneID:3371878"
FT                   /translation="MGKDQVKLDVASFGRRIQFLYSVWLEENTKYDNKNVFKNLREVDL
FT                   LYVLCGKGSSREDGVIYKSMTLHYWLFGFEFSDTLILFSRKKKIVIVTSQKKVSILQQL
FT                   LEGSSDNFPNIELILVDRKGDLKESFENHKELVSNIAEATTTIGRIEPAGLQDGQFASQ
FT                   CEELFSGDNPFSNKETTMVTASIDYLLCHKDEVELGLCKKAAVLSVQMLKGVLLQRIET
FT                   ILDKELKESHKNIGRRAEAALDDKTIHNAWKTKYGLDPEDIDLVYSLVQSGSNFELKAV
FT                   ENSDENLCLTSGCIILSIGSKYREYCANITRTYFLNSTEEQKSLYNYCLELMETLISRI
FT                   KEGTSFNDLYSGIYQKIVEDKGTELAQKFVKIMGHCIGIEFRDPSLIISPRSSPDVLVQ
FT                   KGMTFNLSIGFNNLDSNGKKYAIWICDTVFLSQEGNVEVLTQGCSKKLEHVSYELDDEE
FT                   PEEQKPVVKKEKTSQVKKEKPTKKELDESEEEFDDDETEEDSEDDRHSKSKKDSKEIKK
FT                   EKKSKEHLIIEDRLRRTARRVNNSEHSEELKEIENRQKELRKRKLVELQKRFGGKKEEK
FT                   NDQKGDISDSEEDFFNSKLSSYKSVKEYPKERSSSRIYVDTAKESILVPIYGLLVPFHV
FT                   RLLKNVVCTQEEGRKSFILRINFLLPTGISLEQLPSTLKTPVFIKELMIRSEDGKTLNS
FT                   IFRSIKELIKRFKQKGTLEEEMAEQDMIKNQQPIDFNRSKQRVVLKDVGIRPTIGQGRR
FT                   QHGILEAHNNGFRFSSSKGETIDILYTSIKHAIFQPVENDLIVILHLHLKHSIWLGKKK
FT                   TQDIQFYSEVGNQIDDLEQRRGRNVYDPDEIMEEQRERETKKRYNLEYKKFIQGIEELS
FT                   KNSFEAEIPYRDLGFYGVPGRAGVSNVQLFPTASCLVHLLEFPPFVLSLDEIEVVSFER
FT                   VEQGLRNFDMIFVTKDYSKPVKRVDSIPIEYLDLIKRWLNEMEIVYYEGRQNLNWNAVL
FT                   KTILSDIEDFVQNGGFNGFLGEDSDDEEGGSDDDDDDEDEEYSESDEDDEDDDDDDDDE
FT                   DLSDLEEESSDDSFKELSSDEEEGLSWDELEKQAIKEDRKRGREQDEDRRVDSGYSRKR
FT                   R"
FT                   /protein_id="XP_628370.1"
FT   gene            complement(<488171..>489865)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1940"
FT                   /db_xref="GeneID:3371879"
FT                   /locus_tag="cgd7_1940"
FT   mRNA            complement(<488171..>489865)
FT                   /db_xref="GI:66362809"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1940"
FT                   /db_xref="GeneID:3371879"
FT                   /locus_tag="cgd7_1940"
FT                   /transcript_id="XM_628369.1"
FT                   /product="coiled coil protein"
FT   CDS_pept        complement(488171..489865)
FT                   /locus_tag="cgd7_1940"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coiled coil protein"
FT                   /db_xref="GI:66362810"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1940"
FT                   /db_xref="GeneID:3371879"
FT                   /translation="MQQVPLNAQPWGGIPSPMAGGMPTRQNGPVFPGAVPRMGVYSTPH
FT                   SPNRSSQIPPNVQSQMFPRQVPIPRVGVMGKPPGLGTQLTPAQELMMSTFTAQNQSING
FT                   VPYPASSIPQNLNVPSSPMPSPEREQRNSGIGTKLLNSFIPWMGTCGAQPSVGQNTGLK
FT                   SPNSGGIGSVFCCAPEKSGIMTPEFPGSHDSNFSFSNNAKDQFKGGVNPSNNDLEKENK
FT                   ELRESLFQLGEAVHDFVSKNNPNNESQLIATLSKQLSTIHQRIGDIKYSVFPTENKIGI
FT                   ETKNDLVLNIVQTVNIIFGKIEVIASILNNDHSALVFVNEIQKSLFDIGTHLEKLDELY
FT                   KSKGSELEAAKHVSIMMEEDNKHLSERLKDSNEQIRMLRERIIVLSTNIEDKSSPQAQT
FT                   SSPLYKKLESEKFELERKIQSIEQQLEETKKALEVSQNKYNNLIKQESINAKWPNYELT
FT                   KGRSHEDLVELLKKIDPESKALQSIAENIVKKDQNIFTPQPNLKDRVLNVQVQEKDIDF
FT                   LKSDSTLGELHKDTIRMQLEQFQKLHLINENVNKNAERPLLKSKDKK"
FT                   /protein_id="XP_628371.1"
FT   gene            <490455..>491024
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1950"
FT                   /db_xref="GeneID:3371880"
FT                   /locus_tag="cgd7_1950"
FT   mRNA            <490455..>491024
FT                   /db_xref="GI:66362811"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1950"
FT                   /db_xref="GeneID:3371880"
FT                   /locus_tag="cgd7_1950"
FT                   /transcript_id="XM_628370.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        490455..491024
FT                   /locus_tag="cgd7_1950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362812"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1950"
FT                   /db_xref="GeneID:3371880"
FT                   /translation="MLTKKLNRNFFIQSKFSRGIVYFCERLVPYSVPELYSTVIDVAKY
FT                   RQIFPWISETEITKIWGSIHNRDIFFSRQKIKFGIFGGYLYSIVEGRKPNSIIAYWPPK
FT                   EVLKIPITIEKFSSFVRSHRTSWEFIGNYKYGLTKVSCKLEFEFDTILMDKIAQRYIKD
FT                   MTETTINTLINHIKKSESLNTYSLNI"
FT                   /protein_id="XP_628372.1"
FT   gene            complement(<491212..>492951)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1960"
FT                   /db_xref="GeneID:3371881"
FT                   /locus_tag="cgd7_1960"
FT   mRNA            complement(<491212..>492951)
FT                   /db_xref="GI:66362813"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1960"
FT                   /db_xref="GeneID:3371881"
FT                   /locus_tag="cgd7_1960"
FT                   /transcript_id="XM_628371.1"
FT                   /product="membrane protein with multiple cysteines at the
FT                   N-terminus."
FT   CDS_pept        complement(491212..492951)
FT                   /locus_tag="cgd7_1960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein with multiple cysteines at the
FT                   N-terminus."
FT                   /note="No homologs in other organisms, signal peptide plus
FT                   4 transmembrane domains."
FT                   /db_xref="GI:66362814"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1960"
FT                   /db_xref="GeneID:3371881"
FT                   /translation="MYALKSLSIKLLFLLLLEVCAYKFTNGVPIASEAKVETENPLLSS
FT                   TEDCSNNPCACCSDKLLSMAEEYSELNGGANTECSSFLKNLFCTLACNEESSDIGTLSN
FT                   EIMVLSVCESGCSEILKKCPVKDSKSEEGGDEGKEEKKEKEEKKEKDEKKEKDEKKEKD
FT                   EKDKKSEDKESEDKKEEVKNEDKEKKNENKEEKSESNEENKETGENTDEKHIKEEEDST
FT                   STSNKRSIISSNFSRLKNAEKITIDSSGISGSLSLKDEKSECSAISVPNMHTTKSSKYS
FT                   LAFIQANSDTKICLKSSGGFKLMTKNVPILKSGSSSSGTTANTQTLPSSTVASNVSSSL
FT                   GNAPLTDEEIKCGFCFSKCCCWPVWSGSIISFAAYMVMAFLAIYWQSALFSLGLKSSHF
FT                   WKGGGYWLAGSGGLGIFVGMLVGGLVSSCFAGALSLGGSLTNLFMSVLLVGRLGAALGG
FT                   IGGLGTGASIGLMAHSGTISWVIGLILGLLLGLVVGFSPIARSLKMNDRYIRRGIRQRE
FT                   LRRRSRLSEGSYHSEGFSDASGTDRGKRSSVQRHTSAESRDNAAHISDGHSQSSSSAAN
FT                   NVN"
FT                   /protein_id="XP_628373.1"
FT   gene            complement(<493647..>495122)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1970"
FT                   /db_xref="GeneID:3371796"
FT                   /locus_tag="cgd7_1970"
FT   mRNA            complement(<493647..>495122)
FT                   /db_xref="GI:66362815"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1970"
FT                   /db_xref="GeneID:3371796"
FT                   /locus_tag="cgd7_1970"
FT                   /transcript_id="XM_628372.1"
FT                   /product="nuclear pore associated protein (NLP4) with
FT                   N-terminal ubiquitin domain"
FT   CDS_pept        complement(493647..>495122)
FT                   /locus_tag="cgd7_1970"
FT                   /gene_family="HOG000284097" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nuclear pore associated protein (NLP4) with
FT                   N-terminal ubiquitin domain"
FT                   /db_xref="GI:66362816"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1970"
FT                   /db_xref="GeneID:3371796"
FT                   /translation="IMHEEWIIRVFSSSGRSRVTIPSTCNLSMLKSKIAQSLKVPEEQQ
FT                   LLSLDSHGNTLLKGDSLSVLQHGLFNGSIVYLITDATPQIATQSIQRPKHMTTSDLPPL
FT                   EKKPSNSNYPSSSSADSKDMNNSVEKSEGPHFKSFDSFLSERNFVTDDLPLKQSYKSFF
FT                   ISKGVMNKIPPSVTLRHQAYRHVDHLEMMNLSEAMQFVDYWRSKLGMMKQRVGWMYGYY
FT                   REDSTYPMGIRAVMEAIYEPPQDEKAEPGKLILENDSFKSTVDRVAQSLGLECLGLVFT
FT                   HNERDEVLTSNEIVTLGKLQLEALKTPHYTGYPVSSFICCTIAPCKSIQGGDPIPNAFA
FT                   VSDLGLALLRDKIIDEKGLKDDTHIVIREEDKGEILPQILEKGVSTRKFDAHWLIVRIN
FT                   ESAPIQPKPFFSSSQFPRENRIVPQKPSDVSEFIKSRLTSVPLTSCNLLNDFHLLLYLA
FT                   KLFDEATAISICESIINKTAVDQHLLDILMSLN"
FT                   /protein_id="XP_628374.1"
FT   gene            <495615..>497093
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1980"
FT                   /db_xref="GeneID:3371797"
FT                   /locus_tag="cgd7_1980"
FT   mRNA            <495615..>497093
FT                   /db_xref="GI:66362817"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1980"
FT                   /db_xref="GeneID:3371797"
FT                   /locus_tag="cgd7_1980"
FT                   /transcript_id="XM_628373.1"
FT                   /product="gamma tubulin"
FT   CDS_pept        <495615..497093
FT                   /locus_tag="cgd7_1980"
FT                   /gene_family="HOG000165714" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gamma tubulin"
FT                   /db_xref="GI:66362818"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1980"
FT                   /db_xref="GeneID:3371797"
FT                   /translation="LKMPRELVTLQIGQCGNQIGMEFWKQLCTEHGLDANGTVIKDSGP
FT                   LEDRKDVFFYLSDDSHYVPRALLFDLEPRVLNSIKSSEFKHLYNPENFFIGKEGGGAGN
FT                   NWGCGYDTGEEVYDEILDMIDREVEGCESMEGFVLCHSIAGGTGSGMGSYILELLNEHY
FT                   PRKLIKTFSVFPMLNNESSDVVVQPYNSVLTLKRLALNADCVVVLDNTALSGIAEDRLN
FT                   LTNPTFAQTNALVSTVMAASTTTLRYPGYMHNNLVSLFSTLVPTPRCHFLVTSYTPITI
FT                   SQNIQQNVRKTTTLDVMRRLLQPSNIMVSTNMRKGTYISILNIIRGETDPMEVHKSLQR
FT                   IRDRNMVRFIQWGPAAIQVALSKYNPYSTQHKVNGLMMANNTAIAGLFQRCVAQFDRLM
FT                   KRGAFLDNYKKQSVFQDGLDEFENAREVSEMLIEEYKRAERNDYMLAGYNTDSGSKNLQ
FT                   LDGLSRQEPPLNEYSDDLYNYYSKENNPNYNTYC"
FT                   /protein_id="XP_628375.1"
FT   gene            complement(<497125..>497478)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1990"
FT                   /db_xref="GeneID:3371882"
FT                   /locus_tag="cgd7_1990"
FT   mRNA            complement(<497125..>497478)
FT                   /db_xref="GI:66362819"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1990"
FT                   /db_xref="GeneID:3371882"
FT                   /locus_tag="cgd7_1990"
FT                   /transcript_id="XM_628374.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(497125..497478)
FT                   /locus_tag="cgd7_1990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362820"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_1990"
FT                   /db_xref="GeneID:3371882"
FT                   /translation="MAKWLPGSSLSMSCVGLREKIEPERLKSLGSKEPEYSYETVRSGL
FT                   VQLIKSNQSKFEIPYLEADGISSPQIQILPPSIKTLVVNPKIEYPKCMRRSEKRKLRKE
FT                   RRSTRKVVETSAN"
FT                   /protein_id="XP_628376.1"
FT   gene            <498203..>500755
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2000"
FT                   /db_xref="GeneID:3371883"
FT                   /locus_tag="cgd7_2000"
FT   mRNA            <498203..>500755
FT                   /db_xref="GI:66362821"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2000"
FT                   /db_xref="GeneID:3371883"
FT                   /locus_tag="cgd7_2000"
FT                   /transcript_id="XM_628375.1"
FT                   /product="Bub1p related protein kinase"
FT   CDS_pept        498203..500755
FT                   /locus_tag="cgd7_2000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Bub1p related protein kinase"
FT                   /db_xref="GI:66362822"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2000"
FT                   /db_xref="GeneID:3371883"
FT                   /translation="MKGKYKTFFSFNVDILKDNKTNPYGPFSRNDELSFEEIGYLRYQL
FT                   DYNEFFNTKVDDKENLSKVCQKRNSCSSTNKDSWVKKDLDSKRISILEPVTSEKVELNK
FT                   VSEVIESLSLNYIQKDQAVISPIDSQDSNYAAFKLGSCGNFDKSEEGASFRSEDNYYLV
FT                   SLFGVHKYNSEKNLTFEKSLFSMGLISTMNPYHIRSRSFRESIMLNHINERYNNYSKLQ
FT                   LCAVPYMLYQINLASVTNKDDAPRLNQSSFKTGYSFTLEINQSYKRTFMLKKLIGSGAN
FT                   ASVFSSDVCTIVNENLVSVFSCAVKVQHKDLGLNVREIYGGLSLYKRNKKRITGIIKRA
FT                   SIEIEKPLILNEYQTNSFNEDIKKRSPLVQKTARSSISTTYLPGSNIPSSRNSLNSCFA
FT                   PMDTANENQSNENMAFRTSVSSLAHTPNISFYASSGNTPINNFRKSSVSSVKTASRISV
FT                   SSHCSCNYVDSASDGSSLTNPIEIGEGVTIFCITELYIVSQSSSGMIQNILTREMMKGN
FT                   REQENNQKNAELNDELSASVGISILPTFFGAQSLQNILNEFYLRNGMTMEEPILLFLTY
FT                   QFAETLLAFNEMKILHGDIKPDNILLYPNPSFCEEGWNNDTNLFTCHPLIPESHELPIF
FT                   MSIIDFGRSLDIGEIYKNTFFEGNCHAKSFLPPVMLENLPWLHHIDIFGIASTIHCLIT
FT                   GRYMELTKWSDETLRCLEYKHTKNKQDENDILKVYNYRIKNQSSCLKRNWRIEFWSNFM
FT                   TNCINFCPILDSRSIPNSAEFQGSLCHNNKTGLVSEQTKGLHVSQSIDEISRNITVFLR
FT                   KVQADIISIFQEDQQLKTTLYKQLLKIRKQLQNVSTSN"
FT                   /protein_id="XP_628377.1"
FT   gene            <501194..>503107
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2010"
FT                   /db_xref="GeneID:3371884"
FT                   /locus_tag="cgd7_2010"
FT   mRNA            <501194..>503107
FT                   /db_xref="GI:66362823"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2010"
FT                   /db_xref="GeneID:3371884"
FT                   /locus_tag="cgd7_2010"
FT                   /transcript_id="XM_628376.1"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        501194..503107
FT                   /locus_tag="cgd7_2010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical membrane protein"
FT                   /note="with no close homologs"
FT                   /db_xref="GI:66362824"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2010"
FT                   /db_xref="GeneID:3371884"
FT                   /translation="MELGDIHGVLSSGLLDSDKMRPMGRRFSVKVVDYIVERFGTERTL
FT                   PYISSIMAFLIQGCKDMEVHVQNSAVSTIGLIASSFLAEEIFQLNQDIVDNFFDPLFQF
FT                   SKKESNPTIQISSIAAISSAIDGMSTNLVIMNLNKLMGNLVPIMMNPNTSEACRAVVID
FT                   TLRKLVVLVWTFLQETSFGSSPGMYDLKQKQNMDPELNVCAEGLELKQVEGINDHLILP
FT                   ITWKQISSIFNGILKELHPNYTTNSKNTNVRSASLSLLTEIMVCCFVAQAGALLAAHNS
FT                   NIPLQKPIDGIKTYAEVIINVVNLGAKDKSPKVREVAQYCIKRLQEANEAYIPDGSEMM
FT                   SFTQNIQIIEKEQLNNQNISKSSKSRNRIMNENFFKNATDEILVKHVSPPSSWRQIQRN
FT                   AIEDKDQQTKLDMTTKSSEEEQVDKEDQYPASVSSITETQSVHSNSNSFVGANDLLPQD
FT                   NTSNTQNYPPLHLTEAVNQNLFLPGSKYSAISSNINAPLPSPLYIVTQPPVIQGNVMNH
FT                   SGINQESSEKQLILEKKVEELSKEVKRLITRQNELENVAHVLKMVAIHRVDSLEEKIKG
FT                   LSDSLRETKKEVRLEMDEIQNEKATLEEDLRHLSVNERKEIIGDFRRQLYNKAKQIVVE
FT                   NK"
FT                   /protein_id="XP_628378.1"
FT   gene            <503389..>503796
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2020"
FT                   /db_xref="GeneID:3371885"
FT                   /locus_tag="cgd7_2020"
FT   mRNA            <503389..>503796
FT                   /db_xref="GI:66362825"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2020"
FT                   /db_xref="GeneID:3371885"
FT                   /locus_tag="cgd7_2020"
FT                   /transcript_id="XM_628377.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        503389..503796
FT                   /locus_tag="cgd7_2020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362826"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2020"
FT                   /db_xref="GeneID:3371885"
FT                   /translation="MDESANTKNETKEMNGNSHEIASIASSIFLFIHSAMELQCFSSIS
FT                   DVTKSFFLIASSFSGATLTQIPPAKIKRENTEQMNPKKFLPKKIINALNTVEATTDFHR
FT                   DDPSRNPFIMQLHSVIFLSSYSFNFTKLINY"
FT                   /protein_id="XP_628379.1"
FT   gene            complement(<504072..>504971)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2030"
FT                   /db_xref="GeneID:3371798"
FT                   /locus_tag="cgd7_2030"
FT   mRNA            complement(<504072..>504971)
FT                   /db_xref="GI:66362827"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2030"
FT                   /db_xref="GeneID:3371798"
FT                   /locus_tag="cgd7_2030"
FT                   /transcript_id="XM_628378.1"
FT                   /product="bacterial-like Sir2 family protein"
FT   CDS_pept        complement(504072..>504971)
FT                   /locus_tag="cgd7_2030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterial-like Sir2 family protein"
FT                   /db_xref="GI:66362828"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2030"
FT                   /db_xref="GeneID:3371798"
FT                   /translation="TSMNTRIGTVLASLRSEIFDSGKKILFITGAGLSLDSGIPLFRSE
FT                   SDGGDGSAIWNSELEAWATIGSFRKDPIKWYSIFQNNFKFWSSFLTAKPNEGHRVLSKL
FT                   CSDFPNRIKVITQNIDGLMQQTNCPRENIIEIHGRIHYLRCANPNCDYSSSKFSYIDWK
FT                   GLFNQDNKIPKDFYLKWSCPSCSSPSLPLFLLFDESYTSHTFYEWEKAQTWMNEADLMI
FT                   FIGTSFSVLCTDCCLHYAYRNQIPIYNVNIRPAPICFELYNEDGNDFELIEYPNNLLNN
FT                   ITKTSTDFLTALFPRENS"
FT                   /protein_id="XP_628380.1"
FT   gene            <505448..>505529
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2035"
FT                   /db_xref="GeneID:3371873"
FT                   /locus_tag="cgd7_2035"
FT   tRNA            505448..505529
FT                   /note="codon recognized: AGC"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2035"
FT                   /db_xref="GeneID:3371873"
FT                   /locus_tag="cgd7_2035"
FT                   /product="tRNA-Ser"
FT   gene            <505914..>506195
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2040"
FT                   /db_xref="GeneID:3371799"
FT                   /locus_tag="cgd7_2040"
FT   mRNA            <505914..>506195
FT                   /db_xref="GI:66362829"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2040"
FT                   /db_xref="GeneID:3371799"
FT                   /locus_tag="cgd7_2040"
FT                   /transcript_id="XM_628379.1"
FT                   /product="small nuclear ribonucleo protein"
FT   CDS_pept        <505914..506195
FT                   /locus_tag="cgd7_2040"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small nuclear ribonucleo protein"
FT                   /db_xref="GI:66362830"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2040"
FT                   /db_xref="GeneID:3371799"
FT                   /translation="TRSLRVFENMADSGTIKQNNKSPSDFLRQVIGSPVIVRLNSGVDY
FT                   KGLLACLDDRMNIAMEDTEEYVDGVFVENHGDTFIRGNNVLYISSPPK"
FT                   /protein_id="XP_628381.1"
FT   gene            <506425..>507594
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2050"
FT                   /db_xref="GeneID:3371800"
FT                   /locus_tag="cgd7_2050"
FT   mRNA            <506425..>507594
FT                   /db_xref="GI:66362831"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2050"
FT                   /db_xref="GeneID:3371800"
FT                   /locus_tag="cgd7_2050"
FT                   /transcript_id="XM_628380.1"
FT                   /product="Hch1p like mystery proteins."
FT   CDS_pept        <506425..507594
FT                   /locus_tag="cgd7_2050"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hch1p like mystery proteins."
FT                   /db_xref="GI:66362832"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2050"
FT                   /db_xref="GeneID:3371800"
FT                   /translation="LREAKKMTEISGSLWNANNWHWEEKDYSKWGKEELRTIMESIKYS
FT                   FELEAPKFELSFSDLSIRGEASISVRKKQPILAYEFSISGTWSVNEVESQKKIILGQIT
FT                   IPEFSVDNYEEDFPIMITCKEVISKDYNSELILSEMKKKVVVKLRKKLMEFHNKLLNKE
FT                   NDQRKIETERVKREEEIKTAEIARVEKEEEKRQIYNQQIEKETLIKQRESEASTKTIDP
FT                   HPQAQGSVWNANNWHWEEKPETNWVISTLTKMIEDLSTNKSDSGNSDLIPISFSEVKVT
FT                   GEASSSVRKGKKICVLDCSVFGRFNAIIPEGMLSQNKESNLIGSFSLTEINMMDTHDYG
FT                   KKINYESAELGLKTADIPEFIDFKGKIEKQILGSLDSAIQKFCVEFLNK"
FT                   /protein_id="XP_628382.1"
FT   gene            complement(<507646..>508239)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2060"
FT                   /db_xref="GeneID:3371886"
FT                   /locus_tag="cgd7_2060"
FT   mRNA            complement(<507646..>508239)
FT                   /db_xref="GI:66362833"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2060"
FT                   /db_xref="GeneID:3371886"
FT                   /locus_tag="cgd7_2060"
FT                   /transcript_id="XM_628381.1"
FT                   /product="vacuolar protein sorting 29"
FT   CDS_pept        complement(507646..508239)
FT                   /locus_tag="cgd7_2060"
FT                   /gene_family="HOG000293431" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar protein sorting 29"
FT                   /note="derived version of the calcineurin phosphoesterase
FT                   fold"
FT                   /db_xref="GI:66362834"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2060"
FT                   /db_xref="GeneID:3371886"
FT                   /translation="MSSTDFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTG
FT                   NVCSQEYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGN
FT                   QVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAP
FT                   PSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK"
FT                   /protein_id="XP_628383.1"
FT   gene            <508711..>511863
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2070"
FT                   /db_xref="GeneID:3371887"
FT                   /locus_tag="cgd7_2070"
FT   mRNA            <508711..>511863
FT                   /db_xref="GI:66362835"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2070"
FT                   /db_xref="GeneID:3371887"
FT                   /locus_tag="cgd7_2070"
FT                   /transcript_id="XM_628382.1"
FT                   /product="large membrane associated channel"
FT   CDS_pept        508711..511863
FT                   /locus_tag="cgd7_2070"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large membrane associated channel"
FT                   /note="with no close homologs, signal peptide"
FT                   /db_xref="GI:66362836"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2070"
FT                   /db_xref="GeneID:3371887"
FT                   /translation="MKFPKDLIGFWILSSMFFICFSLVYGTKTESNVKNSLPYLELNKG
FT                   NKQGLLRQHRMVGEFLECTYVEHIDKNLQDGKNEDYYPGTGIDRNKSRVVSLESIDISS
FT                   KIIKTLECQKKIIERWMKDITKTLKENLFSVIEIRSWREMTRPKSLNGEAGEILAILEN
FT                   KNSSPLNKVKEAVEAFEKYITELHDAYSEFRNSEEKLESASTEEEKRTRAQVAVLILGQ
FT                   KENRSLLKFTKIIRNNADDARDSKKLLEKLFPLLSGESYNNRILQALELIQICFFLLNG
FT                   LNVLSVFEEQRLSNKFRRDMERRNLIYQHKIENKTLSRYPKFSNSPNFKDISNFLLSSV
FT                   NKSSDAESENKVKVEFIQMFDEITQDFGIRCPYFLTSILRSGKVGHSLKGEELFDLNAV
FT                   KNCRLAWKEISSYLYKEGQIVPSAAIRQALKKALYKHVKTVYVWPRNALGLFKSLFDRS
FT                   EFERAFDTSNEKRFISTCSEAINKEIGLGTSHAVSLDEIAIICFDFFNLLEFYTDQYNY
FT                   GNQENVGRDGNTILATKKYVNINTLPSKIKAKALDVACSRTLVGLIDFPPFKSNDLDRT
FT                   VIGILTTNFMETCVQRIETVLGEASKYRISNPQTICTEVRNILKDYNMLSQKPENIEGS
FT                   MDIFEQFNILDTSIVTETSKGASKPSDSIEYLKMLQSKLGSLQPSFQSTQSKDIGISPI
FT                   RQLDPVKAYNLVRKMHLDWMEQMRNDPRYKGFTDLELKNNSPWNKQMKLWHELITPELP
FT                   EVRYAASYLNNRPSRFPLISGDKRGKHKKITPLEEFLNEDLDPKYRARYPLVENGPFEE
FT                   QDFYYDDEYYKHPYEDSIAAEAAQTREYYIKRKNGSYIKNEKGSYIKERNGKYVKINKG
FT                   DYIKEGRRNYIKKDEGYYTKNGEINQHYAAVPVIHGEQITAQLVRPNKEYNIKAYQTRN
FT                   NALINYSYIDNGCKGEELPLLWGQRATILHENMIKGFKMVKYRGKYGPGHFVSMDDICY
FT                   ILERDFKVKRNYFEDISKVNLMECQKWFTEYLSKLWPPFNMESFKADVKTLCWDSGFRG
FT                   WL"
FT                   /protein_id="XP_628384.1"
FT   gene            <512067..>513560
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2080"
FT                   /db_xref="GeneID:3371888"
FT                   /locus_tag="cgd7_2080"
FT   mRNA            <512067..>513560
FT                   /db_xref="GI:66362837"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2080"
FT                   /db_xref="GeneID:3371888"
FT                   /locus_tag="cgd7_2080"
FT                   /transcript_id="XM_628383.1"
FT                   /product="mitochondrial processing peptidase, insulinase
FT                   like metalloprotease"
FT   CDS_pept        512067..513560
FT                   /locus_tag="cgd7_2080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial processing peptidase, insulinase
FT                   like metalloprotease"
FT                   /db_xref="GI:66362838"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2080"
FT                   /db_xref="GeneID:3371888"
FT                   /translation="MIQQKIRLFRHVLRNISTQVLRTKKPIFRQINGLRSIESYKIAPQ
FT                   NGIGPIFSELSNGMRVITLENSNKIASLGIIIKMGSRFESKSSFGSSRVLFNMILSQEG
FT                   KTSQNCLPNKLALNGLMLAGGFNREYTSFLLEYLKDQGIENTQEFFDGIFKFYKKQFSD
FT                   EELELAKKNIKEELLFELENPSIMLNELLHSTAWKENSLGNNQSTSFDQVSDLNIQNLT
FT                   DFRNSNFLSRNTIIVGTGISHDHLIKKILNSSRKFDITEQNSVNNLKNDEQTMKIPKYV
FT                   GGLVKNKLPHYGFTDILIAFETNLNWKGRELVALSVLQAYLGGGSSFSVGGPGKGIHSK
FT                   LFLDVLNKFDWVESCNCFVNQYSDTGLFGIHITSYPGYSLESIKVIAKQLGKMKNISER
FT                   ELERAKNLVLSTICTAYENRSHYMEEISKQILSYSEFIELDEIINCIKSIGIEDIKKVA
FT                   DLILSKADRPTVVAVGTDMNQVPNYNEIISIISRQVSNY"
FT                   /protein_id="XP_628385.1"
FT   gene            <513781..>515154
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2090"
FT                   /db_xref="GeneID:3371824"
FT                   /locus_tag="cgd7_2090"
FT   mRNA            <513781..>515154
FT                   /db_xref="GI:126653036"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2090"
FT                   /db_xref="GeneID:3371824"
FT                   /locus_tag="cgd7_2090"
FT                   /transcript_id="XM_001388345.1"
FT                   /product="Ruv DNA-helicase-related protein"
FT   CDS_pept        513781..515154
FT                   /locus_tag="cgd7_2090"
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ruv DNA-helicase-related protein"
FT                   /db_xref="GI:126653037"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2090"
FT                   /db_xref="GeneID:3371824"
FT                   /translation="MNIEGEKPSSTNFSRVSTHSHIRGLGLKNDGTASNDGSCGMIGQL
FT                   QARESAGVVLSLIQNKKLAGKAVLLAGPPGTGKTAIAQAIAHELGPKVPFCPMVASEVY
FT                   SAEVKKTEILMENFRRAIGLRIRDVKEVYEGEVVELVTEETENPHGNFGKAVSAIVLTL
FT                   KSAKGTKTLRLAPQLSDVFQKEKVKVGDIIYVESSSGIVKRLGRSDSFATEFDLESEEY
FT                   VPLPKGDVYKKREIVQDITLYDLDLANAKPQGGQDIISLLGQYVRPKKTEITEKLRLEV
FT                   NKSVNEYIDQGVAELVPGVLFIDEVHMLDIECFTFLNRTLESSLAPIVIFGTNRGVCTV
FT                   RGTDMLSSHGIPVDLLDRLLIIRTIPYNIEEMIRIVSIRCDIEGIKMDKESLQLIGEIG
FT                   SSTSLRYICQLLTPAHIIASTFGRDTICKSDIQEVDSLFFDSNASARRLAEDSNSFIL"
FT                   /protein_id="XP_001388382.1"
FT   gene            complement(<515260..>522060)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2100"
FT                   /db_xref="GeneID:3371889"
FT                   /locus_tag="cgd7_2100"
FT   mRNA            complement(<515260..>522060)
FT                   /db_xref="GI:66362839"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2100"
FT                   /db_xref="GeneID:3371889"
FT                   /locus_tag="cgd7_2100"
FT                   /transcript_id="XM_628384.1"
FT                   /product="WD repeat protein"
FT   CDS_pept        complement(515260..522060)
FT                   /locus_tag="cgd7_2100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD repeat protein"
FT                   /db_xref="GI:66362840"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2100"
FT                   /db_xref="GeneID:3371889"
FT                   /translation="MLLSCGITPDGGVLDEVTLTCCSSWDSICATGTKSGHVYLWNILR
FT                   VDKKSIEGSPEKELVPSCVLIPNSLCPIKLIGMVFVLSPSPLLQSCTDELLLTLHSDNI
FT                   MRYWSLDNGRCIAQLSDSAEHEVLQLVSLADKRFVLLVGHQRITIIDTWSRLNCGALKI
FT                   ASCPYSKRRINNRIDDDTPDMYKIQSPSTVQLSYEDKNEKSSFNPTNTYGEYGESMIFN
FT                   VSTNHDYFELLKWSSNISLFDYCEDNRYPTAHFYTVAAMLNTGQVLVWDLSNLIRIWWH
FT                   FIPIPHCEIPCPVPKPQKNNVPKPFMKYSQDETGFNNLAKNSSRSSINYSQDQIIIEDN
FT                   LGDLDIKYEQIKQESSIEDINGSSFERYDHAFESSSNASDQSKSSSFDTPYIHQFCSIK
FT                   SPMLAPTFFSLHPCFVSEPINFYSIPSSEMFSTQIVVTDFYLIVNAKYRLIIWKRTFLP
FT                   QFQNRNQRYQPFGDLFVPNTPICEDSNPNNPQMEISTQNFSNGSEFKDPMYDIHQTQPL
FT                   KRAITLNVINQNNENVEIKQKLQIWLGFSQISLNIRQACINKTKTYSPIRTLSMEYEEK
FT                   QKHCVSFLAWSSDFTVYSIQLPSVVCFLFSQNFNPKFESNIAFSEHDLREIDNYGNYSD
FT                   ITAVPVYISRDYFKINDKEQLNYLGHLASYWQFFKINTLYENDLEESPKSGRNIDLNFQ
FT                   NQGNNDIIWVHRNNFRFLLEKSCETLHNTNFISIEQNSDKIFYSFFDLSIIESQQKLPT
FT                   YYKFPFIPNNSFSNCYKSFNDAHSFILDNVEVSDSKNMFFPVKLNMDSQNSIENRNDPI
FT                   IYRSTENEIYWKSTKSLRTIWEDDITDYDKKNNISVLSCCITEQKNSIYCIISLSNGKI
FT                   MGQCLTGEFGLFSMMNCNEDKHFFGNIENGVVYQLPLPRPSCGHKTNVIEIKSVTDGCI
FT                   FGLTCCGNILVWKVDLMENFVNKFSTGESKNKDVHCSNNYNTNYSKNVNSPGIKGQIVS
FT                   NNLFSLIACINGLFFTNVISLNKVIVFDVNRLGELGTPKYDKFQILVHSSLEKKCVLIK
FT                   VNDNQANGISSKSEPKSTNRCIWDERKDQSNTEIQGVTYEILSLSLELEKRQDPIESRI
FT                   NSVGIDKPSNFIFILQGDIVFVYDKDSHLLLAKICFNSILDLNVCEYQDYHLSYGLMSS
FT                   LNRFIQTSNRIEFLDHGIMFGSVLIGYMPKLDFQKEKNYYQGCLGVRSSMSVSFMAFNP
FT                   HVSADIVSIEKKKQKNTKTSRYLQHLFPLFVRSTNEFLSKLFADMAPLTVRPILKFSTL
FT                   ITGVNYAISIPICNILKKKTYSSKLSLRLKIWNSVDYYFNLSKRNKQGNGKRCESVDRS
FT                   RSIYSGTRESMIRSHTYDGTGIPPYRYLVSENWSENIMRHLDTKTVSVRTLKNRLNISD
FT                   NKSIISSCPGRPFFEWSRLPGRKKNLEIDTNDYYIGELSGIPCTSHLVNRIVRSRNSGI
FT                   NRKNSKLPHNIKESLNSTSTLQRGETFDSRNLIKREPIDSSENSAPLFRSRTYESTLNF
FT                   SNGQTEVFSSFEASDKIWLERFLSQRNISEKALNEKFQNFKNQNEKTFGTENPVDSCSV
FT                   CELRQDLEYQDEIESFRKQDTSRELQEHFSAHQIALQMVILHYYFTYYSNLDLPIQLLD
FT                   NFLLSWIIEHVEQKKLLIRFIPFHLFSITGMTLDVFNPYLRLSAKYCLQLAIRSLPSEV
FT                   LSYCEEIAIDTLSGIIKEFLRISAPRTNGENKDESLHLLEQEVITSSNMDVGGSLCSTL
FT                   GSEIKSIPPWNESCRRGHPKIYSYCSISLCRMIGYRLPFPIMNSGEYYCSNLSIEDLSL
FT                   FFLSIVLYEHPFKRTHSACIGKIILSFLISIITTYDIEIIIKFSKNFEKQQEKKRLLKP
FT                   IYARRHDTEQWYSWENLNIDSSKSNIIVNTSSLGNTGSFKATGYKDNLNYDINSYYNNI
FT                   SIMDTLRFLFALELFSLNFTSLLKAKNIENTCVPNLLRNSLTSWENNIFIAAHIFQVDS
FT                   GSLSDKIEQKNNKKNVSTKVSNSIICLCIRLLTLAQYPPFWTSCRHLLQLIGQLDPKTY
FT                   IYILGYAGRTAYPYMGINYTCNVLSLLVYFVSSLPEYSFPYLNMVVDISIGFLDPLDST
FT                   LRKGTITAVTSVLFILVSAFPMITFHQNTQRFAIGFDRSIIVYDLRTATKWRVLQGHTQ
FT                   QVDALCFNKEGEFLASYSIVEKALRIWQCTQSGLLGGLLGISGNCIKTIDLIELPPRTL
FT                   SCSLYYRLKVVKISCKNTDEWQLRRENKKTYTITIDKN"
FT                   /protein_id="XP_628386.1"
FT   gene            <522775..>523560
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2110"
FT                   /db_xref="GeneID:3371890"
FT                   /locus_tag="cgd7_2110"
FT   mRNA            <522775..>523560
FT                   /db_xref="GI:66362841"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2110"
FT                   /db_xref="GeneID:3371890"
FT                   /locus_tag="cgd7_2110"
FT                   /transcript_id="XM_628385.1"
FT                   /product="60S ribosomal proteins L8/L2"
FT   CDS_pept        522775..523560
FT                   /locus_tag="cgd7_2110"
FT                   /gene_family="HOG000232983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal proteins L8/L2"
FT                   /db_xref="GI:66362842"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2110"
FT                   /db_xref="GeneID:3371890"
FT                   /translation="MGRVIRGQRKGAGSIFKAKVSKRRGPVKLRALDYIERHGYIKGLV
FT                   KDITTDPGRGCPVAHVSFRDPYRYKIKKELMIAVEGLHTGQFVYCGKNATLSVGNVLPV
FT                   GQIPEGTIISSCEEKAGDRGKLARTSGTYAIIVGQSEDGTKTRIRLPSGARKTISSQSR
FT                   AIIGIVAAGGRIDKPVLKAGNNYHKYKVKRNCWPKVRGVSMNPVDHPHGGGNHQHIGHP
FT                   STVSRSAPPGQKVGLIAARRTGLLRGGRKTAKDKVEKGV"
FT                   /protein_id="XP_628387.1"
FT   gene            complement(<524004..>524414)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2120"
FT                   /db_xref="GeneID:3371891"
FT                   /locus_tag="cgd7_2120"
FT   mRNA            complement(<524004..>524414)
FT                   /db_xref="GI:66362843"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2120"
FT                   /db_xref="GeneID:3371891"
FT                   /locus_tag="cgd7_2120"
FT                   /transcript_id="XM_628386.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(524004..524414)
FT                   /locus_tag="cgd7_2120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362844"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2120"
FT                   /db_xref="GeneID:3371891"
FT                   /translation="MKKTIFFIIICVLIWDFISTQSTVIPSFIPINEGIPDNELSRLSL
FT                   EVLPIISHKFKIQIFSDRIRIDSRPKCYNSQGFDGKDTVKVSVFFFILPYLHATFFPQG
FT                   CEIGVYICDHDFHKQCLWVHKSHCQCSSPGKF"
FT                   /protein_id="XP_628388.1"
FT   gene            <524551..>525462
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2130"
FT                   /db_xref="GeneID:3371892"
FT                   /locus_tag="cgd7_2130"
FT   mRNA            <524551..>525462
FT                   /db_xref="GI:66362845"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2130"
FT                   /db_xref="GeneID:3371892"
FT                   /locus_tag="cgd7_2130"
FT                   /transcript_id="XM_628387.1"
FT                   /product="uncharacterized protein"
FT   CDS_pept        524551..525462
FT                   /locus_tag="cgd7_2130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized protein"
FT                   /db_xref="GI:66362846"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2130"
FT                   /db_xref="GeneID:3371892"
FT                   /translation="MGFSGDKIESSCNIRSQRRLRTDTAEAVFGNFWEAPKNSNFHSRG
FT                   VKKNKQNYEHEIAENSTQKSDSDSLDKKFNITNLDTQERLSFYESQGAEPYLSKYPTIT
FT                   SILTETQPKRWMIMFSRAQSSSSRDSKDGKNNKKNSKINSSGLTNEDLPFNKMQFIWSS
FT                   ELDEHKRVKLNNKNSPSSQSLLSDPNDLSPIVINFPHPIQLQNISIPYEVLDPRSVPCG
FT                   SFIWWDRRVWEYNFVYMARRLSTNDEKSRKKLNIENPVTPKKQIRALGESNGQSSKRSR
FT                   PKVDANPKLNQKSKSPKNVIKQ"
FT                   /protein_id="XP_628389.1"
FT   gene            complement(<525531..>527086)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2140"
FT                   /db_xref="GeneID:3371825"
FT                   /locus_tag="cgd7_2140"
FT   mRNA            complement(join(<525531..526940,527024..>527086))
FT                   /db_xref="GI:126653086"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2140"
FT                   /db_xref="GeneID:3371825"
FT                   /locus_tag="cgd7_2140"
FT                   /transcript_id="XM_001388346.1"
FT                   /product="flap endonuclease 1"
FT   CDS_pept        complement(join(525531..526940,527024..527086))
FT                   /locus_tag="cgd7_2140"
FT                   /gene_family="HOG000193853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flap endonuclease 1"
FT                   /db_xref="GI:126653087"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2140"
FT                   /db_xref="GeneID:3371825"
FT                   /translation="MGIKGLTKFLADNAPKSIQQQGIGSLLGKRVAIDASMWIYQFLAA
FT                   IREGSQWGNLTNSSGESTSHINGMLSRTTRLLEAGIKPVFVFDGAPPEMKKDELTKRDE
FT                   RREKALAELEKAQEIGDEELIKKQSVRTIHVTKKQVEDVKKLLGFLGMPCIDAPSEAEA
FT                   QCAELCKDGLVYGVVTEDADSLTFGTPIQIKQLNFSESSNKITDKSPSKQKNGMQIIKL
FT                   SLILSELDINMDQFIDLCILSGCDYCGTIRGIGTSTAYKLLKKYHNIESILKNIDQTKN
FT                   PIPGNFDFSKVRELFKNPLVSKNNQIKDLIKWSNPKYEELMEWLIKEQNFNEARVNSYC
FT                   ERIKKSKNKTSQTCLDGFFKTASNERKNTHETPSRPPLSEKQKSETRKEVDSSLSCDKK
FT                   KVKIEETKIISEWGAPVSKNLSSQAEKDLAENSSEAPNQSSEIKVNKIEENKDSESSTV
FT                   ENTPSLQTKSPEPTMRPVKRKLNRLISESDED"
FT                   /protein_id="XP_001388383.1"
FT   gene            complement(<527259..>527925)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2150"
FT                   /db_xref="GeneID:3371826"
FT                   /locus_tag="cgd7_2150"
FT   mRNA            complement(join(<527259..527731,527775..>527925))
FT                   /db_xref="GI:126653088"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2150"
FT                   /db_xref="GeneID:3371826"
FT                   /locus_tag="cgd7_2150"
FT                   /transcript_id="XM_001388347.1"
FT                   /product="transmembrane protein, putative"
FT   CDS_pept        complement(join(527259..527731,527775..>527925))
FT                   /locus_tag="cgd7_2150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transmembrane protein, putative"
FT                   /db_xref="GI:126653089"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2150"
FT                   /db_xref="GeneID:3371826"
FT                   /translation="QAIILFLIIKCIRVYSAIYFYVQEGTEKCFIQEVPKSVPIHVKYE
FT                   NVNNLGIDCTVIFKNTENIEVFSRHVNENDHKGSVAYLPEVDGDHKVCIRCDSSNWFKS
FT                   EQMKWILSIDTGNISEHLDVDSIASKDEANYVEEFINSLISKVNNQVSEGEYEFEKQEM
FT                   FLKQALSVNKRIVIYSIIQLTLVSVISYFSIIHMRNFLRKQRII"
FT                   /protein_id="XP_001388384.1"
FT   gene            <529734..>531122
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2160"
FT                   /db_xref="GeneID:3371801"
FT                   /locus_tag="cgd7_2160"
FT   mRNA            <529734..>531122
FT                   /db_xref="GI:66362847"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2160"
FT                   /db_xref="GeneID:3371801"
FT                   /locus_tag="cgd7_2160"
FT                   /transcript_id="XM_628388.1"
FT                   /product="Pre-mRNA splicing factor SF3a. 2xSWAP domain
FT                   protein"
FT   CDS_pept        <529734..531122
FT                   /locus_tag="cgd7_2160"
FT                   /gene_family="HOG000135077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Pre-mRNA splicing factor SF3a. 2xSWAP domain
FT                   protein"
FT                   /db_xref="GI:66362848"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2160"
FT                   /db_xref="GeneID:3371801"
FT                   /translation="ANMSNQVGLIYPPFELRATIDKTASFVAKNGEEFESRILSESGSI
FT                   KFTFLNKDNPFHLYYKKRIEDFKNGVSIDNSGPTIPRAILDMNSRKEKQIIAEKEVLML
FT                   TSFSGGFGFMGGAVMEPEEPRKDQYTISHPIISIKDESVIKITAMYLARNGQSFLSDLT
FT                   ARESNNPQFDFLKPGHALFGYFADLVEAYSLCLIPNKSYLRGMKNESEDLQAIFRRCYK
FT                   NSLWRKKEVETNSGLLELENRDHVDLEWVAINIVETVDFDDLNLDLPEPVDFSMLSKLV
FT                   LESSLDMLNENDRNDLLESEIQNEERQINVLVIEKEQINDNVSDELNNTNNDDAFEEEF
FT                   KNIKIIKNYVRVPKKRGLVTKSEQKKKGKMYRCPITGQLIPDEEISNHMRILLLDPKWK
FT                   QQKDQLVQRAQQESALTASSNIEENLIAFITKRPDLFGTIEEAVAGTHGFEENGEKNKK
FT                   QKFQ"
FT                   /protein_id="XP_628390.1"
FT   gene            complement(<531146..>533506)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2170"
FT                   /db_xref="GeneID:3371893"
FT                   /locus_tag="cgd7_2170"
FT   mRNA            complement(<531146..>533506)
FT                   /db_xref="GI:66362849"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2170"
FT                   /db_xref="GeneID:3371893"
FT                   /locus_tag="cgd7_2170"
FT                   /transcript_id="XM_628389.1"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        complement(531146..533506)
FT                   /locus_tag="cgd7_2170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="GI:66362850"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2170"
FT                   /db_xref="GeneID:3371893"
FT                   /translation="MESYYYSEINENELLDDDRHNDETFEVGEVGDDWVPSITLNHFDI
FT                   KQEYQEREGANQMKRLEELMKSKTPLTVEEIEAAMMNQDFFREQGSTKIQEELHQQNYA
FT                   DFEAEQNVRRSRVNSGYSHNKGQHGSSFQHKQRNTSNQHSSSKRNDDRSYSGSRGHRGS
FT                   HQDILSHEQDTSKEPEPVPEIPFSSYISPLTKTHISEIISCNLSSPSNWDHSGLSNDPS
FT                   RNNNLMASRDFDMILRIQLQQMAERPEIQSYSSKWNRRLLARKHNLPLGNSDSSEDKDQ
FT                   SKLNTKVGQEAEDRSKNKLKEGQIADQDSNRIRKFGKSTYSTVRGARELIKVHNLSKDD
FT                   NSEMRDEINIGENRDQIKNSINGDYSFSTGNAHYQMLSKQVFEVLHSNIFNSPEFGSQD
FT                   EKKVQAPGPLVYSIIEAGNDLLQYVSYFDDEIENCPTGHLQARLRLDQELRDTIDLIFQ
FT                   LLFGFSKHSFGASSVEDANYKNGEHFKVSEISFAERNIACLNARRWLLNKILNIRKGRY
FT                   FVLSLFHMPHISESYMTVLLESIIACNDPIIEIFRSSSIILPPLMALVPRAFRYRQGQD
FT                   ILAPHDGFGYSGDIDKLVDDWRNIYGGNDPYDEKYVTREDLMAKAKLGVKILETTALLA
FT                   NRMMQSNNYRDTSSLVPSLSALLKYYNQEYIQSLLGISTGVVFLALLYNSISVVPRQID
FT                   ALKQITRLLVLAFTNYLLEKDSENSPIMPIKLSPIALKDSEPVVLCVLQRSTNDLNLKN
FT                   ILMSSISDVVGVENNDHFISELQELIVKGTSKN"
FT                   /protein_id="XP_628391.1"
FT   gene            complement(<533944..>534801)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2180"
FT                   /db_xref="GeneID:3371894"
FT                   /locus_tag="cgd7_2180"
FT   mRNA            complement(<533944..>534801)
FT                   /db_xref="GI:66362851"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2180"
FT                   /db_xref="GeneID:3371894"
FT                   /locus_tag="cgd7_2180"
FT                   /transcript_id="XM_628390.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(533944..534801)
FT                   /locus_tag="cgd7_2180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362852"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2180"
FT                   /db_xref="GeneID:3371894"
FT                   /translation="MYFNTLKHTTIQNLKSSEWIFFFFKHLLSENPCTFRDLYFYKHSE
FT                   ESTIECDASLIYLTMQEPFVKLSMLENNYIDISDAKITKEIIILQKLLSTSIITEHEFK
FT                   DCLLEICVEIETNPNLKQNVQELVDKNIISQIFLLDGIFDTILSELKVGVSYLEQFINL
FT                   QIEDWSLKSENKNLVKFSISKLGNIKGWVSVLRISTPKDESNIDFFSKVNISLIDLLRI
FT                   MLKFRRHLICPNHIIVEEIKATWKLVSEEISMASIIQAISTICYGNVQLQNSFSQNQDG
FT                   KFSI"
FT                   /protein_id="XP_628392.1"
FT   gene            <535916..>536497
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2190"
FT                   /db_xref="GeneID:3371895"
FT                   /locus_tag="cgd7_2190"
FT   mRNA            <535916..>536497
FT                   /db_xref="GI:66362853"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2190"
FT                   /db_xref="GeneID:3371895"
FT                   /locus_tag="cgd7_2190"
FT                   /transcript_id="XM_628391.1"
FT                   /product="putative guanylate kinase"
FT   CDS_pept        535916..536497
FT                   /locus_tag="cgd7_2190"
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative guanylate kinase"
FT                   /db_xref="GI:66362854"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2190"
FT                   /db_xref="GeneID:3371895"
FT                   /translation="MKDILVICGPSGVGKGTLISHLMQEFPDKFGFSISHTSRSPRGKE
FT                   SNGVEYYFCSNEEFINMISMDGFVEYAEVHKYFYGTSKQAIEDIINQRKICLIDIDIQG
FT                   VEQIQKSSFGDRAYYIGILPKSQMDLEERLRKRKTDSEQAIQIRLQNSVEEIERINRNP
FT                   NIYKLVNDDLKTACDEIARLVKSYWEDISY"
FT                   /protein_id="XP_628393.1"
FT   gene            <536624..>537220
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2200"
FT                   /db_xref="GeneID:3371896"
FT                   /locus_tag="cgd7_2200"
FT   mRNA            <536624..>537220
FT                   /db_xref="GI:66362855"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2200"
FT                   /db_xref="GeneID:3371896"
FT                   /locus_tag="cgd7_2200"
FT                   /transcript_id="XM_628392.1"
FT                   /product="hypothetical protein, signal peptide"
FT   CDS_pept        536624..537220
FT                   /locus_tag="cgd7_2200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide"
FT                   /db_xref="GI:66362856"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2200"
FT                   /db_xref="GeneID:3371896"
FT                   /translation="MRSILFYFILLFYPISTSLGKESELFWKVKTNLILTTDARFEGAQ
FT                   LCTSLEDELMENAEGSDIKYEENNALDYNLNSNNMIELVVTNSKEEEVTLFVTDAVYNL
FT                   IYKKKDLRKNPSIFHRPKFSESTDEYQNNNVSQEVEPTGRIVYIKKYYSPDGANKHLPV
FT                   IQKFNYSNIQFSINSSSVSVSAMNTFNFTNGSGNE"
FT                   /protein_id="XP_628394.1"
FT   gene            complement(<537861..>538610)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2210"
FT                   /db_xref="GeneID:3371897"
FT                   /locus_tag="cgd7_2210"
FT   mRNA            complement(<537861..>538610)
FT                   /db_xref="GI:66362857"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2210"
FT                   /db_xref="GeneID:3371897"
FT                   /locus_tag="cgd7_2210"
FT                   /transcript_id="XM_628393.1"
FT                   /product="kinesin-like protein"
FT   CDS_pept        complement(537861..538610)
FT                   /locus_tag="cgd7_2210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin-like protein"
FT                   /note="domain similar to KOG0246"
FT                   /db_xref="GI:66362858"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2210"
FT                   /db_xref="GeneID:3371897"
FT                   /translation="MITFSPNKYISPKAIKEALNSNENENMNLDLKQRLEFIEEMLKKE
FT                   DAPLPGDSQLFNIHLSRQLFPQLKFEDIPDIKGVPVEELIILSSSGILPNMGDFEYTLN
FT                   SIRNELIEAERIKGSFEDPLDSRLARRHVLIKELPPISANDDELVEWEMEQREKMLREE
FT                   YDEHNRRKFKLQLLPLDRSSDVPNLKLKSPDKKIGKIEVSDEEVQKLRNYEKSMYPEFI
FT                   KKTDKLAREVSSLFQNNIFYSIILILG"
FT                   /protein_id="XP_628395.1"
FT   gene            complement(<538848..>539177)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2220"
FT                   /db_xref="GeneID:3372199"
FT                   /locus_tag="cgd7_2220"
FT   mRNA            complement(<538848..>539177)
FT                   /db_xref="GI:66362859"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2220"
FT                   /db_xref="GeneID:3372199"
FT                   /locus_tag="cgd7_2220"
FT                   /transcript_id="XM_628394.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(538848..539177)
FT                   /locus_tag="cgd7_2220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362860"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2220"
FT                   /db_xref="GeneID:3372199"
FT                   /translation="MFETAGSPFRNVRKGVNDPLNDEDMAVLDMPLGYTPDGIRDIVEE
FT                   YFWGDFPIFDYERDRVNPPDYLAHFFELDSNTKNIRSILPLHRSNILEPEVSMISLLFF
FT                   KTNTF"
FT                   /protein_id="XP_628396.1"
FT   gene            <540567..>543071
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2230"
FT                   /db_xref="GeneID:3371802"
FT                   /locus_tag="cgd7_2230"
FT   mRNA            <540567..>543071
FT                   /db_xref="GI:66362861"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2230"
FT                   /db_xref="GeneID:3371802"
FT                   /locus_tag="cgd7_2230"
FT                   /transcript_id="XM_628395.1"
FT                   /product="coiled coil protein"
FT   CDS_pept        <540567..543071
FT                   /locus_tag="cgd7_2230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coiled coil protein"
FT                   /db_xref="GI:66362862"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2230"
FT                   /db_xref="GeneID:3371802"
FT                   /translation="CFEHFFEMEEKLDLKSKYEKLRKKYAQLKQQTVALKESLETKESE
FT                   YKCLKVSFEELENTHKECISRLDASQYKETQLKREIEEIVCQLEQFKSHGNTKQDQPVC
FT                   PNGKTGQGILTGLLPMNGVIMNFQKNEKLEEKVKVLQEELDLKILENEQLHIKEFDLKR
FT                   QHQKAIEEHLADNEKLKNEIENLNLEINELKLKRGNEDGIIDEIKQLKEKDKVNSQKIN
FT                   ELLENNCQNENTINIKLNIMRKFIPRVNLLQLEEEHSSWANICKQKNCFAFLKLESLVS
FT                   EFLKKILIVVENWSNYINCYISKPSLQDKITERIYKQILILLKEGNKDLTDLSGVIFQN
FT                   GFILEQNISESALSCMNDRDQFNSIEIKDILVERSISAMMSIKNALSLQIIAFKMEFHK
FT                   LSGSKLAFEFQNENKKAIERLFIIIRNLRKYLPKLNCLFNFALNLGRKPDLIYSHTLRT
FT                   NSFYVAFIELRREIKNQFDNICVEVEEKKQFFDFVKRILIEDVTLQDENISLSESFINS
FT                   HKKIIELESMRKILHSKINFKIKNIIELISTELNDACRIFESLFFSDNIAHPFFSETSK
FT                   DIKSSFFDSIVDLFCLLNCNKELFMRLVSSLYQHPSITCQSSNNLSELQINMRETKSKL
FT                   EAAPPKITLPELHILNKRIEQLEESKNEHLKTINNLMNQLNTVNESSNLNDHKSDFKND
FT                   LTSTEIIPVNSSSEPSKISELKKQKCGNQPQKYIHEVFESQLREANETLENTVTRLQHR
FT                   INDLNDDIEVTRQSYDEQISLLSQHICSLSEKLALTDASTLSSFNQEILCYSCESWSTL
FT                   DLILNKTKGACQKCKTKLLRLK"
FT                   /protein_id="XP_628397.1"
FT   gene            complement(<543347..>544981)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2240"
FT                   /db_xref="GeneID:3372203"
FT                   /locus_tag="cgd7_2240"
FT   mRNA            complement(<543347..>544981)
FT                   /db_xref="GI:66362863"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2240"
FT                   /db_xref="GeneID:3372203"
FT                   /locus_tag="cgd7_2240"
FT                   /transcript_id="XM_628396.1"
FT                   /product="hypothetical protein, signal peptide, possible
FT                   secreted protein"
FT   CDS_pept        complement(543347..544981)
FT                   /locus_tag="cgd7_2240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide, possible
FT                   secreted protein"
FT                   /db_xref="GI:66362864"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2240"
FT                   /db_xref="GeneID:3372203"
FT                   /translation="MRYNSKLRFLTPFIGLVLLLNFAHGNPKTSSSNQLSNETNVGCKE
FT                   NFKQKLSEILNRGKKPDNHGKNPFDTFFGMLLNAEDLKYFDPENPASENNSSIPVTSTP
FT                   SPKAKREAVSDVNASNLRKPCKPEQSKSQMFDWGTHTKVSHSLARDKLTPRDSQNQITQ
FT                   TFLDFFSVIKKGGNEISKKKSYGPTFKEIVVPSLIKGVNNSELEGATRGILINELLVET
FT                   EMGKATIPKNRPDGLPSISFIGIENEVMPLHVIYIKEDDRFSFKTFPNFVPPDIPKIAG
FT                   QRLKEWVILKYKQIHDFLMAKSREDLDSKSLLKSLNNYGIYFAIEFKDDAVCYLSEVTR
FT                   SNSNLIKNSNSNDKTLVSRVSRILFSRLRPFISFQSTFIPLKMSEFRSLSFIGSPVLMN
FT                   RADNEDDLLTQQALFYWSIEAEKFLNDYKRKDHVCNEREIFSNSEYKQHCMISPHGKNP
FT                   RNPNSYNNGFITTVSCFGLHPEGTIVLFSYKSLFSLRVCQKDGSWSDIKVLSDQNRATV
FT                   IFHKCHSRNNNKESFYSRVSTASFFED"
FT                   /protein_id="XP_628398.1"
FT   gene            <545804..>546469
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2250"
FT                   /db_xref="GeneID:3372201"
FT                   /locus_tag="cgd7_2250"
FT   mRNA            <545804..>546469
FT                   /db_xref="GI:66362865"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2250"
FT                   /db_xref="GeneID:3372201"
FT                   /locus_tag="cgd7_2250"
FT                   /transcript_id="XM_628397.1"
FT                   /product="40S ribosomal protein S3, KH domain"
FT   CDS_pept        545804..546469
FT                   /locus_tag="cgd7_2250"
FT                   /gene_family="HOG000210611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S3, KH domain"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362866"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2250"
FT                   /db_xref="GeneID:3372201"
FT                   /translation="MAPQLISKKRKFINDGVFEAELNEFLSCTLAEDGYAGVEVRVTPI
FT                   KTEIIIRATRTREVLGVKGRRIRELTSLIQKRFNFPEGSVELFAERIENRGLCAMAQAE
FT                   SLRYKLLKGVAVRRACYGVLRHVMESGAKGCEVIVSGKLRAQRAKSMKFRDGYMIATGQ
FT                   PFRDFVDKAVRNVMMKQGVLGVQVKIMLPYDPEGKTGPSKPLPDAVMVREPKEYPINQ"
FT                   /protein_id="XP_628399.1"
FT   gene            <546710..>547708
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2260"
FT                   /db_xref="GeneID:3372200"
FT                   /locus_tag="cgd7_2260"
FT   mRNA            <546710..>547708
FT                   /db_xref="GI:66362867"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2260"
FT                   /db_xref="GeneID:3372200"
FT                   /locus_tag="cgd7_2260"
FT                   /transcript_id="XM_628398.1"
FT                   /product="uncharacterized conserved protein, signal
FT                   peptide"
FT   CDS_pept        546710..547708
FT                   /locus_tag="cgd7_2260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized conserved protein, signal
FT                   peptide"
FT                   /db_xref="GI:66362868"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2260"
FT                   /db_xref="GeneID:3372200"
FT                   /translation="MIGLQELCEIYWMELIAFWVLLIMVIVLLRGIRSNYEVAINWFKS
FT                   SQEFLESNFSRSALIKKSFWLDSWSQFDIFATGRKNCPFMYMNVICKPRQDLLTGILLQ
FT                   PLLRNYDKVYIEIPIEKMEPIMLLVCSKGELKSALIDYPEIEIHCSQKKINLSKNIVYA
FT                   NSNACVEYILTSGSFSKFISSQLAERLVNYIYISDQTTCPRLTNSYSKITSVLKACIRV
FT                   PSKDDIDFMSHNNLNLNYLFKNILSLCETLQTLELPEKTIQHINNNRLQIEKTFSKMNN
FT                   NGVNEKVEAKRREKIRSEAIKVSRMSPKEQKKYQEKKDKQQARSRIKLKKV"
FT                   /protein_id="XP_628400.1"
FT   gene            complement(<547836..>548954)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2270"
FT                   /db_xref="GeneID:3372202"
FT                   /locus_tag="cgd7_2270"
FT   mRNA            complement(<547836..>548954)
FT                   /db_xref="GI:66362869"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2270"
FT                   /db_xref="GeneID:3372202"
FT                   /locus_tag="cgd7_2270"
FT                   /transcript_id="XM_628399.1"
FT                   /product="hypothetical low complexity protein"
FT   CDS_pept        complement(547836..548954)
FT                   /locus_tag="cgd7_2270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical low complexity protein"
FT                   /db_xref="GI:66362870"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2270"
FT                   /db_xref="GeneID:3372202"
FT                   /translation="MFIIERALSIFTLIYEMEAKVGLDESRIPKIGLESSVSSLNSVLD
FT                   SSNKRTPSYFNTGFIPNQLVLNASLLNELRQEPCGNKSISQINGDKPKKYDGKSETSNN
FT                   NKYSRKNSESKNLASSSSKSQDNSRNVESEAASIIEKGQIQSVPNLELSKIASPNVSNA
FT                   QTRQQNYVSSNSSSFNNKSQSNYKSNFQEVKTSSKDKNIPASSPRFVRVNTNLVESSIN
FT                   SYRVQNTAKSGAFPATSPQSRVYNNTNVQGTSWRTVWPNSNLMSNGGIGDALASPVSAK
FT                   SINKFSPSSPQQMFSPTSYSQISSSAKYTVTPNPSVVRYIEQKSAEGLASPIGFSPLAS
FT                   PTYRKNVQQSRSNNNTTLPNSNLNNLTFSYKG"
FT                   /protein_id="XP_628401.1"
FT   gene            complement(<549624..>550022)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2280"
FT                   /db_xref="GeneID:3371966"
FT                   /locus_tag="cgd7_2280"
FT   mRNA            complement(<549624..>550022)
FT                   /db_xref="GI:66362871"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2280"
FT                   /db_xref="GeneID:3371966"
FT                   /locus_tag="cgd7_2280"
FT                   /transcript_id="XM_628400.1"
FT                   /product="60S ribosomal protein L40"
FT   CDS_pept        complement(549624..>550022)
FT                   /locus_tag="cgd7_2280"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L40"
FT                   /db_xref="GI:66362872"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2280"
FT                   /db_xref="GeneID:3371966"
FT                   /translation="DAKKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
FT                   RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGVIEPSLANLARQYNCEKMICRKCY
FT                   ARLPPRATNCRKRKCGRTSQIRPKKKLK"
FT                   /protein_id="XP_628402.1"
FT   gene            <551072..>551542
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2290"
FT                   /db_xref="GeneID:3371827"
FT                   /locus_tag="cgd7_2290"
FT   mRNA            <551072..>551542
FT                   /db_xref="GI:126653136"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2290"
FT                   /db_xref="GeneID:3371827"
FT                   /locus_tag="cgd7_2290"
FT                   /transcript_id="XM_001388348.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        <551072..551542
FT                   /locus_tag="cgd7_2290"
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126653137"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2290"
FT                   /db_xref="GeneID:3371827"
FT                   /translation="YSFRPNVPSSLFFNYNNNLGPPFHILLDTNFINFSIQHKLDIFKG
FT                   TMDCLVAKCIPCITDCVIGELEKMGHRYNLALKLARDPRFKRLHCLHKGTYADDCIVQR
FT                   VTEHKCYIVGTNDTELKRRIRRIPGVPIMYVTNHKYSIERLPESLVSVPLKK"
FT                   /protein_id="XP_001388385.1"
FT   gene            <551759..>552259
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2300"
FT                   /db_xref="GeneID:3371967"
FT                   /locus_tag="cgd7_2300"
FT   mRNA            <551759..>552259
FT                   /db_xref="GI:66362873"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2300"
FT                   /db_xref="GeneID:3371967"
FT                   /locus_tag="cgd7_2300"
FT                   /transcript_id="XM_628401.1"
FT                   /product="translation initiation factor if-5A"
FT   CDS_pept        <551759..552259
FT                   /locus_tag="cgd7_2300"
FT                   /gene_family="HOG000106270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor if-5A"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362874"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2300"
FT                   /db_xref="GeneID:3371967"
FT                   /translation="LLLSLNMSEDEQQFDSVDAGASHCYPMAAGSIKKNGYCMLKGKPC
FT                   KVVDMSTSKTGKHGHAKAHIVGLDIFTNKKYEDVCPTSHNMAVPFVKRSEYQLIDIHDN
FT                   FTSLLTENGSTKDDLALPTDAEGNPDEVAIQIQQMYADGKAILVGVLAACGIEKIVSAK
FT                   ELA"
FT                   /protein_id="XP_628403.1"
FT   gene            complement(<552413..>554068)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2310"
FT                   /db_xref="GeneID:3372205"
FT                   /locus_tag="cgd7_2310"
FT   mRNA            complement(<552413..>554068)
FT                   /db_xref="GI:66362875"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2310"
FT                   /db_xref="GeneID:3372205"
FT                   /locus_tag="cgd7_2310"
FT                   /transcript_id="XM_628402.1"
FT                   /product="ORC/CDC6 like AAA ATpase"
FT   CDS_pept        complement(552413..554068)
FT                   /locus_tag="cgd7_2310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ORC/CDC6 like AAA ATpase"
FT                   /db_xref="GI:66362876"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2310"
FT                   /db_xref="GeneID:3372205"
FT                   /translation="MSTKKKRCRFHDDSGDEEASKNLGFEDDYMLDEFYTKKILKSLKS
FT                   EPPSNWEFLGRANEFKEISEYIRNCISCSISGIIYISGSPGTGKTCTINRILNILENDS
FT                   SKLGFVKPSSYKIVRTNASKVVSCFNKNSGLPNGISLFVHLLDLMKFQTRIIEEFKRIS
FT                   RNEGFQECIMYFMKQISNKRAKFIVFIDEIDLARSNRNHGDAVFELFKAIINFPNSGFV
FT                   LIVASNTVQIGNEIVKKIGVNLKNKGRIKLMVFSPYSHNTLKDIVLQRIERASNFKNDS
FT                   LLNKAGIELCVRKVASIYGDCRRTLDACYLTLGKFVFERQSQIQKEKTASDESEDGNSI
FT                   QMEDLSNVSTRESSPKYNRSPLDSQEVNNLHRLRTRSMPANMSVPIASFQNVIGRIHQT
FT                   NQGRLNLIKTLPLHQQYVIMGIILAIIDEQIQTKEGYNSLKTEKDEFLASKVTNSRASI
FT                   CHSKRKYQQICAELITPPEEYKDMLDALESNNVISVSNGTKVTKRSSSFHRGAIRANSN
FT                   KESKIELMFPAENVINALISLPKLGPIFSSLLPY"
FT                   /protein_id="XP_628404.1"
FT   gene            <554577..>555596
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2320"
FT                   /db_xref="GeneID:3372206"
FT                   /locus_tag="cgd7_2320"
FT   mRNA            <554577..>555596
FT                   /db_xref="GI:66362877"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2320"
FT                   /db_xref="GeneID:3372206"
FT                   /locus_tag="cgd7_2320"
FT                   /transcript_id="XM_628403.1"
FT                   /product="thioesterase of the a/b hydrolase superfamily,
FT                   possible bacterial origin"
FT   CDS_pept        554577..555596
FT                   /locus_tag="cgd7_2320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioesterase of the a/b hydrolase superfamily,
FT                   possible bacterial origin"
FT                   /db_xref="GI:66362878"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2320"
FT                   /db_xref="GeneID:3372206"
FT                   /translation="MSKSDFDKWFPSYSKVNSHLINLGSRNQPICRLLCIHGAGGSDQI
FT                   FVKKDLNTGRESSNILLDYAQENGIELLVLQLPGRAGRSHEACYEDIATLINDFYPVFK
FT                   SHFFGKANLTEYIELIPWVIVGHSMGGLIGFELLKRIKFEQLKDFSAKFGVTDQSGFEN
FT                   KIVKLLREKRIFPELFIIMSSFPPNIPEYDRPWRKNEELNDEEFKQECREWGINQNVFK
FT                   KGIWEEFEKQLRCDFTMFDSFEMNLVDKIFYCSNQSLYNFMYPLGVDAQLWSASQDSKV
FT                   TKDIMNKWKELLTSNGNSLDTREIDAQHNFLHDPKARKEWMQDLSTSLDKIILDLEYY"
FT                   /protein_id="XP_628405.1"
FT   gene            complement(<555755..>556390)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2330"
FT                   /db_xref="GeneID:3371968"
FT                   /locus_tag="cgd7_2330"
FT   mRNA            complement(<555755..>556390)
FT                   /db_xref="GI:66362879"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2330"
FT                   /db_xref="GeneID:3371968"
FT                   /locus_tag="cgd7_2330"
FT                   /transcript_id="XM_628404.1"
FT                   /product="SAR1-like small GTpase"
FT   CDS_pept        complement(555755..>556390)
FT                   /locus_tag="cgd7_2330"
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SAR1-like small GTpase"
FT                   /db_xref="GI:66362880"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2330"
FT                   /db_xref="GeneID:3371968"
FT                   /translation="LPITSRSCLCISDFKECTMFVFSWFRDILSWFGLSNKSAKILFLG
FT                   LDNAGKTTLLHMLKDDRIATHVPTLHPHSEELVIGKIKFKTFDLGGHETARRIWKDYFA
FT                   TVDAIVFLVDASDRSRFGETREELSNLLETPELQNVPFVILGNKIDIPMAASEDELRHS
FT                   LGLFEHLTYGRGEKRGDNGIRPVEVFMCSVVRRMGYSEAFRWLSQFLS"
FT                   /protein_id="XP_628406.1"
FT   gene            complement(<556724..>563395)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2340"
FT                   /db_xref="GeneID:3372207"
FT                   /locus_tag="cgd7_2340"
FT   mRNA            complement(<556724..>563395)
FT                   /db_xref="GI:66362881"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2340"
FT                   /db_xref="GeneID:3372207"
FT                   /locus_tag="cgd7_2340"
FT                   /transcript_id="XM_628405.1"
FT                   /product="large secreted protein, signal peptide"
FT   CDS_pept        complement(556724..563395)
FT                   /locus_tag="cgd7_2340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large secreted protein, signal peptide"
FT                   /db_xref="GI:66362882"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2340"
FT                   /db_xref="GeneID:3372207"
FT                   /translation="MHHKRFIYLLNLVYISSIFIVCLSLINSVDTTTLLKINANKTNKS
FT                   ATSHSQRTPRNRNRKVPREFRNGNKLHSVQNLRNNSSKRDNIPVKSRKDAPTFYGNIYL
FT                   RDNEYNDTLNSKYNKENIASRANRVDYYSFLGGRYNLMNALWSDKIEVFVPEKSKESKT
FT                   KYKWMNDKYLGSNEYTSFYPNNNYQQIYHLLNKAVSVSLPKKTRMDDEFQEFVISNIEK
FT                   SNRTQFFDNNLTELYQNNGSLKYSGFGNGESLKDEISKNKISQKLEVKNITLSNSDPVN
FT                   LIQEKDNLMPNMKWAQDVLSEIPSSIPENIVNFEYQHINEQETNELDGKEGTLLKEFVK
FT                   LAVDFSFLSGSSLNGAVCMFKAVLPLMKIRWKTLNLINTSKMDTIIKIMLGIPFFKYFE
FT                   EKESMISSCINMFFLMDIDSGEGLCLNKSGYEGSIMGVSVADFIVKQYHDNKIKLIKEK
FT                   ETKRESNELKPHDSANLLEMIYDDICNYFYECMDEDISDEVNEYLFQNSRIFGVMENQR
FT                   INFFKSNHTALFPDTSESKSSIDALPSDWFLAALQQLSQMNAELPELEFPGLNIRDLGR
FT                   LYFYSGRLGVQLPIRLTLKMIYELSVFANHSSLLRRAFCTESLMKIINFKIANVLCKVS
FT                   FSPIPLKFDPNELYISLKNILKMISFTPISWKKRPDPICSEAEIVAEKYPNAISPPNFI
FT                   QYYAVRDKWSLYRSLAIQLYGNLAVEDGETTLSIVSMLHSLIIGYIKLNWDEFRELYLN
FT                   IGIIDPERYYSLLLSKRRGPALIELIAFSRIYNFKVMVYKKIMRNSRREVHFELDEEIT
FT                   GIFEQSSNKYYHSDEIYHKTLSCKLVRLLVERELPPGFYQGVFKTNISDFNETIRENVK
FT                   DGSSWTWDAILPVYDSITNKKILSNEIGVQIKYKSIIKEHIDADYEIFDRKNEGNDTFP
FT                   LFKIIQDEAKYHVDTTNWRRPSNNSFGQILNSGSKKINQADTLNDQQSEFQNISKVNNS
FT                   IFQLDNEKTSFSEKYYQYNIVIQPLISFHQAGVYESKMFINKVFKFNPQINWEDLPRRL
FT                   DLEYLQSIIYVGDIYKEKKNLEIDTWKPDEQKNNIINIFPENKLNTETDQEDSEVLKQI
FT                   PKKENVTLTKNENKTISDGILMENSTLLNGYTNLDPETRTEIIKTRISEKEYGYPNIAL
FT                   ISHSKEEKDQDQAKSLNEFDSELEYIIIPTAKPWNNFVSLPKVGVMNSEPEFSFIPLKA
FT                   GPLLPNKAKENIVFKLDMEILFNMAREFWMIPLNISSRALYCFGKNIAPFLNNPNPIYI
FT                   PQMFIYDRIISTVISLLPVVDNSMNNIRPIEFVITVCEMALLDPIDLDPFLKISRTNIN
FT                   SSAEINDNIPNELKRIFGQMPAIKNICALVANCLHLSNYGNEYKNLVNKVSRAELFNKF
FT                   TPSSEQLILIQKLVPRFPEVVVIIRNLLRMIHFIGRKGISLDKDALYQIAKELSITFHS
FT                   ISPYLWKLQINLQELYEIVDKPTGGLRQARRMKKNYFAPIYEEAYWGQYDKELLLFTCA
FT                   SILTSRGALTLVTAIVVCHYSFLRIPLSNRILSTIPNAKDFENDEKLAAETIFFFLRDF
FT                   IRNPIEILKSKEYNEDPMGTFNKIYSKWQDQNNRELGIDEENIKKEMFGTKFNLFMFIT
FT                   YDKYIDLLLESGQELENAEIKFERKNQEIDRFSKFDLKSYSSKENLYINHRNGKKGFFK
FT                   EKTYHEEKFSSFWGYKPSPYKKDLRKSHMGSNIDDIFESLSLLLYSTNSYKELIKTTFT
FT                   SSLSLISKICELERDIIRNSKSNNAYIHVEGVDQEIVLFVFSICNKMKSSRERMRRNMQ
FT                   CARNPENCKPENIDQDDEMHHLEIFEVMQFIYKIPIMVFEMNQEQTIIRDTELNRRIYS
FT                   LNDTNKLLSSIRIAKIFDSDSKNFRYIPMIPKVTVCDFEDLKNGVGPIPIHAILKGMNS
FT                   MSKSTYNRESFKFRKRTAFDDATDNFFKRKQISVPFPCANYPKNLQSSTDLVPILRRYI
FT                   PYVPGDVEGKSLLQFIKISTAVIDLRRRPIKELPDRSMEKTFRSILLDDKDLNGSREYL
FT                   MKIYGLDVNEIIEKNYLFEKRLIDNKYDKTDLNMFYDDLYMNDKKNIYEYNQYKFLIEY
FT                   FNIVRHKRINPEVIHSFIDLEETRNRGKKQSRMLSIGERMNDMLKYAALSIFSEFYYYW
FT                   SKFKYNIRRFSYENPIKVEIIPSDEFKEEKLKKKQISLYIEDRLDEIKLNRNHE"
FT                   /protein_id="XP_628407.1"
FT   gene            complement(<564031..>564558)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2350"
FT                   /db_xref="GeneID:3372204"
FT                   /locus_tag="cgd7_2350"
FT   mRNA            complement(<564031..>564558)
FT                   /db_xref="GI:66362883"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2350"
FT                   /db_xref="GeneID:3372204"
FT                   /locus_tag="cgd7_2350"
FT                   /transcript_id="XM_628406.1"
FT                   /product="hypothetical small protein, possible signal
FT                   peptide"
FT   CDS_pept        complement(564031..564558)
FT                   /locus_tag="cgd7_2350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical small protein, possible signal
FT                   peptide"
FT                   /db_xref="GI:66362884"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2350"
FT                   /db_xref="GeneID:3372204"
FT                   /translation="MSFFALFISIYLFAFLYGNVPWMELSTWKSYPYKEYSLPKMILKS
FT                   KSSSSLNEVVLSSPFLNGTFTKVGHKRYDYPIYELNQVGNGCKHYINYDVTIPPGKLHT
FT                   FLKDFICYSYLGGWIIYSSCQKSYENPLGYNSIRAIGYPAYGKFRNVSIPVDVKDWYHA
FT                   IHNHIRVPIKVT"
FT                   /protein_id="XP_628408.1"
FT   gene            <565132..>566529
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2360"
FT                   /db_xref="GeneID:3372208"
FT                   /locus_tag="cgd7_2360"
FT   mRNA            <565132..>566529
FT                   /db_xref="GI:66362885"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2360"
FT                   /db_xref="GeneID:3372208"
FT                   /locus_tag="cgd7_2360"
FT                   /transcript_id="XM_628407.1"
FT                   /product="eukaryotic membrane protein with transmembrane
FT                   domains near C- and N- regions"
FT   CDS_pept        565132..566529
FT                   /locus_tag="cgd7_2360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic membrane protein with transmembrane
FT                   domains near C- and N- regions"
FT                   /db_xref="GI:66362886"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2360"
FT                   /db_xref="GeneID:3372208"
FT                   /translation="MEQIKDEIFFKKDECWKESEKKFLENEWRNSKGSLESIVSSNSPN
FT                   NSAFTVRSKLSQDSHSDEYSVMIDDDAPVDEEIYFQFSDISIINRVFCDISSVKYTTYS
FT                   EIKHIFYFLSFFFFILSIFLFERSWNGVTKVKVYYDNFGNFPLLFKNNEYSSNLSEIEY
FT                   ENISENSKLYEFTVDRTLQEPIFVFYGINGFFSNTKEFVGSKPPEIFGYGYKCTHILSI
FT                   DDILRYRPDFRIHLAEFFRVPINFNFTQIDSIFSNNKKSRIFKMSKKNNSINRNILCGL
FT                   PIYSLFTDEFELTKKGSSKEKIQIRAIDFPEDQWKYKMLHSFRQFISGAINSKFLNQSH
FT                   RYEKKSNDKIPKLSMMLSRWWSQSISPNFIKPYGIISSSYEYSSMEDMILYPGSYELHF
FT                   ISNLFPNNAWGAEKYVLFMNLSVFGGEQYLAAVICLFIAIVYALIIYFNPKRAQIIIIK
FT                   NRIDQNI"
FT                   /protein_id="XP_628409.1"
FT   gene            <566817..>567674
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2370"
FT                   /db_xref="GeneID:3372209"
FT                   /locus_tag="cgd7_2370"
FT   mRNA            <566817..>567674
FT                   /db_xref="GI:66362887"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2370"
FT                   /db_xref="GeneID:3372209"
FT                   /locus_tag="cgd7_2370"
FT                   /transcript_id="XM_628408.1"
FT                   /product="EB1 like microtubule binding protein"
FT   CDS_pept        566817..567674
FT                   /locus_tag="cgd7_2370"
FT                   /gene_family="HOG000198048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="EB1 like microtubule binding protein"
FT                   /db_xref="GI:66362888"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2370"
FT                   /db_xref="GeneID:3372209"
FT                   /translation="MTSTYDSIGGMGMMDKCYFTGKSDLLNWLNSYFNLNVSRIEDCAS
FT                   GAIYCQIADAVYYYQVPMKNVNWGVKHDFQYLHNYKLLQQVFGKVNQPKYIDINKLIKG
FT                   KYQDNLEFLQWMKGLFDESGAIDRDYDAIGRRSLGKGPFPQYSGQVIPIASIQNTSADS
FT                   SLNTAINNSNLAPNSKNSNTKNMLPSKNTEIEKLKKSLRKEIEEKEIVDKERMFYFNKL
FT                   RAIEILYEELNEKKIPFMSLKDISEILYDSNDIDLESFSRKIIDSATINSNGLTSTTSG
FT                   VEEQ"
FT                   /protein_id="XP_628410.1"
FT   gene            complement(<567743..>569041)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2380"
FT                   /db_xref="GeneID:3371969"
FT                   /locus_tag="cgd7_2380"
FT   mRNA            complement(<567743..>569041)
FT                   /db_xref="GI:66362889"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2380"
FT                   /db_xref="GeneID:3371969"
FT                   /locus_tag="cgd7_2380"
FT                   /transcript_id="XM_628409.1"
FT                   /product="RRP45-like archaeo-eukaryotic exosomal rnase, PH
FT                   domain"
FT   CDS_pept        complement(567743..>569041)
FT                   /locus_tag="cgd7_2380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RRP45-like archaeo-eukaryotic exosomal rnase, PH
FT                   domain"
FT                   /db_xref="GI:66362890"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2380"
FT                   /db_xref="GeneID:3371969"
FT                   /translation="RLWPIFYKIDNNCKCKKLFIKSIKMDTFIVSVREYGLRLDGRTMN
FT                   EYRNVKINLNKNYGEVEVNIGRTHVLSVVKSELVAPSQERSSEGFISFTVDIGPLSINP
FT                   TSHAFRHNRTTLGTEIANYIERILKETGAIDTEILCILSGVCVWSVKCEIHVLFDDGNL
FT                   FDACLMATLSGLKHYRYNEIDVDSFLKKSKCEGFGERDYQRLENTIRKLEMIPFNVHHF
FT                   PLSISIGYINGKEGLSYIVDPNSDEESISDTIIHISINDKQEVCGISKFGGAKLSLNQI
FT                   NFAIQIATIHSEKLHQEFKKAFDGEYLKRLKCSDNKGKIVIDQFNTNSKRTETEFDANP
FT                   PLIMQILSNNEPDKSDNEVSSSIAFSSPSNMEIKNAEFDEYETQHESKLEKASFSDRIC
FT                   ESLEQVQLDQSVEPIELLNAVKSNIKIKKRKKG"
FT                   /protein_id="XP_628411.1"
FT   gene            <569088..>570623
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2390"
FT                   /db_xref="GeneID:3372210"
FT                   /locus_tag="cgd7_2390"
FT   mRNA            <569088..>570623
FT                   /db_xref="GI:66362891"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2390"
FT                   /db_xref="GeneID:3372210"
FT                   /locus_tag="cgd7_2390"
FT                   /transcript_id="XM_628410.1"
FT                   /product="tyrosyl-DNA phodphodiesterase 1 (tdp1)"
FT   CDS_pept        569088..570623
FT                   /locus_tag="cgd7_2390"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tyrosyl-DNA phodphodiesterase 1 (tdp1)"
FT                   /db_xref="GI:66362892"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2390"
FT                   /db_xref="GeneID:3372210"
FT                   /translation="MAANEKFDVLRSPHFKKPKFGYDVIEISSDSSIESKLGDISSNNY
FT                   LKLETPIYLNKLNFEKKNLKNLSFKSLFVVNDCTPIEKSVWRIKHILFSSYLADVNWVI
FT                   NEIGDSELICENIESILFVSHGFDNPQNYKLKNFNKVKNKKISTYSPYLKVPYGVFHPK
FT                   FILLVFEHLVQPKKNFVRFVVTSANLIQQDWELKIQSIWVQDFFHSIERKDCEFLDYLQ
FT                   EFLKNILNGSKLKDFWLSKVQEFNFEDATVKLVASVPGYFFGDEMFMWGHLRVRSLIKR
FT                   FVSKDQDKSDELREKRERIVLQFSSLGRISEKWLYTELASSLSEIPGTELEIIFPTVEQ
FT                   VVNSIEGINGGGSLPVKKEYICKPWIKKLLHKWGTGTMKKNATDEKVIPHIKTFLKYKI
FT                   FGNAIKIIWLVQGSYNLSNAAWGQIQKDGSQFCIRNYELGIFIHKDQFEFERYFKLNEE
FT                   FPKFFWKRKSNCSLISEINANQPNVLLNFPLPFKLPPKRYSNSDHPWNIELLM"
FT                   /protein_id="XP_628412.1"
FT   gene            <571428..>571793
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2400"
FT                   /db_xref="GeneID:3371970"
FT                   /locus_tag="cgd7_2400"
FT   mRNA            <571428..>571793
FT                   /db_xref="GI:66362893"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2400"
FT                   /db_xref="GeneID:3371970"
FT                   /locus_tag="cgd7_2400"
FT                   /transcript_id="XM_628411.1"
FT                   /product="chaperonin 10 Kd subunit, putative"
FT   CDS_pept        <571428..571793
FT                   /locus_tag="cgd7_2400"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperonin 10 Kd subunit, putative"
FT                   /db_xref="GI:66362894"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2400"
FT                   /db_xref="GeneID:3371970"
FT                   /translation="QVNKLLRTFRPIFDRVLVQRIHPKAVTKSGILLPESINKGGKGFF
FT                   MAKVLSTGTGKINQFTGEYNKCLLKPGDTVIVPEYGGIHIQQFYEEVNHGTSLDLMVYK
FT                   EEDILGIFENDSKNNVN"
FT                   /protein_id="XP_628413.1"
FT   gene            complement(<571834..>573072)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2410"
FT                   /db_xref="GeneID:3372211"
FT                   /locus_tag="cgd7_2410"
FT   mRNA            complement(<571834..>573072)
FT                   /db_xref="GI:66362895"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2410"
FT                   /db_xref="GeneID:3372211"
FT                   /locus_tag="cgd7_2410"
FT                   /transcript_id="XM_628412.1"
FT                   /product="signal peptide, secreted low complexity protein"
FT   CDS_pept        complement(571834..573072)
FT                   /locus_tag="cgd7_2410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal peptide, secreted low complexity protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362896"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2410"
FT                   /db_xref="GeneID:3372211"
FT                   /translation="MKTLYLFHLRSIYILVLYQLILFNILNSSSQTLNKVTKSNENTEV
FT                   LPTFDGCKNVLICERVDTRLFFNLELGICEKCKDRLLDVECSSIPTINNAYQLLSFTNG
FT                   FDKEFHGANGYNKIVSMIERGATNESSILLSGKFVNLSGVEYCALDENNQIELFQEIYL
FT                   IYNQNKNIENLTLDIKLINPFQAAENKTLEIISNWEINNKKSNHAMYAYKKIKEKMFDK
FT                   KSESNSDINSQIFNNIFPSINVIFNSTNEQIFDNVKPCIRISCLKQKKKGSNNKIGEKN
FT                   KVAVYDIVTSVNLLKSKVKSENDYLFYVNVLIKTLLKSLERKTKRKKISIGCTTKIISW
FT                   VKELCEILGIQTDENSNMGRYISEFLKNTKKEPNFSKKTINVTNIVESKQNIGFIEAEL
FT                   EDYKKLEEELKEF"
FT                   /protein_id="XP_628414.1"
FT   gene            complement(<573460..>573807)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2420"
FT                   /db_xref="GeneID:3372212"
FT                   /locus_tag="cgd7_2420"
FT   mRNA            complement(<573460..>573807)
FT                   /db_xref="GI:66362897"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2420"
FT                   /db_xref="GeneID:3372212"
FT                   /locus_tag="cgd7_2420"
FT                   /transcript_id="XM_628413.1"
FT                   /product="60S ribosomal protein L22"
FT   CDS_pept        complement(573460..573807)
FT                   /locus_tag="cgd7_2420"
FT                   /gene_family="HOG000198396" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L22"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362898"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2420"
FT                   /db_xref="GeneID:3372212"
FT                   /translation="MAPITKAHKTQRFIVDCTAPMQDNIIDASGLEKFFHDRIKVDGKC
FT                   GQLGTKIQISRQKGRITVLSEVPMSKRYLKYLTKKYLKKQQIRDFLRVVATSKGSYEVR
FT                   YFNISNEAGEE"
FT                   /protein_id="XP_628415.1"
FT   gene            <574430..>575812
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2430"
FT                   /db_xref="GeneID:3372213"
FT                   /locus_tag="cgd7_2430"
FT   mRNA            <574430..>575812
FT                   /db_xref="GI:66362899"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2430"
FT                   /db_xref="GeneID:3372213"
FT                   /locus_tag="cgd7_2430"
FT                   /transcript_id="XM_628414.1"
FT                   /product="translation initiation factor eIF-5; Tif5p,
FT                   ZnR+W2 domains"
FT   CDS_pept        574430..575812
FT                   /locus_tag="cgd7_2430"
FT                   /gene_family="HOG000281172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor eIF-5; Tif5p,
FT                   ZnR+W2 domains"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362900"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2430"
FT                   /db_xref="GeneID:3372213"
FT                   /translation="MLNIPSTVDDPNYRYKMPKLVSKIEGRGNGIRTKIVNMADIARSL
FT                   KRPPAYPTKFFGCELGALSKWEDKEEKSIVNGAHQQNDLQRLMDKFIQMYVLCPNCELP
FT                   EIDIIVKKERVSCKCNACGYIGALDNNHKITTYISKNPPGGVESTMGSKNKKERRERDK
FT                   DRSSEGCNNSNGSTAADNEKPSKHKSKKASKKSSKKSPHELDIFEKDVLTFESPEIVDV
FT                   IERLTNFMQKNEEVSPEDFFSELRVLQVSQDFDEFMRFSVLLAVLFGLKDPIDPKVFKL
FT                   RIPYISKAVEGSLRSNAIISIFESYCVEKNPSTLATYPYLIQQLYDADILSEKVILKYY
FT                   QKDAPTSWVSGCSTQDTFEKAKKSCEPFVDWLLDGSNDESDLSDENNDDYDTNNSDIDE
FT                   DDSHSPVRSSRVKVKSLNLSEKLDSYKFESCSGSEDDGSLTKNVENSQSQNSDSDLDID
FT                   NI"
FT                   /protein_id="XP_628416.1"
FT   gene            <576103..>581472
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2440"
FT                   /db_xref="GeneID:3372214"
FT                   /locus_tag="cgd7_2440"
FT   mRNA            <576103..>581472
FT                   /db_xref="GI:66362901"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2440"
FT                   /db_xref="GeneID:3372214"
FT                   /locus_tag="cgd7_2440"
FT                   /transcript_id="XM_628415.1"
FT                   /product="giant membrane protein"
FT   CDS_pept        576103..581472
FT                   /locus_tag="cgd7_2440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="giant membrane protein"
FT                   /db_xref="GI:66362902"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2440"
FT                   /db_xref="GeneID:3372214"
FT                   /translation="MSSNEVEDNQNRNKENDSFCILSREYLPKERCLMETWNNEIRIRI
FT                   QYEFTNHLPVLFLSENSELVKRSQSCLQKIVFELLTSVLFYLDIPYITAIEFLENCSIV
FT                   SYLKICKILGYDFIGKDELDIQEVPTESLKDEFNVFISDPSKAIDINLPSFSSFVEDHI
FT                   TPLIMDAVWLIQMSVHSNESNKNSIWIEFMSRLCRGNITSRERPLPSIPKSVKLISIKD
FT                   IVSYLDLGKSDNMKITESLISSKFKLQQKYVRDRTRLCFTVDSFTTQRECLNGFSILGV
FT                   LIKYLFDQINFFSDLNIDEPTSQIIYERDYSNNPKGTNYVNEYSENINDKNNSHTNLNL
FT                   SNYLMKSIWNIILRYDLSIQRSVGLIFEVFISIISGFIDTKNNLNDLDTRLFVLLDKLL
FT                   AIFPEKIVRKSFIIFIEHISNICSSNKGPKDSDSLNTENIGNYAYRTNPWIITDKKGFK
FT                   DILDLPFFVLTSFLIKKGFFELSDYFREKLVEWDDIFWSDFKVDKYSLKNTDNFSNLFD
FT                   AQGFFFPPKTLENINSIYKYYHLYFNSQLSKIEESEKDFNLELLLREILRNERFNDEIN
FT                   FSNISIILSELILTPSILFANAFFADYFLEEICVDEDEIYFVSKISKNSEIIQEITDFT
FT                   GMPFSIINLSSNILKKKIELIINDIESKVKDSEKSSNLILQYKRFYSLTEWISKYCKYH
FT                   LFQKHPSCIPIFLELHLVFVKEFNNGKLSELFESQELSSINGYKCPSELLFEVSSCIIF
FT                   PAISLLPKSPSIPEMLKNSIFGEIDIKYRYQIYRRLMVFSYNRYPMNYQWVSVKKILSK
FT                   YLKGVTKDIINNKNDNKHSNSIKRRPPVQIRLLISNIIGLSYTNPLAVCDTIINQCNNY
FT                   DNMIPLLIEILGNNIDEICFDVMIFTIINFILSRPTYMIDCRSSNSDLNCSRFGNRGIA
FT                   KFVALLLTKRKVPREILKNFLQTITYRIDETFYGNEYSVKIPNNFLDICFWKQLLEIVL
FT                   SAPILDLSVLTGKQIQSLAGGPLLFQLFLSQHEEDNFGAMNEHSFFNSLLDNNSYAKQN
FT                   CDLFISILKNGEIQSKEVLFRIAKLRSEILWDVPSNLNMDIKLLINLSDELHWCCIQTI
FT                   ELLKRSFDPESYRNFILNISNSRYSFEEIVTQTFLYLDIPTAWSFLRNGIRKSNIIQVD
FT                   REILVQEDGLLDIDHEAIKCIKTYILKKSEMTFLNNEVFMDFYILFWYLDLSDISLPYQ
FT                   HYSEKLFDLYSEILYYKENIDRILAQNIVDHKTDTFIEKCKIEFFLNPNNIKLLPSYTK
FT                   NKNHLTRQVRDAIKPFEKRLRKLYSCYNALASEYIKLSKRSDFISQFLDSDHGINRFKD
FT                   ELNESLKCHDFSEHEKKIQSFMIWICKDFIAPRVIHSETDALFTYFWIERFVLDEERGI
FT                   FSSNKYLIESFLILTTKHISSLIRSSTPRESQLLGLFFKEIFAYIKRFISKFRSGINAD
FT                   NNQKGETTFKVSPNNIPVTDLDRLEFETDTNGKNLNNILDNKDSLIDGTKCSESIENKD
FT                   SDCSKLFEKKSLENFDQKMSLINESSQEIKLDSSIYEPSKLDVLAEKNESNNGLEYIEI
FT                   FKGKSCNEIESLTQRTTDSILNNFLYECERNIMISLSLGLGLLSERSPEDLPEWAHTLS
FT                   SVWMLSRFYESFPISAITGEYLLKELPNILEYATKRHWNDLNLSITSLILKLKQCSPNW
FT                   IRKRDLKDKNSKQNESALTLKVAIESTKKNNSSSSNLYPVTPSSKNQDEKINNNSSRSE
FT                   FKRQRLNVDEYCLNKTSHSNSANSIRREEYRKK"
FT                   /protein_id="XP_628417.1"
FT   gene            complement(<581505..>582869)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2450"
FT                   /db_xref="GeneID:3372215"
FT                   /locus_tag="cgd7_2450"
FT   mRNA            complement(<581505..>582869)
FT                   /db_xref="GI:66362903"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2450"
FT                   /db_xref="GeneID:3372215"
FT                   /locus_tag="cgd7_2450"
FT                   /transcript_id="XM_628416.1"
FT                   /product="possible membrane associated transporter"
FT   CDS_pept        complement(581505..582869)
FT                   /locus_tag="cgd7_2450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible membrane associated transporter"
FT                   /note="with 12 transmembrane domains"
FT                   /db_xref="GI:66362904"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2450"
FT                   /db_xref="GeneID:3372215"
FT                   /translation="MNFRLLIRDLLNKDKTFWSPLIGCALIHWSLGFANTFGNTVPYIA
FT                   SYISLKGKHKLRAGMICWIECFFVLFQGGANYLYPSIELIIGIPSCLAIGFFFCNFGLL
FT                   ISYLFLENYFLYLFGYSILYAIGNGLLFASTIEFLASNYSKNSRSKIIGVLWLFRGASM
FT                   SIIPSFQSSFVNPINSNNYYVYSGNKFFNSLIVLEKVPKLLKLTFIFSAIFQITGIANL
FT                   AITGRKYPRIKEKQEQYISDKRCHFANRIYTSEPFVLLWLITFLSWPCIEYIQLFWKVH
FT                   GMTNTGLGDLQLTRVSCIIMILQTLFRVFWGIFGQLAGYFNCICILSIILVTGIILLMF
FT                   PIIESISIFQYILGYLLVSIAHSGNLTIFPTTIVKHYCQSNQMELFIYLFSAKAASCIF
FT                   FCILTDFTTRFLNINYSLVPLLIFSLGSFFLSFILRDIKDNYILEKNSKKRYINI"
FT                   /protein_id="XP_628418.1"
FT   gene            <583173..>584312
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2460"
FT                   /db_xref="GeneID:3372216"
FT                   /locus_tag="cgd7_2460"
FT   mRNA            <583173..>584312
FT                   /db_xref="GI:66362905"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2460"
FT                   /db_xref="GeneID:3372216"
FT                   /locus_tag="cgd7_2460"
FT                   /transcript_id="XM_628417.1"
FT                   /product="TBC domain protein (small GTpase GAP), 3
FT                   transmembrane domains"
FT   CDS_pept        583173..584312
FT                   /locus_tag="cgd7_2460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TBC domain protein (small GTpase GAP), 3
FT                   transmembrane domains"
FT                   /db_xref="GI:66362906"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2460"
FT                   /db_xref="GeneID:3372216"
FT                   /translation="MNDSRRFVWCILLKISIEDINRKISISSLVQNADKTLINQVNCDV
FT                   DRCDLQSDIDKLNLKRLLISVFSYRRENYSYIQGIHEIGKVFLTLFHEYKKSNLANIKK
FT                   KLSKLIVFSERFEAIILCKLLIKKFNSEKGRADICFKAFDRFLMLYSTPYIYKSDSLAQ
FT                   INLEYILSNISRDLLYLLNKRSPILYNFFVKLKAKDDKESSVCIFILPWIITYFSHNIS
FT                   VKQKKLTYYIFDHIISSHPLYIVFLIVEIIIQSETKLFDYLEQNFGLDISLNFEENEIY
FT                   PFVHFFFQNLDISNLNWKVIVSCSHKYLSSTRLNILNSYFLWEAGKGSKHDLRIGTTLF
FT                   SKMNVKVLIYSIFLVLISSLLFSIYVGEFNFLKIIKKKN"
FT                   /protein_id="XP_628419.1"
FT   gene            <584407..>585105
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2470"
FT                   /db_xref="GeneID:3372217"
FT                   /locus_tag="cgd7_2470"
FT   mRNA            <584407..>585105
FT                   /db_xref="GI:66362907"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2470"
FT                   /db_xref="GeneID:3372217"
FT                   /locus_tag="cgd7_2470"
FT                   /transcript_id="XM_628418.1"
FT                   /product="14-3-3 domain containing protein"
FT   CDS_pept        584407..585105
FT                   /locus_tag="cgd7_2470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="14-3-3 domain containing protein"
FT                   /db_xref="GI:66362908"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2470"
FT                   /db_xref="GeneID:3372217"
FT                   /translation="MNLLFKEMDERLLQKYRAQVFEWGGCFDKMFEALKSLIYLSEFEN
FT                   SEFDDEERHLLTLCIKHKISDYRTMTSQVLQEQTKQLNNDELVKICSEYVFSLRKDIKA
FT                   FLQSFEDCVDRLVEKSFFSKFFKLKVKSDISRYKLEFGLCSLEDSKKIHQDAFTLLCEH
FT                   PDKIEQLPLGFIQNLAYILSEKYGEKKQVFNMLNSLGKILELQIKEQENMDRKAQITVY
FT                   LQGIKDYIEK"
FT                   /protein_id="XP_628420.1"
FT   gene            <585486..>586208
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2480"
FT                   /db_xref="GeneID:3371917"
FT                   /locus_tag="cgd7_2480"
FT   mRNA            <585486..>586208
FT                   /db_xref="GI:66362909"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2480"
FT                   /db_xref="GeneID:3371917"
FT                   /locus_tag="cgd7_2480"
FT                   /transcript_id="XM_628419.1"
FT                   /product="hypothetical membrane protein"
FT   CDS_pept        585486..586208
FT                   /locus_tag="cgd7_2480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical membrane protein"
FT                   /note="with 4 transmembrane domains"
FT                   /db_xref="GI:66362910"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2480"
FT                   /db_xref="GeneID:3371917"
FT                   /translation="MQQNKQTVGGIGHFHSSLKDVEAQSQISCAAYKQQWIAKVARVPP
FT                   RKVHTTNISRIKNRLFAFNQRSCALSIGTMVGNFKYICSWAKLLGLTISSFLFIWVLYC
FT                   FSIIKYLKGDQHIEYFYTNVLCLVISLISFTMLSTSLIIPNSTAINLNSMESSLLAGSG
FT                   VATRNLISCKTLSTLYLVISLLSIFTALLPQMESYHFTITMLSMILATHLAPSVLFYIA
FT                   YLRGEDGCIDDRSHHTLI"
FT                   /protein_id="XP_628421.1"
FT   gene            complement(<586983..>588143)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2490"
FT                   /db_xref="GeneID:3371918"
FT                   /locus_tag="cgd7_2490"
FT   mRNA            complement(<586983..>588143)
FT                   /db_xref="GI:66362911"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2490"
FT                   /db_xref="GeneID:3371918"
FT                   /locus_tag="cgd7_2490"
FT                   /transcript_id="XM_628420.1"
FT                   /product="cyclin'cyclin'"
FT   CDS_pept        complement(586983..588143)
FT                   /locus_tag="cgd7_2490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin'cyclin'"
FT                   /db_xref="GI:66362912"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2490"
FT                   /db_xref="GeneID:3371918"
FT                   /translation="MLLGAMTRLISNLTQFEGNEKNFSENISGEFEHKNDKIPILKSRL
FT                   SYSKNSGTILWKYWNKPSEASTRNNSNDELSLLVNQNELSESLTSKSSLFDSGNLDKEK
FT                   NSVGHSVVEIKRFNESNIKQELRSAISRKSANYGKDRNQLHENNNSMQFNYRSYPLSNS
FT                   QISSWMNNSWSEYETVEKDIKKCVIMEIDKINNKTEENKKIITPFHSLATPKISIGDYF
FT                   ISRIVKFVSLTPVDFCVMVILIRRAVEKSKGRLSVTSLTAHRLVLATALLTYKLMYDVQ
FT                   YGIKFWAHIGGVPQWEMLMLEYHILKILNWDLSINYHEFKKTYLEILSNKEVRKIMISS
FT                   KASSSKIDRTEYQNKADYSQVNSDGNKRTKLQLNVSKLSSNRKKCV"
FT                   /protein_id="XP_628422.1"
FT   gene            complement(<588401..>588986)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2500"
FT                   /db_xref="GeneID:3371828"
FT                   /locus_tag="cgd7_2500"
FT   mRNA            complement(join(<588401..588577,588621..588829,
FT                   588884..>588986))
FT                   /db_xref="GI:126653262"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2500"
FT                   /db_xref="GeneID:3371828"
FT                   /locus_tag="cgd7_2500"
FT                   /transcript_id="XM_001388349.1"
FT                   /product="Skp1 family protein, putative"
FT   CDS_pept        complement(join(588401..588577,588621..588829,
FT                   588884..588986))
FT                   /locus_tag="cgd7_2500"
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Skp1 family protein, putative"
FT                   /db_xref="GI:126653263"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2500"
FT                   /db_xref="GeneID:3371828"
FT                   /translation="MIFPKVRLLSSEGEEFAVDVRVATASTLVRNIIEADVGIDDPVPL
FT                   PNVRGDVLRKVLDYCEYHVDNPSKEIPKPLRSNSLSNIVCEWDEEFVNIQQEFLFELML
FT                   AANYLDIKPLLDLSCAKVATMIKGKKAEEIRQIFNIENDFTPEEESAIREENKWCDEP"
FT                   /protein_id="XP_001388386.1"
FT   gene            complement(<589175..>589909)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2510"
FT                   /db_xref="GeneID:3371919"
FT                   /locus_tag="cgd7_2510"
FT   mRNA            complement(<589175..>589909)
FT                   /db_xref="GI:66362913"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2510"
FT                   /db_xref="GeneID:3371919"
FT                   /locus_tag="cgd7_2510"
FT                   /transcript_id="XM_628421.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(589175..589909)
FT                   /locus_tag="cgd7_2510"
FT                   /gene_family="HOG000281003" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with 6 transmembrane domain"
FT                   /db_xref="GI:66362914"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2510"
FT                   /db_xref="GeneID:3371919"
FT                   /translation="MASSIMETFGSLNYEEAFSKRGIISTIVGILLGLVVSTTVNATLV
FT                   EISLSPFFSTYFGLLFVIIGGLIFWKVYVTIIPDEENALNKRTSLLTFAALIIFSGFIC
FT                   FILENDWFLGMTPIIRVPIYTILGLSISFAIAFSLVDAVNYISGFISSNDSPLLVNSKA
FT                   QIIFVICSSLFIGIIFGFLFGLVEDTHEQIHYVNISLMKQKHYCYTIGVIVGALCGFGN
FT                   EVIRLSDRSYMIVGKTVYDSDV"
FT                   /protein_id="XP_628423.1"
FT   gene            <591378..>591995
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2520"
FT                   /db_xref="GeneID:3371920"
FT                   /locus_tag="cgd7_2520"
FT   mRNA            <591378..>591995
FT                   /db_xref="GI:66362915"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2520"
FT                   /db_xref="GeneID:3371920"
FT                   /locus_tag="cgd7_2520"
FT                   /transcript_id="XM_628422.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        591378..591995
FT                   /locus_tag="cgd7_2520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical membrane protein with 3 transmembrane
FT                   domains"
FT                   /db_xref="GI:66362916"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2520"
FT                   /db_xref="GeneID:3371920"
FT                   /translation="MNRVKHRICCDILERELPLLFYKNALSFESRPTEKSSPVQLCYPD
FT                   LSMTLGFHPYNFNIYQLNTDAEDEDVFDRPSIIISTECKEFNNIREDVYRWGVLYLICT
FT                   VLLLVYILKIIMESQLNINHFIGIKINKTAFHIICFLLSFSPLLAVTEGCPFFMIVYKA
FT                   LFPSMLTIIFVYFLNEVWDILFVFLFSVARLSISAIQYKMVS"
FT                   /protein_id="XP_628424.1"
FT   gene            complement(<592278..>599441)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2530"
FT                   /db_xref="GeneID:3371921"
FT                   /locus_tag="cgd7_2530"
FT   mRNA            complement(<592278..>599441)
FT                   /db_xref="GI:66362917"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2530"
FT                   /db_xref="GeneID:3371921"
FT                   /locus_tag="cgd7_2530"
FT                   /transcript_id="XM_628423.1"
FT                   /product="large membrane protein with signal peptide and
FT                   transmembrane domain near carboxy terminus"
FT   CDS_pept        complement(592278..599441)
FT                   /locus_tag="cgd7_2530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large membrane protein with signal peptide and
FT                   transmembrane domain near carboxy terminus"
FT                   /db_xref="GI:66362918"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2530"
FT                   /db_xref="GeneID:3371921"
FT                   /translation="MAFPKKEYIVLFLIIFFYISSFLCVSSDSKNKIDPTLALLPWTFN
FT                   NKSNIDIRVSYGCHNWKFEDEFLRVNHSVVRIDEYGNNCTDVINVNPKWHHMRLKGVFT
FT                   VIASDIYTGENLRSEIHIAKVESIKISTSSKRIRLGSLENLYAIGFDSENNTFTSLNEL
FT                   RIVWELENDNIISEKNYGSQILVTGSKVGSVNVHVKIIEEHYALIGSSVTIYVEDPFKI
FT                   IPYIRRAPFGSLYPIHLVKEGTTDFTNFFRKEFHYCKIDRNIGPQAQILDGNKIIVENY
FT                   NNHDIEAESIISTTCMDRRVDGSFFTSLIYISFPKEIIFAVQDDISLLPPQNNFNFDEF
FT                   VQLYFIEGEQLAERSGFFVRTLQNNELTITENKVIFLQLKLLNYKREFLHVPINSRFRF
FT                   ICKKGCNSVNITPFQTEYNENNSTTGGFLKITGNSVGLSEFVVTLDSIGDTSYSKPNGE
FT                   GKLTEITSLLKINIVRDIDTLFSNLPLVLYPGEQRINIRENITGGKGPFFFCSSNPSIA
FT                   MIDFHTGLLKTGYNTGLLNVTIYDIGISQYYENKNKLSCESLKNVYGLNIPVLVSYING
FT                   FSLEMASLNGKLYKNTIYTSISQNSLTVEIKAEPIRVSNNLLGNQFEPSYYNLSFYKLD
FT                   TLDITKLYDPCEIVKVANLLDFQPNTKYTNDLSINDCLLILNNLGIVSYSQLTSNYDFN
FT                   IIIMNIDGQKINIELKKHGNLVFDNFIEFGIEFNYNSKTIRRKIIDIGLSIFIFQDIFF
FT                   VPILNEIVLSYFESSETASNNFYIEKSSQINLLIQGGLYDYQNKTNCLIEFNKFRLFLL
FT                   LDNEEREFFGTQKEINDHNSIRISKLDETNKFLLECNGELAVGFFKFTMAIFDEYQSEV
FT                   YRMESVLKVHCKSIDHINMFWVSRFPIMGKYTCNTRSDDCMIFHFNSNKIHRFISLAYD
FT                   KNNNLLLSFNRFKVKWEIENISEFSTHFLDENKLINQNIIDVSIHLGAEYYMKDVNIRF
FT                   EAFIHENFEENNLDDNLNRFSIITKGIFTRPPILISPQMLDMPAQFEDYHQFEDENEGI
FT                   NSIGSWNLLEGKHQFGIIYGTNNFNIFFDDKTAVKYSLCNDMMKEEDVFLIKNNSFNHF
FT                   HNRVHIFPFCLDSKQLLRGENETKKIDVYIEDQLILPKYIIKKKLVFSNLNKLHLVWLD
FT                   RFNLNMNKESELLPWSIYFTYNVSDQNIGFINDFKVPRKYISENIYEYINNVDYYKNID
FT                   NTLPCINENCLIDDNSRSILVVIMYNEQDMALEPWQSTEFKIEIDYKLKNISCKSELEF
FT                   SKQKKNSLNDFSIEIINLSSTIFQIMEIKKKNIDIELVAKVLDSNSSVNIYSNSLNLKV
FT                   YESIKLESNTDMFSLFPYGSPLHISFKGGPTKYKGLKLDWHIELEKKINSKAHKDILLI
FT                   RNNKKLVIEPLGEIGRERVLIKCFLTNENNTNIFKALIFSKLINVYVDIPDKISLFSPE
FT                   IEYLYLGYPKAYTIRTWNSNRNKTLNFHNSQYFPSEFSKCKVNWSISQNLNGFNNISKN
FT                   FVDNKCNPNSDLVCISRFIDFNYIDRFKMNNTFFEDHMHSNVSMHDYIALIHPINIGAS
FT                   YLNIRLSCSFGNKKNIELELTQKLSVIKAINSVENGIWIINDSLYYIILPKEVEVKSNN
FT                   KLDIEYANNSQQIYIDTWNSNKSVVIFNEENRFKLGSESLVTISPIIISEPKFTVVELS
FT                   KYGDYSIKLSLFFFNSMGIRLFPNPNYCLGINLYLIPVQNITQEFLIKKEDDNLYIDAI
FT                   FEESNLNANCQLLLYQNKETKSLKLIEEIKSWELTDSKNEFYENYRDSCFIIQIFSNTN
FT                   KFIGSQPFCVSLSSKASIKHSENNIFVNESNITNINFIDKITKYEFEVFGGSLLHLNPI
FT                   KWKALNSTPDKLNFCVVVNKLLEDIESLLKEEFSKILNIPLTLIIIIRGERIQSELSSY
FT                   LNISSNKQLLCVSIDKKINPFELWVVLMKYSSIISNDHGLIWVDVNRNDNNTLKYNTSE
FT                   YDVAPTWELLSSYDSVKVVENELLVIPMSNSIKYIKLRLSKLIEINLKVIPLNGQFSEN
FT                   DFIIVNKKYDKLHINTQFSFSIYFSDGDFINKFFNNIYYNSPISNINCEIYNPILKEIY
FT                   TTTPFWSLTILNSPFLLPSCNMAPRSSELSTKIKNGIVSNYYDQDSMYILPKINKTTFI
FT                   IQMQFKSSRKLKRFIPVHFHPILMEPLSSRLFSNKSTFTHGWLDDTHHIEIIVPLNPKD
FT                   YFEFPIQILFWFGYENTRLVAYKIKSQVLDEYMVNFTVNRFQGEIKIVNITRDTRASIA
FT                   DLNTILPFFILLEFNSNGQKHLINIIFKDRDNNKIESQGDTLSKYFIFSRPMKVNQHLC
FT                   SILISLAILSISVFYFLYKKKEVISRENNSSPFRKLNTQKW"
FT                   /protein_id="XP_628425.1"
FT   gene            <599728..>600090
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2540"
FT                   /db_xref="GeneID:3371922"
FT                   /locus_tag="cgd7_2540"
FT   mRNA            <599728..>600090
FT                   /db_xref="GI:66362919"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2540"
FT                   /db_xref="GeneID:3371922"
FT                   /locus_tag="cgd7_2540"
FT                   /transcript_id="XM_628424.1"
FT                   /product="60S ribosomal protein L35A"
FT   CDS_pept        599728..600090
FT                   /locus_tag="cgd7_2540"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L35A"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362920"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2540"
FT                   /db_xref="GeneID:3371922"
FT                   /translation="MKSQIKKKSFNNKTTEPVRLYSKAIVTGYKRSKVNQTPNVSLLKI
FT                   EGVKTKEDAKFYLGKRCAYIYKAKTIKNGTKFRVIQGLIRRSYGNSGAVCAKFRKALPP
FT                   SSFGGRVRVFLFPSNI"
FT                   /protein_id="XP_628426.1"
FT   gene            complement(<600407..>601137)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2550"
FT                   /db_xref="GeneID:3371829"
FT                   /locus_tag="cgd7_2550"
FT   mRNA            complement(join(<600407..600518,600560..>601137))
FT                   /db_xref="GI:126653266"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2550"
FT                   /db_xref="GeneID:3371829"
FT                   /locus_tag="cgd7_2550"
FT                   /transcript_id="XM_001388350.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(<600407..600518,600560..601137))
FT                   /locus_tag="cgd7_2550"
FT                   /gene_family="HOG000239420" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126653267"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2550"
FT                   /db_xref="GeneID:3371829"
FT                   /translation="MSNENSSLYPKQFSIHTSDGVKLSCRSFGNIPSKVPMTGIESIVF
FT                   VLVHPYGIMGGSSSNMLGLALSLADKGYGSIIFDHRGIGKSTGYKSIFGNNEVYDVVSV
FT                   CNDIKGKNSDIKVVLIGSSAGAPIAGSAVDECENVIGYIGIGYVFGFWPSLLFKQHYNN
FT                   ILRSKKHKLFIMGDSDGFTSIDVLKNKMDNCCDPKQVEIIPKVGHFELESPYYDDTICE
FT                   IIDKFVKS"
FT                   /protein_id="XP_001388387.1"
FT   gene            complement(<601148..>603352)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2560"
FT                   /db_xref="GeneID:3371923"
FT                   /locus_tag="cgd7_2560"
FT   mRNA            complement(<601148..>603352)
FT                   /db_xref="GI:66362921"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2560"
FT                   /db_xref="GeneID:3371923"
FT                   /locus_tag="cgd7_2560"
FT                   /transcript_id="XM_628425.1"
FT                   /product="Sgd1p; NIC plus MI domains containing protein
FT                   involved in RNA metabolism"
FT   CDS_pept        complement(601148..603352)
FT                   /locus_tag="cgd7_2560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Sgd1p; NIC plus MI domains containing protein
FT                   involved in RNA metabolism"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362922"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2560"
FT                   /db_xref="GeneID:3371923"
FT                   /translation="MKDENDEDIILLEKKLGIIKKEGVSETSIEKKRKALYKKIEREEG
FT                   IGDFMDLIDGILTDVNKKKKKIESESKPNKKNIRNKSCDKSFNSKNFPKLICESIINWQ
FT                   NEFRQRAQGFLNRLSEGNMTLILEKLIELIKYTIRLAYNNHNFCDSDLLKLRSESIKIV
FT                   LGYFDSDYYVAHRLIAINDIIESELIMLFIQNCIIQPQNTVSLNTVYSALISSIGIKLE
FT                   GSFNQRLIIILNKIYNETLDKILQNLGSNIEKYNNKIILRHIIISLITIYRCGFASSIV
FT                   IQNFIDTGINGYKYSKSNIIYWECFFDNVLTIIRGSAFYIKDESNSVFENIIENIGSEI
FT                   SKDYYFEPQLKNEIESSNLNIFVSPLKFKFIIEELNEWRESLKNQALSQKLRRREGIIE
FT                   RQLNTMHSWSLNCVLLKHMQMIRNGRKQAPIQSKLEIVSYPKTLIEYIWQEENKNLLLW
FT                   YLNKDQENNLVNQLIGFYNLGTKQLNPKRIIHEEIDATNNVINNNKLLDLASKMRFTSD
FT                   VQKSIFVALLGAIDEFDAINRLTSLNLTQSKTYLNSAINVIVISSLFEHVYNPYYYKVL
FT                   KGLTVLPAVISKKINNEIINCFSQQMGILDKFNVRKIMIFSQLIKDCIFGRIFDLRIIR
FT                   FIKINDIHALTGSIGLFLKELIILILREENEADEDAFIFELFSAVSKMSELKETILFVI
FT                   QALAVPAIENNNESNNGYEILKIRIARITKLLGDNITFLK"
FT                   /protein_id="XP_628427.1"
FT   gene            <603645..>607211
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2570"
FT                   /db_xref="GeneID:3371924"
FT                   /locus_tag="cgd7_2570"
FT   mRNA            <603645..>607211
FT                   /db_xref="GI:66362923"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2570"
FT                   /db_xref="GeneID:3371924"
FT                   /locus_tag="cgd7_2570"
FT                   /transcript_id="XM_628426.1"
FT                   /product="adrift-like. FTSJ family RNA methylase"
FT   CDS_pept        603645..607211
FT                   /locus_tag="cgd7_2570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adrift-like. FTSJ family RNA methylase"
FT                   /db_xref="GI:66362924"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2570"
FT                   /db_xref="GeneID:3371924"
FT                   /translation="MVKPEFRIYSFPSCETIKLRIPFSVVPCSNCASKGYECYCNAIKE
FT                   GLGKHEGYSIKELESLKSQLDSVRNELDLIDINVWQSFTRTTNIAQDVIYKLREIPVEL
FT                   ATTGWCKLYEILHYFRWHEYINEAEYHSMHLCECPGGFISALNHYIHLNVINKRQRLGS
FT                   SKLHWEWKANSLNPYFEGNNPNAILTDDIIYRDTYRAWNMGADDSGDITKVCNIDYIWQ
FT                   KTSKNTKNCWLADLVTADGSLDIQYNPNEQEKLTSSIQYCETVCALGILRKHGSFIIKC
FT                   FNILHHTTISIIALLCYCFQNVHIVKPIMSKGGSGEIYIVAMNFQGIRSVMLKALISHF
FT                   QGNKDNFHDFSLFPKEWLPDEFIEQCVTAATLFSKWQIDNISYNLLKYKSFVVNDLKYK
FT                   RMKFSDLDLSNSTSHDNHEESNIMNEQSKGELIKENYLFDSGVSKREKRIFALEYLQNL
FT                   GISNIPTSQYILPNLQHRKEYLNSTSLSRRGGDRNRVQGIFIDRKYAFQQYTKLQETRN
FT                   KCYFPSISFVKLASSNNIDSFKKKFFFFVDDLVNENNDTESSDVSNNGDISKIPLKRKM
FT                   DIELNLAQILPKEKLPKNISPKWFIWSKDDIAYQRLVDRLKSQAYMFESENFFKKVQDF
FT                   TCVSLQMSPYCDDDLIQRFCETITAINSPIKKITFGIDTCVHNELFDNKLRWTTIPFDA
FT                   SKLLDQKENTNLIYSSITGNEFEMNFTQDSILNANIIDDLPLYCQIPANIHILSLFEII
FT                   RELKLSECNAQSTMSEYLGKINKYAEIYNGVAYREVLEDHCKFPLTFLLNMNSKSPKQG
FT                   TIILLSNEETDELYKDKNKTKFNICNNLTFIDISKEFKYCNQYKQIINAITEDYNVKKN
FT                   EYDLIYIDSYCHLVPTFSLGQFEVEESFNLVTDIMIALNLIKFGGNIIISLKTALTRFT
FT                   AGIIIVLSSVFDKIALSKPYSSSSPCYSNFYLICSGFNDHSNTLSRHFFQFLWDVFSNN
FT                   IKENTSIVQCVPPTLFASDNFLHWLKEFNNEVMLYDIEMLEAVIEQQESSDHLGLNISN
FT                   CGKRQKNTDSNWEDFTNRVSIQREILRYILIGANSLSSDEAFLKLYGQTKESCDTFKME
FT                   KMEENHKTLSEGDQNLIDINILQNDGQYPNFLEQMNVHRLEESQSNKNIDPFEDQVDLN
FT                   KEIDVFCISPEIEYNDPFAQNN"
FT                   /protein_id="XP_628428.1"
FT   gene            complement(<607219..>608580)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2580"
FT                   /db_xref="GeneID:3371971"
FT                   /locus_tag="cgd7_2580"
FT   mRNA            complement(<607219..>608580)
FT                   /db_xref="GI:66362925"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2580"
FT                   /db_xref="GeneID:3371971"
FT                   /locus_tag="cgd7_2580"
FT                   /transcript_id="XM_628427.1"
FT                   /product="AMSJ/WSAK like polysaccharide polymerase
FT                   (glycosyltransferase family)"
FT   CDS_pept        complement(607219..>608580)
FT                   /locus_tag="cgd7_2580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AMSJ/WSAK like polysaccharide polymerase
FT                   (glycosyltransferase family)"
FT                   /db_xref="GI:66362926"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2580"
FT                   /db_xref="GeneID:3371971"
FT                   /translation="GEVKHRNSSFIGLEKNNQKFNDEIKKIFEIDNWFNNYPELLLNLS
FT                   EKSPKLLSESMRKYTRISDNFFVQGEIMMSILKYTIGNVENGIVFGIADHENKGDAGIN
FT                   WSQYLVFKRLNIKIIYYCTSNYSHKPCDIKRALNIANTLPRKPTIFLTGGGNLGDVWPK
FT                   YEYERKKILEEFREFNTVIFPQSISLKSKDTIIDFDYLKMHKNLTIFVRDIYSFGFLHS
FT                   ILFNNQSTTNTKLLLTPDIVTSIVTTKEKKSPNTAAHLVFNETYDILWINRNDRETSKR
FT                   QWNKNYNANLNIKVDDWIKFMPTTYSKGISFGNKYILKSGEEIAPPQFVSNNVFNSTYE
FT                   YDEPNFDVFSIGISLQRFCAGLNFILQGKVIITNRLHGHIFSSLLNKNQILLDTKFKKI
FT                   LNYYKTWSFSIDEDYIKLANSEKDALESAEEMSRRFPSDNRTELFYIYCGKLYL"
FT                   /protein_id="XP_628429.1"
FT   gene            complement(<608634..>610259)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2590"
FT                   /db_xref="GeneID:3371925"
FT                   /locus_tag="cgd7_2590"
FT   mRNA            complement(<608634..>610259)
FT                   /db_xref="GI:66362927"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2590"
FT                   /db_xref="GeneID:3371925"
FT                   /locus_tag="cgd7_2590"
FT                   /transcript_id="XM_628428.1"
FT                   /product="integral membrane protein with 10 transmembrane
FT                   domains"
FT   CDS_pept        complement(608634..610259)
FT                   /locus_tag="cgd7_2590"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein with 10 transmembrane
FT                   domains"
FT                   /db_xref="GI:66362928"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2590"
FT                   /db_xref="GeneID:3371925"
FT                   /translation="MKKFAINANRQRVIKGIIIETLTILGWTVGSALHSIFTKKSFNKL
FT                   SKDEPISSRIIFGSFLTIVQLLLASVTGILICGIIGIIHRREIKQDSVELASNRISING
FT                   NNSNIEGSITESTCENRFEQTDFTQVSKSSSYIIDGDNIEISKEKAEFNEFDTNLNMDE
FT                   NVNISYLILNKDYNLNTFNRNINFPEASFEIGSNYENEPKKDKLITSASNRGQKNSYNK
FT                   HISKERWWGSNKMLFSAALYAIANICANTALGGGKVMLVQIIKCSELILTAILAFFVLK
FT                   RKVTVREVIAFSISTVGIILVVTSTLSNGNAGSKVIVYSVILAGVGAFTISLRNVIVSS
FT                   ANKNEKAVGTFTILSFWGMITSLAIFSIMSIAFGGFNINVSVMPLLISGCFHATYNFSS
FT                   LAFLKLVGSPIVHAYFNLAKRAIIVLTAELINCTAPPIVQIFGSILAILGIHFSKKRKL
FT                   SFKSKKKITPSYINEIQNKNTDCNGKVEKVIKEQHKEAKITNKDKYPYAASIAISSLFI
FT                   IIGWITSYTCSCVLPKKSLTPMVG"
FT                   /protein_id="XP_628430.1"
FT   gene            complement(<610463..>614881)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2600"
FT                   /db_xref="GeneID:3371926"
FT                   /locus_tag="cgd7_2600"
FT   mRNA            complement(<610463..>614881)
FT                   /db_xref="GI:66362929"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2600"
FT                   /db_xref="GeneID:3371926"
FT                   /locus_tag="cgd7_2600"
FT                   /transcript_id="XM_628429.1"
FT                   /product="Low complexity protein, putative"
FT   CDS_pept        complement(610463..614881)
FT                   /locus_tag="cgd7_2600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Low complexity protein, putative"
FT                   /note="similar to gi:23612271"
FT                   /db_xref="GI:66362930"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2600"
FT                   /db_xref="GeneID:3371926"
FT                   /translation="MEILTHDDTESIKFIHGPRFRLRNNNPPRILICNPLKYLILERDS
FT                   QIIIFDLNIVLSNPDGLAYFESNFDQLYQAQLGKYDIGHESTIIHMVFDCSSTILTIVT
FT                   ERKILLFDLLNIDRKSEWMSINHDGIQSLTWTRNHDIITIETDSSCSIYHFIPSERSFH
FT                   QTKLILDGISDGFKLVEAAKSSFYEIEFILITENEKNIVIVTNELYFQIISCRSKLFTI
FT                   PQSFVRVFSILIEPILGLFQEHNSKANLISQLNIVSAKFIDGDDLYLSISLIRFSEYVD
FT                   GYVLFFKIYDDMKIELSSYSINDLCFDNVDSNDIDQIKKIRCVSFWVKEWGILFVGSTA
FT                   FSQMVVFTYNHSYINKENSSDFIPHKWVRLAMCEGYDINCTDFDIGIFDSCLCTCNSGS
FT                   IRDPKSTVDAPEILQPPVIFIAETNGDIITHYIGGNPKLIKPIKSEEVVSLITNSDLQN
FT                   INSNDQDLKTQSSPPKHLYNSINFPQTHFNISKIDYGKSSVVFEQTFTTPERELLSREI
FT                   FMVNKSGKKLFDSIMKIDYQVSQLEKKFIEINDQFFKILNSQEIQGLLNLCGTSDEIEP
FT                   NFSESVDLYQLISKSNEISNVEIQLRRIHLHIMKKISDEVYKNTNIEMLKEKLRKNELT
FT                   SSQISILFQYNIELFDAFTNNDFSGSQTILNSLITIERFSLKLASRISQVSIFCERLNS
FT                   RRSCELEFISLPPPEYSYNILNFNDQGFSTPNKMHFDSQLNAQLHKNISSSVNISKKKN
FT                   FVIHPDSKGKHHSYSSKRSVNLSDIINNISNSLTDDDSCKLSFTQSDESNIIKSQKLKI
FT                   NNLMNQTNTPGRYIQLRSKFIGYSCDEIQSDNLGVINKSALQKNTPFFELSWTPGLAED
FT                   KTGQVKLTGNPNFKFGTKNKYIKPGILNSVLANCIERLERIIDHCEIAKGSISFIEREG
FT                   LIPALINKKGDSSQSIKGSSNNLQNGSRIVASQLLLSRNSSLQKNMMYRQKLSLIISGF
FT                   ISKPSDKRKLSSFPKITNCSMTNFKSNISSKLNDKDLIQDGFKEECTQPHPFMLPGKFQ
FT                   NSIHSYYKAPLLEHQSQIDANNQFGCIKNNLEKTGLKDHGNELEAVSETNNLNFGNCSE
FT                   LKAIEKDIEINANGWQEITQEPTKLRPSLEESNFSNKLFSLSNNLDEKTSDSNLNEKFT
FT                   DIDSSDQKNETEKDLCENGKSMDEEDIKSSLFPLSLTNNDTPNSKRASEGLFTFSTEMN
FT                   ISLNLKSPISEKKYTQDIVSNESNIFSFSSDSNPLKPINNICSNPKKILENNLSYVHIK
FT                   SELNRFGESTVPEVRESVIDSNTSSDVGNGCPSCNIKDISDERIRQTPEGNSTSPANLG
FT                   GLLGFPNCIANLTAPKVSGFGSSQFLVNGPFSSNKSDNNLCANSNNCCNIEEQQSFGFH
FT                   TTNLNLSTPFKTHPVSDNSMGGFATFSSEFRGFSQISEQNSTSNSFSNNSSSNIFNFAP
FT                   PQKPRQVNKLD"
FT                   /protein_id="XP_628431.1"
FT   gene            complement(<615052..>616794)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2610"
FT                   /db_xref="GeneID:3371927"
FT                   /locus_tag="cgd7_2610"
FT   mRNA            complement(<615052..>616794)
FT                   /db_xref="GI:66362931"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2610"
FT                   /db_xref="GeneID:3371927"
FT                   /locus_tag="cgd7_2610"
FT                   /transcript_id="XM_628430.1"
FT                   /product="POZ+kelch domain protein with kelch repeats at
FT                   the C-terminus"
FT   CDS_pept        complement(615052..616794)
FT                   /locus_tag="cgd7_2610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="POZ+kelch domain protein with kelch repeats at
FT                   the C-terminus"
FT                   /db_xref="GI:66362932"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2610"
FT                   /db_xref="GeneID:3371927"
FT                   /translation="MDDVTRDRITESSLYNDLLISSVLLDDDSLDTLIKGFDSMTHELR
FT                   ESFNNYLSKVRKKIINEFESLKYEKLSFEQEKKRTIREIECNRKAEVERMQKLRNTLEE
FT                   ETEIAKKLIIKEKHDNAKKLLNEKESFYKKQQELANHWQMIENKLNQERLELEKIKDKI
FT                   TEINFSARSTVEINVGGTMFEVSRSILTEGKAKGSLLSRIFSDKTLDIEIETDKNGNIF
FT                   FDRDPEIFKIIINYLRDSAKCLPSPTTTQMSLNILKEFNYFGIKFYDNSLIYVFGGCNG
FT                   EKILDTSELFITPIYLEDDFSEEINKNIGWSKVKTMPTPRAHGSSTNLDKSNCALFGGY
FT                   NNSSKALDSLEIYDPLTDSWRVGPSMLIGRRNLASITLEDGRIFAIGGFNGENIISSTE
FT                   FYDSRTKFWSVSPQLNVPRSSASCVKLDQFSIAIIGGTCGNKRLKSIEVFDTRRNQWEL
FT                   IQSKELLEVRSGSIAFASFGKVCIWGGIDEKNDVLCSGELFNISSSSIENTSTYIKPLS
FT                   KGILDSKIHPISMGKYSAIICGGQTAEETIKTTQFYCFQEDKWDKGPDLIFPRYGHAIT
FT                   KLDI"
FT                   /protein_id="XP_628432.1"
FT   gene            complement(<616921..>620712)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2620"
FT                   /db_xref="GeneID:3371928"
FT                   /locus_tag="cgd7_2620"
FT   mRNA            complement(<616921..>620712)
FT                   /db_xref="GI:66362933"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2620"
FT                   /db_xref="GeneID:3371928"
FT                   /locus_tag="cgd7_2620"
FT                   /transcript_id="XM_628431.1"
FT                   /product="ClpB ATpase (bacterial), signal peptide"
FT   CDS_pept        complement(616921..620712)
FT                   /locus_tag="cgd7_2620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ClpB ATpase (bacterial), signal peptide"
FT                   /db_xref="GI:66362934"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2620"
FT                   /db_xref="GeneID:3371928"
FT                   /translation="MNTPKFNFTKCFLLILFFNLATFFLVHVVVSESTNSVDQLRDEYS
FT                   ISEFLSGNQSNEDHYASIDQSELETRSSFDSNRESLNAHLESKLTGVIKQSFVEFQKGK
FT                   LSKNDVDIEELIFEIVKLALDGNGSRVLPSLELIDFLQKIIETSKYNTVTTLDYILAFI
FT                   SKEKFDTSITHDINRLRNFTEYLSYLLKYNDNGPNRMINSGKETLSLIKTRIHSSIWGM
FT                   EELIRTNKIMDYEIQNLGGKTTYSSQPVIGEITYEINSNQPRAVFSYKLVKQTIIEMLG
FT                   TNINKVHSNLKRIYGKITYSGSSKSNKSISLNLLYAIYLSAIMINDLYNQGLSSNLLSP
FT                   GFIFMVLLRDDIEHLPNNWEERLIKRSISYGINETDIKIQDSKYSNLESIITKGFTHSE
FT                   CNASVLRSNIQVVFRKYGIDYFKFMNEALKKYKTFFVPSTDGRINSISWFNNYSVNGYT
FT                   NKLNKKWFVDINELVIENGVTKAVDFMDEFHLLEISLSRSGLSSAIIVSESKLLKRTLV
FT                   EYLAYRIISGNSSIDLRGYRIISIHLESLLESCKNTKKSLTEQIKIKFDELMGAYDGKI
FT                   IVFTDNLFSSFETSTGSKRLYDIMKHYIVRGTLKVIATLSNENYKILAEKEIEVKSIFY
FT                   TIEMKELNGIVSEVFISGLRYQLELSTGIFINNDVIRVSVLMCHKYIENCVLPDDAVEL
FT                   INFAISMAKNEQFLEIPSAIHGIEDFISHSRIGAQVSKMRDYESNSIISSNRSRLSEVL
FT                   AMHLRMRNRIVSLALKIRPYLTNFRYLKTQLYFMMLINLNYQTSCVNKPVEDEFKLLEN
FT                   REKIIPNFSEELSVTQLTSLYRKNLLKYKQINNKSYNESINDEVSAITESQLDPMFFDD
FT                   IHQVVKDKQKEVADMKSLILEMAFNYNSLYSPLGMGEIDASHIAFIISERYGKSITKLL
FT                   DEIEYRKLPERMKDRLSEILSKYVIGQKSAIDYVSFHLGVELLRDNKNNPRCLLFVGPS
FT                   GSGKKTFALALQTALTESSVLFYDFSYDITMYSHFKILKSSDFADADAAKRLLGDNPKT
FT                   GIISEELKQTGKTVFFFEHIENMHPDVIKLILDILHNKDNINHKIGNLGSSTFILTTKV
FT                   GSEIILKNPDQIDRIKIRVDIIKKLRETFSSDLVRLIQNVVLFRPFTKEEALKILELNF
FT                   SEFSVLIKKNYSTIFIQPSLLVLNKIVDKKYSPELGYKSVLDFFEKEVKEKVLQLIKKG
FT                   ILVPYTTFKITIRDISSVEDPNGFKIDFAIVKKSINSR"
FT                   /protein_id="XP_628433.1"
FT   gene            <621325..>622779
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2630"
FT                   /db_xref="GeneID:3371929"
FT                   /locus_tag="cgd7_2630"
FT   mRNA            <621325..>622779
FT                   /db_xref="GI:66362935"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2630"
FT                   /db_xref="GeneID:3371929"
FT                   /locus_tag="cgd7_2630"
FT                   /transcript_id="XM_628432.1"
FT                   /product="patatin like esterase"
FT   CDS_pept        621325..622779
FT                   /locus_tag="cgd7_2630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="patatin like esterase"
FT                   /db_xref="GI:66362936"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2630"
FT                   /db_xref="GeneID:3371929"
FT                   /translation="MISEREKLSRIDGKDLLCNESAKVPVSSANSDKQKSWSMKFGIYS
FT                   KKTISDAQSNYLNQDLDSAMESNNKPRNCNTSSDLNTPNNNGNYSFWPNSFEDIQKGGS
FT                   AVFNRLASRIEEGIQDLQSQIRPDFPKLPDSLEGKIPLGFSFSVSAMLIPYHLGVILEL
FT                   QEQGYITESTPLSGASGGSIAAICCALDISMYEAMEACISLYEDCRKNGTAGRLNEVLE
FT                   RELRKKLPDNVIELLNNRSEKGGQIIISFTQLLPVPKAHFVSDFNSKDDLIECILASST
FT                   IPFLSVPWPTFKCRGKPCVDGYFAVGRGELGCLPTNAIRTVKVCPLPSAGSSMKSNRSD
FT                   VISPHIQSYDWILFSPDSNNNNEDFTRTRKWIRSLRPAGVNLKDFEQSLVDSMNTKESK
FT                   INGIKEESFELRETFNSCYINNNPNFNAPPLMKYSNNELLRIAVDPPSSQVAWELFYIG
FT                   RGDALRWIMMDRIRESSYKLMEPTYN"
FT                   /protein_id="XP_628434.1"
FT   gene            complement(<622848..>623807)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2640"
FT                   /db_xref="GeneID:3371930"
FT                   /locus_tag="cgd7_2640"
FT   mRNA            complement(<622848..>623807)
FT                   /db_xref="GI:66362937"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2640"
FT                   /db_xref="GeneID:3371930"
FT                   /locus_tag="cgd7_2640"
FT                   /transcript_id="XM_628433.1"
FT                   /product="TPR repeat protein"
FT   CDS_pept        complement(622848..623807)
FT                   /locus_tag="cgd7_2640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat protein"
FT                   /db_xref="GI:66362938"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2640"
FT                   /db_xref="GeneID:3371930"
FT                   /translation="MKTLELLSKAQALVNKFPPEYENANALFTQAIKLDPLNSNVLSAY
FT                   GEFMCSIGNFESARELLEKSIKVNPYDDYVKYFSLAQILDGEESLSYWNNGIEVLQESI
FT                   KIVEKKGNDKSCIERLDLMKNQLCSAYCAISELFMTDLCYSDEAESQVKENLAKASEID
FT                   DEHFETLCCKLAYFKTIDDFEECKKYVFKIKYILANKYNLSVEFNDFADELRNKDIILP
FT                   EYSVRLNLSRTLIDLNETELAELVLSTLLKEDEEDWQIWYLLSWCSLVSEDVSGAIECF
FT                   EMFEKYGNKHIQDIEFKQQFMSDLENLKLNIEKIKTCK"
FT                   /protein_id="XP_628435.1"
FT   gene            complement(<623918..>625138)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2650"
FT                   /db_xref="GeneID:3371931"
FT                   /locus_tag="cgd7_2650"
FT   mRNA            complement(<623918..>625138)
FT                   /db_xref="GI:66362939"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2650"
FT                   /db_xref="GeneID:3371931"
FT                   /locus_tag="cgd7_2650"
FT                   /transcript_id="XM_628434.1"
FT                   /product="s-adenosylmethionine synthetase (SAM)"
FT   CDS_pept        complement(623918..625138)
FT                   /locus_tag="cgd7_2650"
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="s-adenosylmethionine synthetase (SAM)"
FT                   /db_xref="GI:66362940"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2650"
FT                   /db_xref="GeneID:3371931"
FT                   /translation="MDSSRFSGNKSTYTDLQTTSEQFLFSSESVCSGHPDKLCDQISDA
FT                   ILDACLEQDPESFVACETCTKTGFIMVFGEITTKANVNYERVVRETVKEIGYDSEEKGL
FT                   DYKTMDVIIKLEQQSNQIAGCVHVDKNVEDIGAGDQGMMFGYATNETKELMPLTHVLAT
FT                   SITRELDYIRVKGVSSRVGWLRPDGKAQVTVEYNCKHGVLIPKRIHTILVSVQHDENIE
FT                   NEEIREFVLENVIKKVCPSDLMDKETRILINPSGRFTIGGPAADAGLTGRKIIVDTYGG
FT                   WGAHGGGAFSGKDATKVDRSGAYMARLVAKSIVFSGLCSRCLVQVSYGIGIARPLSLYI
FT                   NTFGTAKDGYNDAKLLEIVNKVFDFRPGILIKQLNLKSPIFKKTSSGGHFGRSEEEFLW
FT                   EKPIILQ"
FT                   /protein_id="XP_628436.1"
FT   gene            complement(<625279..>627384)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2660"
FT                   /db_xref="GeneID:3371932"
FT                   /locus_tag="cgd7_2660"
FT   mRNA            complement(<625279..>627384)
FT                   /db_xref="GI:66362941"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2660"
FT                   /db_xref="GeneID:3371932"
FT                   /locus_tag="cgd7_2660"
FT                   /transcript_id="XM_628435.1"
FT                   /product="RAD24/Rf-C activator 1 AAA+ ATpase"
FT   CDS_pept        complement(625279..627384)
FT                   /locus_tag="cgd7_2660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RAD24/Rf-C activator 1 AAA+ ATpase"
FT                   /db_xref="GI:66362942"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2660"
FT                   /db_xref="GeneID:3371932"
FT                   /translation="MSLWANKFEPKTAQELLVNKHKIIEVKSFLENSFISANSINGSKK
FT                   NILIIFGPNGAGKTTILRCLCNNNIKILEWDPPTIINEGLGASFYRFIFNSVFFSKSNL
FT                   NEKVLVLIKDLPFTLLQHNTQVLIEIRHFLSKIILNDSSIIPIVFIAGEDRNSRQFLKS
FT                   ILPGELDIYTENSTDKKLAKQIKIVRVNPFPSTVVKSRLKHILNIKKIFVGVGEGNLIE
FT                   EIVQTSNGDLFHAISQLQFYFEGNQDIFVKNNLRDLTANTEFFLSGKKRSNHLNYRDKP
FT                   YQTPNSTLSNFGKEPVYNIFRTIGKILYNKREENTNKLRLESLQNACTKRTKIDSEFLN
FT                   AWNNRAGLVEYINNENNLHCAYYCEGFKDINEHFLNIHITQQDFLKGKLTFDIEELLLY
FT                   SGLEDSSLILLLQENYIPFIGNCADIIMCSDIFTWSDVYTSDLNSENFFSSISASCIAR
FT                   TILFFNSKPLNPCSPDCQIQSDLKVGFSKNNFSLWKKQEDLQNKRLKISNLVEKPKKAT
FT                   FKWHPKKPALKSFISNLEHLKEDYKILIGKCLPFFTARDNYMNLFFSNTIFTEVFPYLS
FT                   CFFAVKHNSFSQNNTINNELINFIVNWNKYSKYIPIPQINSINSAGVGLENGSKLYHYD
FT                   SSFNTSYCEYLSDEQLVSILETFDVENLQSNPTINNCFESRNSNYSNNNTINLASSSDE
FT                   SIDDYSE"
FT                   /protein_id="XP_628437.1"
FT   gene            complement(<627987..>628949)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2670"
FT                   /db_xref="GeneID:3371830"
FT                   /locus_tag="cgd7_2670"
FT   mRNA            complement(<627987..>628949)
FT                   /db_xref="GI:126653304"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2670"
FT                   /db_xref="GeneID:3371830"
FT                   /locus_tag="cgd7_2670"
FT                   /transcript_id="XM_001388351.1"
FT                   /product="serine/threonine protein phosphatase, putative"
FT   CDS_pept        complement(627987..628949)
FT                   /locus_tag="cgd7_2670"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein phosphatase, putative"
FT                   /db_xref="GI:126653305"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2670"
FT                   /db_xref="GeneID:3371830"
FT                   /translation="MTPQPSSTTISGTANGSNNDIDVDSIIAKLLEVRGSRPGKPVQLT
FT                   EKEIRGICIKSREIFMSQPTLLELDAPIKICGDIHGQYYDLLRLFEYGGFPPDTNYLFL
FT                   GDYVDRGKQSLETICLLFAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLW
FT                   KTFTDCFNCLPVAAIIDEKILCMHGGLSPELHKLDQIRKIERPTDVPDTGLLCDLLWSD
FT                   PEKDVRGWGENDRGVSFTFGHDVVEKFLRDHDMDLICRAHQVVEDGYEFFAKRQLVTLF
FT                   SAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKKKLKP"
FT                   /protein_id="XP_001388388.1"
FT   gene            complement(<629708..>631069)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2680"
FT                   /db_xref="GeneID:3371933"
FT                   /locus_tag="cgd7_2680"
FT   mRNA            complement(<629708..>631069)
FT                   /db_xref="GI:66362943"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2680"
FT                   /db_xref="GeneID:3371933"
FT                   /locus_tag="cgd7_2680"
FT                   /transcript_id="XM_628436.1"
FT                   /product="clathrin assembly protein"
FT   CDS_pept        complement(629708..631069)
FT                   /locus_tag="cgd7_2680"
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="clathrin assembly protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66362944"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2680"
FT                   /db_xref="GeneID:3371933"
FT                   /translation="MCGVSAIFILDINGKPIIGRNYKGDISESGVLDAFQQHVIEQEES
FT                   CIKPIFSSKMITYCWIKYNNLYLVLLSRKNSNAIMMITFLYKLIEILKDYFKVLEEESI
FT                   RDNFVVIYELLDEIMDNGFPQITEVKVLREYIKNEAHELSAASVLVQSRNSSSSIKPPS
FT                   ALSNVISWRPEGIKHKKNEIFLDVIEKVNMIIGSSGDVINSEIVGTLTMKSYLSGMPEL
FT                   KLGLNDRLGDASISTSNANRNSASSSNRNSILKNKSVEIEDIKFHQCVRLARFESDRTI
FT                   SFIPPDGQFELMSYRLTPSSNLKPLFKVDVNIENISATRIKYVIKVKGQYKARSVAKNT
FT                   EIQIPVPSDVIIPTFKTSMGTVKYSPERDLIVWNIKTFSGQKEFTMTAIFDIPSIINET
FT                   NTSKRPVTVGFEIPYFTISGLTIRYLKITEKSGYQALPWVRYITQNGNYEIRMP"
FT                   /protein_id="XP_628438.1"
FT   gene            <631996..>632835
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2690"
FT                   /db_xref="GeneID:3371934"
FT                   /locus_tag="cgd7_2690"
FT   mRNA            <631996..>632835
FT                   /db_xref="GI:66362945"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2690"
FT                   /db_xref="GeneID:3371934"
FT                   /locus_tag="cgd7_2690"
FT                   /transcript_id="XM_628437.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        631996..632835
FT                   /locus_tag="cgd7_2690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="Low complexity protein with 1 transmembrane domain"
FT                   /db_xref="GI:66362946"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2690"
FT                   /db_xref="GeneID:3371934"
FT                   /translation="MKNDLFTDKNRFLSTLGLIGVVIGGVWYITKNNKKEISNRKLDNE
FT                   EIKNLLVSISNELHPILMEFSNLVSSINIPIDINSIEFSNYSEIIFSNGGFKDKIVRAQ
FT                   KEVIDNLAIDQENFEKLLYSACKVDEEVLMLKLGIDRMYEDSFKGVYPLLPYFGLKADF
FT                   SKKYPNFTQDHVLRRLRELNNEKEKGLKAVVKELDGLSRHVKEHPISGVIPSEKLSKRL
FT                   EEINKQSENTVFESIESKRLFSHAIALYSREVEFAEKKRILEREHCDNILNIILNYK"
FT                   /protein_id="XP_628439.1"
FT   gene            complement(<632863..>636777)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2700"
FT                   /db_xref="GeneID:3371972"
FT                   /locus_tag="cgd7_2700"
FT   mRNA            complement(<632863..>636777)
FT                   /db_xref="GI:66362947"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2700"
FT                   /db_xref="GeneID:3371972"
FT                   /locus_tag="cgd7_2700"
FT                   /transcript_id="XM_628438.1"
FT                   /product="SMC3'SMC type chromosomal ABC ATpase'"
FT   CDS_pept        complement(632863..>636777)
FT                   /locus_tag="cgd7_2700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SMC3'SMC type chromosomal ABC ATpase'"
FT                   /db_xref="GI:66362948"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2700"
FT                   /db_xref="GeneID:3371972"
FT                   /translation="QRVYQNNNSLIPERILFGKLIFFLLGLLNIMYIKELKICGFKTYR
FT                   DETTISFHPGCNCIVGLNGSGKSNILAAIQFLLSDSFGNTLVERRALLHEGLGPQATEA
FT                   YVELSLDNIGRRLSMYDEDVVTIKRIFRSSSQKNEWQVMGKNISKKDFDSILESCGISR
FT                   NNPYFIVRQGKVAELATMSDASRLRLLKEIAGTRTYDERRDESIRLLLETETRKIKVDS
FT                   VFDDIQKRIEVLKDEQKEFKAFLNLDRRRRNLEFLLNEYEWEEASKGEQEYFEKLSKSR
FT                   ERLSSVERNLNLISSSIQSLIESQKNLDIQLEELEHKKKEIQNKISHYSASINDLNLEQ
FT                   DTHESHQRILYLSNLENETKSKILAIETSIKDEKELMYKYKIKYNSILKEKDMLSQQES
FT                   SLISKNNEMEFSTISEKRSVINRKIELHNIEKEKLSSHLCSIKKSLAEKQDELRVLDSN
FT                   ILKWKEDQFKSQKNLDSIIEKIRVNIEEQQMALEKKHEINKSLYEKENQQSIISSRILE
FT                   LENYIGSRAKHSVKMGLNLAREYCEKNNLSWGGLDNDEGINETLVFGTVLEVISVDDIY
FT                   TTAVEVAAGNNIHNLIVKDKEIATKIVSHIKAFNGHRNDIKYRTNYSIVLSPIDDIKQL
FT                   NKSHSKYDIGSEKNAISMIDIIQFDEKVRPVIEQIFGNYVIVESLDNAKHLVDKYNVNC
FT                   ITLDGDEWDNKGCVRGGYRNINLPGAQQNSIIICSRQLKNLIHENSILRSEIYNIKSKI
FT                   KEIEDRVFELSHDREEYLSTRERFISQISKSKEMIHLSESKKRNIQSIIIKVKEEEEKA
FT                   VRSTDTVQNYIVALKSELSCESLSNGLTLDEENLLKEIISKIRTLEYYEIPKVEREISD
FT                   LCNDIDKHEVHLNTLFEELYRIQEEKQEEDNMKLNCDNFETNGLLMEYNKLLEESKEFF
FT                   NEIINKVESTKKKSIEIEELKRSRMQEESLALNSRNELISLVSSLQKKYDKFRQAKEIA
FT                   LHERTKYSDSQNVISEINIPKEKSKVYQELQIVQKKLSEDYRSINRKVISELDQFIQEY
FT                   TDLSDRHKELNSAMSSIQLLIETLDIQKEKTLLKTFEEINFYFNQVFRELIPNGDAKLI
FT                   LRLSSDARSIADENDDNTNKKPSYKKNSSINNKYLNNTMAKESDSTLLGIGIRVTFHVG
FT                   SNSQINSTNTQKKPNGQAGNYYSLNQLSGGQKTLVALAFLFALHRADPAPMYLLDEVDA
FT                   ALDDQYRWSVANLIKKQSISTQFIVTTFRPQILQVADKYFQVSQVNRSSFVSEISKQQA
FT                   LELQQEQYQQKKSHELISDD"
FT                   /protein_id="XP_628440.1"
FT   gene            complement(<636910..>638865)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2710"
FT                   /db_xref="GeneID:3371935"
FT                   /locus_tag="cgd7_2710"
FT   mRNA            complement(<636910..>638865)
FT                   /db_xref="GI:66362949"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2710"
FT                   /db_xref="GeneID:3371935"
FT                   /locus_tag="cgd7_2710"
FT                   /transcript_id="XM_628439.1"
FT                   /product="ataxin2 related nudix domain protein (RNA
FT                   processing phosphatase/ATpase domain)"
FT   CDS_pept        complement(636910..638865)
FT                   /locus_tag="cgd7_2710"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ataxin2 related nudix domain protein (RNA
FT                   processing phosphatase/ATpase domain)"
FT                   /db_xref="GI:66362950"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2710"
FT                   /db_xref="GeneID:3371935"
FT                   /translation="MDQLIESLSHIVTQNGSFGSTNCLSSRSENAGRDTTHSSESGYII
FT                   DIKGKCNQINNLRDDNLVQSSIFNSNMNKICSNRLNDCFLKNEDEANNSGHKIGDRIEI
FT                   SGGFQETLGSNILKKFLIDRDRSHNLNILPPNLTRESVMNNFEQSAQLDEKKTASDIAM
FT                   KYSPEDIILSKVRGIFMNRYSRDSIPQEQIDTLKTTTKKKNKVNGPMERLISNFDMEAA
FT                   YKDMEAAFSEAIDDCYARFFTNLPVNLLEDAIHLYFQIQAAYWWYEDMWYDKYSHVLPK
FT                   LSLRVFGQFVAEDCPILRHFVSSPEEHDKFLLNWKRYCKTIPLRGVILINKEFTKCVLV
FT                   KPWNGNRFMFPRGKMDEMEEDSLCAIREAYEELGIDVTKHLNDSIYIEKQVEEQTIKLF
FT                   LIPGIDENTPLEPKKRKEISEIRWFSFTSLPNWHANQSLRHRKPKNSDNFSHADGNLNC
FT                   ISNDYISCIDRQDIHNSEDEDLIGSSEKVHENLESIIEKPDSNQFFRVSHFTRNLRGWI
FT                   EVLKRIPLYNPSNPGGIIPNLPKNLNPAVIRRLQNADLGGPPLSSLPLFVRVKFNANER
FT                   RGQPSSTSQIYSQNKKKPKPYFSDATKDKRTFGTKAGSGWDVESMFALNEQKFGVKSTF
FT                   SLDEYTIPLPKIRQKK"
FT                   /protein_id="XP_628441.1"
FT   gene            <639264..>644612
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2720"
FT                   /db_xref="GeneID:3371831"
FT                   /locus_tag="cgd7_2720"
FT   mRNA            <639264..>644612
FT                   /db_xref="GI:126653426"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2720"
FT                   /db_xref="GeneID:3371831"
FT                   /locus_tag="cgd7_2720"
FT                   /transcript_id="XM_001388352.1"
FT                   /product="FALZ protein"
FT   CDS_pept        639264..644612
FT                   /locus_tag="cgd7_2720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FALZ protein"
FT                   /db_xref="GI:126653427"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2720"
FT                   /db_xref="GeneID:3371831"
FT                   /translation="MELSNSCKCFFNKCAHNINLKFDDAEEIINGSSEIFLESETEFPN
FT                   KIFIQTPSLLYCNIISVEVNGNYFEGWSINPVPTLEDSNKIVGHNVFDIATLQMAYGFI
FT                   SSNYGEINPDQSNVIENRLLILISDEKMLNTATDATNENEYKYSIIIKVNFELLINVPK
FT                   SPITYVIENDNSINISIIPNSHSKLPWFPTLSSALYLTEDASPFWNSPWSFKCTVPNGY
FT                   SAIMPGILNTNCFVNRTNTINENTFEYNYDSGTSFPHIYPNNIALLIGKYIREDKTIGK
FT                   NTVTIFRPIDVSQIVNIANFVVEIMDGYEKLLNNTLPMKSIIIVFSNYIFNQHSHFFNC
FT                   HGRVSDTLGKVEMLSNASSPLLYQENNYYSHLSETDIGNTIGNIIIVPLDMFPHKVISN
FT                   MSSAIDNKKNNFQDNFRMQIRTLTMPIIILLDRLASLWFGSYIHITNLKRLPTDGWMLL
FT                   GMKRYLMRQMAKKLCGEDLVKCRMKEALERCLLLIENGNDYIPLSVKDFYINLQQNGTP
FT                   SFPLIHWSQRECQTLFRLKSDIVFHSLQCYVNQMIKSKARKVGFGFSDFDSSIKQNSQS
FT                   KFFNIFIQSFINKHCIKKNHRNFTTQHFFLHIASCISQQFIHRSKKEIAAAQLPQHEQY
FT                   LLNEIQDELLAFRSAWIEGVGCPNLTITSTFQFSNKNISLDHALFTVDQTPLQPPHLTS
FT                   KEGISSFIPLVSIFKVKRNIAPRCDIEKLIFNCLSFIDGFYNFGASRSQLSNSITKLLP
FT                   SFLWPHDPNNIILKESNITILGLGNTGRIPIPIKFGFGPLFDSVFQDELQESTKRRVDH
FT                   LNNKINIERSALDNNFNNLNQLDAPNKKKNYSASSNGCISSWQFGYMNILCQILLNYHE
FT                   NMSEPVNDIEWLCTELASHIPISGGTGKFWPGHTLIYIVQNEENKNCELETIEPQLPVL
FT                   QEIKFETQKIKSGYRRDSVPVSNASIASSVCTQGVTNNQNSITHANIKVNEVPRLSLLH
FT                   DLQQRKHFVGKLSNSDNIWLQPLQFSRNYKEIISSENEQISMNRTANTVNFNSHLLWII
FT                   ADSSQYWLAKISRYQTWSMWDQQFLNETDVIGQFEAAYQLGMERYIFGDCSAHNLTILE
FT                   RAFQSINILMSALYHFDWNIFVRKKALLSIIKIHNKLSSQVSIKSGIQSIKTAVFSLIK
FT                   KFIFELISLIGYQKNKELSNITSNVFFFNELEILLFTIKSLSYLWNFEVDSSSFESVHF
FT                   LTELLDKYANPSHDKFNFEILCSIFEAIERIVLPPSNDQYSSLINKVTSVISKLIVGLL
FT                   KGCNYIFEDAKIFVILFKILSKHSINILIPVSNEFRNDFGIYFDPLWFIDLPFMYNNAW
FT                   WDSYSSIHGSISMPLYKLSEPIIQLSALKCYFSLSLQGFTETMAVFSENDIESNIKFKS
FT                   ISPEVIYGLILESFSECNKQTNSQQNITSTCGNKKPEAINIIGIFNVWNFKKNSPENVA
FT                   SARIFPKNLLKTLCACALIHLILWNGIKESFKHKKNNSNNWKIINSLWSIFICALDDII
FT                   RDFPHLLDEFILLQAHAEFEPLINSLTNKQHKNRETFDDIKQCCIFISQIILNSPISLS
FT                   SYPFDPLIFQNISNMYISLFGHGVPVCMNQTPFISQDVKCNQLVFNPSNGYILSAIPEV
FT                   PMKESLRKRQKFIKRGCDLSDSIQIRRLCDDESYIISRGWKHICKKITQCLIESPYGAP
FT                   FIHPVDENDAPDYYNLIEQPIDLSTIMNKVKQDLYESIEHYRSDVDLIFANCKKYNEST
FT                   SQIVEWCNKIQSEFDQLFKPVCRLFA"
FT                   /protein_id="XP_001388389.1"
FT   gene            <644811..>646925
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2730"
FT                   /db_xref="GeneID:3371936"
FT                   /locus_tag="cgd7_2730"
FT   mRNA            <644811..>646925
FT                   /db_xref="GI:66362951"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2730"
FT                   /db_xref="GeneID:3371936"
FT                   /locus_tag="cgd7_2730"
FT                   /transcript_id="XM_628440.1"
FT                   /product="ABC transporter with ATpase domain plus 3
FT                   transmembrane regions"
FT   CDS_pept        644811..646925
FT                   /locus_tag="cgd7_2730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter with ATpase domain plus 3
FT                   transmembrane regions"
FT                   /db_xref="GI:66362952"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2730"
FT                   /db_xref="GeneID:3371936"
FT                   /translation="MSFFYQNHSGDKTNLQINKGEIYEHAKKKQIDYAVKQGITGSIKM
FT                   VWGLCYEYFISNGSNELIGRPINRNNGKSVLSKIKLPKYKLLLTFLLILGSSIVSYYFS
FT                   LLIGSFWSALETKNKDRFQKILFYYFLMLIINGAINCARTDMSIRIQIDLRMWLTNLIL
FT                   KQYYSDLTYYQFSINKMIDNPDQRIGEDISLFSSHLLLLICRCIDNLFDFFVYSILLYN
FT                   VNFKLFISAIIYSCFGTFLTAKLGMNIILLKVQEKKLESDFRYSIMRVGENAENVAMYG
FT                   GAQCEMERHEQILNSLLLNLTTKRSFESKMGLFGSIFRNLIRVLPIAVISGDYFSGNIQ
FT                   LGRINQCSLAFNSIVEDISILVNTFREISNLLSSIDRVGHFIASMADNYIESQSINIGE
FT                   KLISSFENDSKTSRKIDFLHLESEFSRQMKEKSLEFKLNFPAGIASKSLKNCVKLEFTN
FT                   TQGKSSVNIRGKIRSVIWPEPKIKFESVSINTPEEYPRKLLFNINFMIEHSDKVLITGD
FT                   SGVGKSSLLKVICGIWKNGSGNIYRPPSSELLFIPQKPYCTQATLREQLFYPQIPSIKT
FT                   NGYEYKNKEELDSYLLKILEEVGLKYLCDRLSESGTVNCLDTIKDWSTILSLGEQQRLA
FT                   FARIFIFKPSICFLDEATSALDMETETKLYSMLSKKKFTYVSVGHRPSISIFHNKKLLI
FT                   KNGNIIFECI"
FT                   /protein_id="XP_628442.1"
FT   gene            <647116..>648051
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2740"
FT                   /db_xref="GeneID:3371973"
FT                   /locus_tag="cgd7_2740"
FT   mRNA            <647116..>648051
FT                   /db_xref="GI:66362953"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2740"
FT                   /db_xref="GeneID:3371973"
FT                   /locus_tag="cgd7_2740"
FT                   /transcript_id="XM_628441.1"
FT                   /product="WD40 protein"
FT   CDS_pept        <647116..648051
FT                   /locus_tag="cgd7_2740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD40 protein"
FT                   /db_xref="GI:66362954"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2740"
FT                   /db_xref="GeneID:3371973"
FT                   /translation="LLHISVGDRLVTADIKQNFHIFDLLPTCSNYDYLFRLIWVETSTL
FT                   YDSSIVGTISRISWAPECFGQLFVAGTTQKNISIWSETRKGYQDTYHIIRNNFVFENGL
FT                   GFKNGTFFDINNGSSWKLTTAFSPFKGKISNIKFADKDHGLIFAACDSNGIVGIFKCND
FT                   MAMKAEWELETLKVRKTDHFVDLGIANMEKHYTCCLDWIPYHVSSGIGITVAISNHIYI
FT                   FKKKSIFWNCVETIAVNNAGIIKDISWSKLALFSDFYKLASLHEDNTLIIWKSTDSPNI
FT                   NELGRNKTISQLNKFESIGSIVSFAFFFFH"
FT                   /protein_id="XP_628443.1"
FT   gene            <648648..>651188
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2750"
FT                   /db_xref="GeneID:3372262"
FT                   /locus_tag="cgd7_2750"
FT   mRNA            <648648..>651188
FT                   /db_xref="GI:66362955"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2750"
FT                   /db_xref="GeneID:3372262"
FT                   /locus_tag="cgd7_2750"
FT                   /transcript_id="XM_628442.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        648648..651188
FT                   /locus_tag="cgd7_2750"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66362956"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2750"
FT                   /db_xref="GeneID:3372262"
FT                   /translation="MSKGHELSFFKYIPNVFSKKPNCKKYFSSFEIKKVLLTEKDGIKL
FT                   KPEDKNHNLIELITKYNSFCSYYFNIINNIEYKNDTCIKLFPKHSIKMFKVLGVNLTEE
FT                   EITEFFCNFFQTTKKKCFIHSTSNAERTVENMLIWNFLSNFIYQNTRGVDLINLKSLFK
FT                   NNLCNMHFNAMKSIIIVDQKFLSAFSPCSYSVYFPPIMDEVIPICTSIVDLACKSLNNS
FT                   NPAEWSTQILVWISSLLRISDFNGVLKILITMNSILNNNHNNLKSSISYGVFPYLWEGL
FT                   LDMFLLINQTVSRSLINIVKTIPVCGIVFKSEILKKFFIEERVNLSIEFQKELSSKLRD
FT                   VENTISKSPNAKIFRNLFLKNDTFDKFRHQRYNLLENYRNLDKSIYSSKLPYSSKHEKA
FT                   HFESINKNFEGKYNLFQNCNKLKLNSGLNSDNLEFKVIRYENSVLTVCAICNSRIFRKG
FT                   DITLIQPFNKQLTLNGKQIMSFRQLAIVLNVIFIKQSLKFQGNTLKLKLKITDPGIDPS
FT                   IYKHCIIICLLNYYKYIKKTTLIRRLSLKFPQPYLSLIENINREIFENLIYNLSNENKS
FT                   PNDKLVIIFSKRLKYVYLYHRVEIKCILFRQEIFNFKNDSFFNNKRQDLFSYLLSFPKI
FT                   DCNIIKKIIYLTKLQKNIVFLALNSIAMIINNMNYTNRINIISMIAFLQKAIIPNAKIL
FT                   ILASRFEYAKMIKHALCTLNISAKILEEEYILYKAEYIKLRTEKNSFRGLPRYENWLYR
FT                   EMVVEEHDIIIINNIELNFNFVKKSLNIERKSNESSCFDHLLIEDVGVLSRLDILLLFI
FT                   LPFNNITLFNSGFMVNDFFTKGDAKKWVDIALGD"
FT                   /protein_id="XP_628444.1"
FT   gene            <651840..>659168
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2760"
FT                   /db_xref="GeneID:3372264"
FT                   /locus_tag="cgd7_2760"
FT   mRNA            <651840..>659168
FT                   /db_xref="GI:66362957"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2760"
FT                   /db_xref="GeneID:3372264"
FT                   /locus_tag="cgd7_2760"
FT                   /transcript_id="XM_628443.1"
FT                   /product="separin (caspase fold protease)"
FT   CDS_pept        651840..659168
FT                   /locus_tag="cgd7_2760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="separin (caspase fold protease)"
FT                   /db_xref="GI:66362958"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2760"
FT                   /db_xref="GeneID:3372264"
FT                   /translation="MDINLFETLFELSRSNRFEDLLFQCIELLLNRISTIFSFENKHAN
FT                   NKSKNKRNAALSDIFDSLIEIFECNAHMEIIFAIKKGLMKVKNFSQTEKLFQTNINKVL
FT                   NCFNDIYKIYGFIAVCCIELKEKKTLTHFLILSHNILPCFLIGDLLFLKKGVTGVWNTE
FT                   KVLISSIARVSKEIYQDHNSKFISAKMEVLFFSWVICLDNWLEYLRTRIFIIDNFQRNF
FT                   SEDILGLVKYIKELFYLISKSNLSYYYQILIIVNFCDSLSINVLNNVEFFDVIKNPSLN
FT                   INFLSVAIENDGLLKGIIKLLNKFIKFRMYTTIVDLLAILNGLSTLLINIIHQRMKKLN
FT                   DTEINLNNGINDDLLINSIKYYSFEIEFRRTKLVIMELHYLKASLCIPNQLLVERLYSI
FT                   EDSLNKLSQNVGFNERYQKAITSYLFLTIGVINSFSKIDLDKNLIFFVGNLLGTQCLLL
FT                   KSILKEKFFCDEIFLKNMDSYRISLLEYTVRQIFFLKNKSNFKVLCKDCIFKVVKILSL
FT                   FLKIQSNQPQDYKIEENIGINNKINIKFKTSICEVVLKSIQFTNAILDELFIIMEKIIE
FT                   EILNTVQIEDNNNMDEIILNFLLSTSENLIRLSSQMKSNKNYQDSIKLLSLALKCLSNT
FT                   FSVPWIATNESMYDIEKKIEKLKIFEESSSDDLSEYSCSTPDQKEDYFQVKNNLIENSI
FT                   ENTKNHNTCARFWKNENFEVYNESFKHKNADLISYSSNIEFGNAFTPFTRRLKSKGLSQ
FT                   LKSQTIKRIQTSAISYIARGKSKFNKISDREVIALTQRLKDSEVDFPIHILLFLIAIDQ
FT                   IISSIQFQFAQEPTQSFLNNIMLLVEEKLRTLFTLIDDRSYLFIFGNKIVELFPFIEKY
FT                   KKINFLKNEIIKNNTNNYDELIEQYFFNLLNSIISRFAKTKMLLINEYSAEKITLYRYP
FT                   EVENERNNMIKVVWFTLELNYYLYLREISKKYNQIFKKGISNGFCEELFNIYKIVNTFI
FT                   DESREKALVESKLNFESYFKFKVEFLNYYLWFIKVKFIIQNENVESKLIFENEINKLLY
FT                   ELTSLIKKTNISSKLLFLSKINIYEIYLLFFEDYRITKIMTNFSKDKNNRIYMVLKESL
FT                   DLLYSYLGFNRGYSDQSFHELLSIEYWKNKQLQINYDLILDEDLDSLKNIESDKSLNEF
FT                   EDIPIPINKKLSNSKYNEKNKLCKLEESDHTKLIQNTKTFVKFEICEPINKYQEVYLSF
FT                   IHEIGLIELEILFNSVYEIKELILLQDLDLKLLKELFNAVLYLFNPCWTFTLSSKTDIF
FT                   DKEKISKKMYISLSGFVSNLKLSLSSTEQREMLIINIGLFISNVLYYSAQITNKETYYL
FT                   NKSTPRWMDIAKTYTDGLIFLIESKYLLISDFLDTKLLTPFSVTEVLLNLIVLKIEHIE
FT                   TINDAFQYLEIVKKVKIYDSDKDNHNTMALLIRIMNKLSTLFMNANQPDMSLFYLLESN
FT                   KISQNITLFLETCGINSLNLQRTVLSACISHNFQFYYINLVLKSLHKLGESWWKLGAIE
FT                   RSQSVYSKLITFYKKWTIPYKKFITLYFYQLPTLLNHLFSRSDSQYNLIYSADNIDSFK
FT                   QILLEKNDNFESSSHIIFLKEILEYTRIISNCTCLSIFEEEVILMMLLFVLLYFTLNNS
FT                   LSIIKDYFIANFSFILQTPEFLTEINQSKIILTFRKIILKLLNYEINSSGLILELLSIN
FT                   ISEYSENKHFMFFFCNSINHMLVFISSKYTEIIGNYFSKKWSKKINDNIVILETKFDIK
FT                   KLTSNIKKNSIEFTIKEICNLIISIKQMLSIELTPIESQVKLIEATKLNSSNIKNTLIL
FT                   NNLIGKYELTLLIDQLDENRSRIKNRLHLFKQILTFVNIIFNHMLLNERMNYYLLNQIS
FT                   ISIILDIVLLMKVLCYPDTSWNAIFCSFINSLTPISLLNDYSFSIIQSIRKIQREFEHF
FT                   KFIYKNNNSVFDGNSQSSLLKFFLEHKNNEFPTWQWGEEVSIKEIGDNISMVYFRLSTF
FT                   FASSTYRNSNDCKYSLLQITRDFSLNKYLNREVSINNQLMLSSSKLTLLYFIENNQANE
FT                   LLEEFDNIQRMNTESIIKIDVNTNSSEQTRKWWNRRIYIESRLNSWLNKFSNQILKGWT
FT                   SKLFYGWRKELNSEKNIKQVAEFIKTYLIDIDQSLIGIIIFSLTNNIPQILNLLESDNI
FT                   LNFNLKDICVKFKKIKFQSIKNKVENFPTIIFLDKILISLPIESICDLKFQPITRGINR
FT                   RMCKNNIDNLFNQLQKSKESNLRLLASFCNIYYCINPTGDLEETEKTVIEFIKQKFGSK
FT                   CSGISNSIPQATEIMNTMSFNRSNLYLFCGHQAGEKFIQGELFERGIITENLESENYHF
FT                   YMPPSLLIGCSSSKIRSYGSNHVFFTPIHYLIGGSPLILGALWDVTDQDIDRFTMSIFD
FT                   NWVGSKLSLVESITLAKQECKLPLLNGSSCVCFGYPI"
FT                   /protein_id="XP_628445.1"
FT   gene            <659610..>664163
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2770"
FT                   /db_xref="GeneID:3372263"
FT                   /locus_tag="cgd7_2770"
FT   mRNA            <659610..>664163
FT                   /db_xref="GI:66362959"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2770"
FT                   /db_xref="GeneID:3372263"
FT                   /locus_tag="cgd7_2770"
FT                   /transcript_id="XM_628444.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        659610..664163
FT                   /locus_tag="cgd7_2770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66362960"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2770"
FT                   /db_xref="GeneID:3372263"
FT                   /translation="MKEPNCIDNNDTPKQEYLDGKIEHDDSRLSKSIQFVVNEISSLLN
FT                   YSNTSKTREQDTSHFYSESGHLKAIATEIHKTIQVSSAIKLRSNNPLLLSLTALLSNPH
FT                   HTKYLNLMTENIIEGFSENQSKKFNVDELGNKSNDLISKETKNAVVNLIASNLQYYLFE
FT                   GRATNVVINDLVVTLMKAYSSEKTPNKVFDIDWGTNNQVFIEARDWCVLIGPKECIFPK
FT                   TCYELRELLNKKGIKLKSYFENVNTDNISSHKINLVAGGIDSQDTNHSSIDELDTQYFE
FT                   RLSYSKLKEYKSNNIPNYSHFEQIKKFISVQFPNLKTFFYSPGSCIYINGNDVLTFLDI
FT                   LKKATEEKKMEENEIKNNSSMKKVSNSINPYWFLKDTKRIISNFPVKDTVFKASTCDCN
FT                   FIHNPIKSKTQGFYELNIEGLFLPNSMYVILNGFKLLFPDIFTCNVSIESFAEPPFLPN
FT                   EINNPVLIWEKLIPLLNTTVRSISPTLVELANQLKPYTRIHFKNSKANTENVKNNQEQA
FT                   QIQTLNCAIPFFSLPRKRLNPSSQIQNYQRNYSNVNCRNNSQNCVIIGNSAINNSISQI
FT                   QPRNVHASNSSLSNILLDLSTSNGIYDSVNAQVGSIFTHGISNFPHLIGSSSSVENQAL
FT                   LALSQNNTQNHPPLLPSSGIRARTPNSVTTNVQWLNFKGIGISSQTNSNYVSLSTPMGK
FT                   QLLHRIGTINPIQRLEQTQNLIGFQIKSTSLKGLNSNQINSPIEKFITKIFEETALCFI
FT                   GFDSERLDYFTARAVEEGAKVIKFTNLEKEYAKQYSKFAALKEINISNFIYSWLNVTRF
FT                   YCVFDHSKLQPDNKKSLNYSYEKVYHYFEVQQFVSLEWFLTSCFEKRSLDPDMFTPICR
FT                   PTFSIQNTNKLFLTNSVEDDFLVIVIENFPHMNKIYNSSKEGQELLSNAIWGNCIQRIL
FT                   KSIYGPNITNMKEISNVMERNKSKWEKGFPSNVIIVPCNLLPYKSSLNNAYSECTNSPI
FT                   SALYGPGKSQFINDLEVIKNYLNNYNPKKDKNFEEMLHIVTPAWILDSCSKRTKIDYKG
FT                   YEIKYSTSVVQIKRRRRRAKTTSVDAKNNTFKEEVCFFYKQDENSSIRNIIPPQGPWPL
FT                   WGWNVYIIDSIKQRLSENLRKKLKEVGAIYTYSAISFEHVISYSEEQIKDFLNEIEHNG
FT                   INIIVCNDFLDSQLLEKIGMDKYSKDEMSGQPSKGINIVSESWINMVYGTRTLHPFGCK
FT                   FYFNLSLDINKNLGHNKDFNSLKVLESYSASKKLEQNENYNEDQIGCKTFENKFIAFDG
FT                   CGTLAVLENSKNMKEIHKNKARENEITNLHFGECESARYTEYDKVQDSNSSENKSNKQK
FT                   RRRTMNKSLHEMDSTIHFENLNIKTNDKNSVYYEANVKNDNLNALDNGNQTENEFLVPL
FT                   SLSFMSNWAENKNKDCLPLFFSSNTPIRKGYEVKEIRSNTPTQSQSNWINQFNNIEDLV
FT                   DNSACPIESNDDFASQTDKTTTFQKTIDESENDHPVNSTNHYSPILCPIIPVNLHY"
FT                   /protein_id="XP_628446.1"
FT   gene            complement(<664264..>666720)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2780"
FT                   /db_xref="GeneID:3372266"
FT                   /locus_tag="cgd7_2780"
FT   mRNA            complement(<664264..>666720)
FT                   /db_xref="GI:66362961"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2780"
FT                   /db_xref="GeneID:3372266"
FT                   /locus_tag="cgd7_2780"
FT                   /transcript_id="XM_628445.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        complement(664264..666720)
FT                   /locus_tag="cgd7_2780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66362962"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2780"
FT                   /db_xref="GeneID:3372266"
FT                   /translation="MSEHQRLTRKLNPSSKSVKLLNRPLKGKGSNQDEFDPARIEELNS
FT                   PNKSINPIKGLLRPRQKNTTNIQDSNVKPPPSDIGIFNNAQITGNATVNSNTNLPEALL
FT                   AEAIKNNRVKLPGYLDLPARLSKNLDKGIAGLTPGVSTDSGRIHDNLDRLKNEFCRFID
FT                   FKYHASTIGNTDLEQRVFLRNSFEKLKEVDYPTIKMQQWNEYQNLLLEQKKNLLLFQKS
FT                   RGGDQQLDDAWCQTDEQSFDEFVNSNIKLKFDKLKEIKMKRLSLKRRLYLKGYFDITDF
FT                   DDIEQIYDDKMLSRLGLNNQFVNDSSEDELDEMMDFVEKIDSDGRIEYNNYQIRQILSV
FT                   FDRKFKRRCKPDYYQFFFGYLDYEKEKKDKISGLNKLSESERTPKELKLKLIDFLDKKL
FT                   NWTEIETPWEWERDFAIDEMDPLKRGSPKIRLSDMDSSLVKKGIPNEFLQELTEIRKEY
FT                   RRELLDNSLRKFEMDGISTNISDNLSINKEIMKKEIYGSDKKNHYTELINKAKVESDYD
FT                   EANLLSKLKKGHFAKSKVINKVRFRNEPEIFNQKNFDEQKYKIIIEEENSSDCNSIEIG
FT                   LSNSSDNKLDIHQSNMCQDLTSKLEDDIVVSLNKLILTKGISDELKNDLVKHLDKILLQ
FT                   TNRNPPDSQPSIVKDSTNQSKNVLGNKAATTKSKYISHSKQLSVLVNGSALGIQEKNKN
FT                   FDELIDGKDTKLINKSVKQSEQQKRAELNMDIDSFEKNLNTLRTAAGVLQVLGEIEEES
FT                   NLINNHNKLKKIISEKVENNGFDLETNEIKTIEDGVEALIKEILDKRKIGKQKPKSESK
FT                   LVGQTE"
FT                   /protein_id="XP_628447.1"
FT   gene            complement(<667071..>668255)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2790"
FT                   /db_xref="GeneID:3372265"
FT                   /locus_tag="cgd7_2790"
FT   mRNA            complement(<667071..>668255)
FT                   /db_xref="GI:66362963"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2790"
FT                   /db_xref="GeneID:3372265"
FT                   /locus_tag="cgd7_2790"
FT                   /transcript_id="XM_628446.1"
FT                   /product="regena domain protein (CCR-Not complex protein
FT                   subunit 3), putative"
FT   CDS_pept        complement(667071..668255)
FT                   /locus_tag="cgd7_2790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regena domain protein (CCR-Not complex protein
FT                   subunit 3), putative"
FT                   /db_xref="GI:66362964"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2790"
FT                   /db_xref="GeneID:3372265"
FT                   /translation="MADSELNLICSIFSKCESDLKAIVSIVNILSKNKYEVNKFETEIR
FT                   EIKEKLHIVEKKIVESRIVSSNQTDFVSEKYILEKCHESLQSLKGSIVNFKEIKMNNDH
FT                   SQGDKKLQINDFESKSVGDLLNDEFSELRIDNEVKLSQINADNYIKDSFSPEKLNENDI
FT                   YTRERIVKPGNNTEIPIENTDEYKHSIGFRMDVSKHLNTDILDNSFNNKLEIQDSIGRH
FT                   IQYTPRMVWHNPRSDFPSRPLEKLANTSFFDKLALDTLFFIFYFQQGTFQQFLSIQELK
FT                   RKKWQFHKKCFAWFYKRSDSKITTEDAEVADYIYFDFEKDWCQKIKNDFAFEYIHLDDT
FT                   PIVINKNNESNACYNSKACADKDQISFNSDISENIFNADGAINDHCTINNPSNK"
FT                   /protein_id="XP_628448.1"
FT   gene            <668619..>669079
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2800"
FT                   /db_xref="GeneID:3371832"
FT                   /locus_tag="cgd7_2800"
FT   mRNA            join(<668619..668820,668868..>669079)
FT                   /db_xref="GI:126653428"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2800"
FT                   /db_xref="GeneID:3371832"
FT                   /locus_tag="cgd7_2800"
FT                   /transcript_id="XM_001388353.1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT   CDS_pept        join(<668619..668820,668868..669079)
FT                   /locus_tag="cgd7_2800"
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /db_xref="GI:126653429"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2800"
FT                   /db_xref="GeneID:3371832"
FT                   /translation="ETIINTYFFSRENDLMYWDGEIVGPDETPYEGFVFKIEIIVSPQY
FT                   PILPPSVKFVTPIFHPNVNFFTGEVCIDVIKDNWTPAWTLHAVCRAIISILCDPNPNSP
FT                   LNCDAGNILRCGDKKGFNNMARMYSLEYASKYK"
FT                   /protein_id="XP_001388390.1"
FT   gene            complement(<669088..>669885)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2810"
FT                   /db_xref="GeneID:3372267"
FT                   /locus_tag="cgd7_2810"
FT   mRNA            complement(<669088..>669885)
FT                   /db_xref="GI:66362965"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2810"
FT                   /db_xref="GeneID:3372267"
FT                   /locus_tag="cgd7_2810"
FT                   /transcript_id="XM_628447.1"
FT                   /product="ortholog of kin17 (RNA metabolism proteins): a
FT                   family of highly conserved zinc binding C-rich proteins
FT                   with KOW domains"
FT   CDS_pept        complement(669088..669885)
FT                   /locus_tag="cgd7_2810"
FT                   /gene_family="HOG000200247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ortholog of kin17 (RNA metabolism proteins): a
FT                   family of highly conserved zinc binding C-rich proteins
FT                   with KOW domains"
FT                   /db_xref="GI:66362966"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2810"
FT                   /db_xref="GeneID:3372267"
FT                   /translation="MPKAEVGTVKWLSKQIKSKGLQKLRWYCQLCEKQCRDENGFKCHR
FT                   MSDAHLRQMEVFEQNSKKILNDYSKQFELAFMRLMKTRYSKSKVLANTVYNDLIHDRNH
FT                   IHMNSTIWTTLTEFIHYLSNTNKCEIEYSDKGWYIQYIGHEGEKKNKDLDSKNKFRLTE
FT                   DNRRERRIGMVVKSNSSSNQRASFIQRCPTVFLRNTTNLEDDDGKISIQINNNRNNISE
FT                   HNSVQNLFNFQEQDFTCNGNFEFQNCCQEKYKVRSSSLSREGY"
FT                   /protein_id="XP_628449.1"
FT   gene            complement(<670061..>672712)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2820"
FT                   /db_xref="GeneID:3372268"
FT                   /locus_tag="cgd7_2820"
FT   mRNA            complement(<670061..>672712)
FT                   /db_xref="GI:66362967"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2820"
FT                   /db_xref="GeneID:3372268"
FT                   /locus_tag="cgd7_2820"
FT                   /transcript_id="XM_628448.1"
FT                   /product="hypothetical large low complexity protein"
FT   CDS_pept        complement(670061..672712)
FT                   /locus_tag="cgd7_2820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical large low complexity protein"
FT                   /db_xref="GI:66362968"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2820"
FT                   /db_xref="GeneID:3372268"
FT                   /translation="MQFSKFQSLRSSISTAENEQQLFNDNIRSTFGDRLYFSNYDDELK
FT                   DELNLSLNSREKKTLENDEYIETWEGNDEGLLWGKKEARDKSWKEEWIEQRNIPKDSNI
FT                   SQMPYSEDESPNNINFQCLKNELRENSNEQSLSLCEKFENCNRASLGQLIGVDYKKNRR
FT                   WKEKWFRRGRKLFVRKFVQQLCENNSRVLKVWFEDSEFIFDSINIYSNPNKLSWKLVRN
FT                   NKYGKIISDQKEWKESNDFYDDYNIILYEERGISNGSNKYPYFYSKRKKVFKDNSEIIY
FT                   SKYYKGYGGENETFDIEAISSGHSSSNLTFDGLCPTNSVDDIKYSESWSECIEIDSHGN
FT                   KKGRKYGDKDNTELHEVWFEEIDGSKEYDIWYENDEIQWGEKIGYSKSNNESFKVKWEN
FT                   KKEQGGLKREKYIEKNWEKVGEQNSWGEKFTEVVDQTSLGKKIQIVKENWYNNGAEVFR
FT                   EECNEESQFNDLDEDKLPDLIIRRGEKRGERFATGETWSENWNESLKRSEINQKIIRTK
FT                   LFTDKWWTKKNGEKWGEKKTIQLKLESNYDKDSKILDEKVVDSIPQNEHLYIENTESWY
FT                   LSEFEEYSDTWETDGLNQHGYKKGIDRKHDNNRFIKWEEKWNKDHLKKLKKKCTWELMD
FT                   DSGLIEVWTEDQFQDQSGNFIVNKRGRKYNLDNRTEVIEEWEEACNDDGNGNLYTKKQG
FT                   KGRENWYLDEFGKSDYTGEQWAVKQGFDNEGSWSERWSERSGYKEAWKKGENRYGDKWE
FT                   EEWKEDFENKWKWARKSGENNVGDLWKEEWREEIDTTNHISKKSASKKGKKMISGEEWS
FT                   EEWGELYYGIGNESMGDGGIHAEYMEKWANKYATDGSGNEWGNSWGDMWNWSKKVKSWG
FT                   EKWENSNITEKW"
FT                   /protein_id="XP_628450.1"
FT   gene            complement(<672878..>675271)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2830"
FT                   /db_xref="GeneID:3372269"
FT                   /locus_tag="cgd7_2830"
FT   mRNA            complement(<672878..>675271)
FT                   /db_xref="GI:66362969"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2830"
FT                   /db_xref="GeneID:3372269"
FT                   /locus_tag="cgd7_2830"
FT                   /transcript_id="XM_628449.1"
FT                   /product="hypothetical low complexity protein"
FT   CDS_pept        complement(672878..675271)
FT                   /locus_tag="cgd7_2830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical low complexity protein"
FT                   /db_xref="GI:66362970"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2830"
FT                   /db_xref="GeneID:3372269"
FT                   /translation="MIGNEVHIVQYHPPINWVLLKSDLISGRINNQTLERYSHNLIYPF
FT                   VSCNDRTIDSLSRVFSRIISNEFQINTFLRKLGFFVSSRLNEKLYKIDECLSSRQIYQS
FT                   IIDIWLKSDKEFEKISSNMTKNEIKKKSHQNTEQIFNSQLNVNFVSILRNIIKKCGDEN
FT                   KNITIWSIIPENNMEFNSSFESTEDDAMPIKIIEGLLSICFNDLQREFFNLRNIKINLI
FT                   LIIKYSKVLLSISSDKRPTIITNQSNHQIKISCVDSRCLLSYSDVIIANSLNLLTLRLD
FT                   FSNLFFGGNTILTLFAEKNNYLLKYVDKNAYNEYIDRKIDPTDLSDSEEGEVVEQENII
FT                   AIMENEFQKKGWDRLVDNISMKIIGFVPSHWSPTAIKLFPLTSPVGRNSFKLLQEVYHS
FT                   LNFGSILLGINDIPSAAIIINLSKMKSRNCNKGIPRNDFIKQINETKRSPESGCVSTTL
FT                   KRNLFNLVIINRNPIIPLPISRKFQCENKVNMTTNINISQIDDKYILFASGKFQELFHK
FT                   VKTAVDLNIIINKNVYCMIDFCNFEKKNKCLDLILIKKLNFSQDICNLIKITMAGLPSL
FT                   LTEFEYFITKRMSQGEIYSLKDFVSNFEDEKEYFESKFFIRKTKLIDLIFPIIHGIERK
FT                   IILNNFLKTKINCQTGKAQDMQVLVSKLDKYLSLLLGELPMNGCLFSCKGISSETIALI
FT                   IAEREFVRQSVPKLFWLSIYYLVNSMKFISREHQRIFYIISTGKDFEPSIHLKIPNSKS
FT                   DNFFLLDKSNDYAARISYFDKALSKIDESSIFGSTNHSKKFNFE"
FT                   /protein_id="XP_628451.1"
FT   gene            complement(<675391..>675921)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2840"
FT                   /db_xref="GeneID:3371833"
FT                   /locus_tag="cgd7_2840"
FT   mRNA            complement(join(<675391..675720,675772..>675921))
FT                   /db_xref="GI:126653470"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2840"
FT                   /db_xref="GeneID:3371833"
FT                   /locus_tag="cgd7_2840"
FT                   /transcript_id="XM_001388354.1"
FT                   /product="ubiquitin conjugating enzyme, putative"
FT   CDS_pept        complement(join(675391..675720,675772..>675921))
FT                   /locus_tag="cgd7_2840"
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin conjugating enzyme, putative"
FT                   /db_xref="GI:126653471"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2840"
FT                   /db_xref="GeneID:3371833"
FT                   /translation="MSFSRKRIAQERAEWRKDHPVGFSAKYAPSEDGEGQDMMKWICKI
FT                   PGKSGTLWENGEYTLNVTFPEDYPAKPPKCIFQPPLFHPNIYPSGTVCLSILNEDEDWK
FT                   PSITMKQILLGIQDLLDNPNIKSPAQAESYQLYSNNRAEYNRRIKQQALQNRPSD"
FT                   /protein_id="XP_001388391.1"
FT   gene            complement(<676088..>678109)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2850"
FT                   /db_xref="GeneID:3372270"
FT                   /locus_tag="cgd7_2850"
FT   mRNA            complement(<676088..>678109)
FT                   /db_xref="GI:66362971"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2850"
FT                   /db_xref="GeneID:3372270"
FT                   /locus_tag="cgd7_2850"
FT                   /transcript_id="XM_628450.1"
FT                   /product="cathepsin like thiol protease possibly membrane
FT                   associated"
FT   CDS_pept        complement(676088..678109)
FT                   /locus_tag="cgd7_2850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cathepsin like thiol protease possibly membrane
FT                   associated"
FT                   /db_xref="GI:66362972"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2850"
FT                   /db_xref="GeneID:3372270"
FT                   /translation="MQIGFTEKDLQIPNKSCGRKWNKFIVFINFISFLSIITKINGNLL
FT                   HNGNHSMNGNESGVSRTLKQEKDDHSILIGKKNETNTEIFSPNNYSSQSSTKLVDHRTE
FT                   NFIEKDFQKNNSLVEEDNLTSKFFDPFVFNFSIDVHQCISKYEKLNKYLQKISLIFYLF
FT                   NKTRELENEGLNNNSTSILKAENERVVNTTIKINIATNSGKMDNHLDIIIQPEVFFNSI
FT                   YRTNTTWMDRLLDTPNINSSPMNLLNLTNNQDNSQSIIDCICIFVSEVQSNLGLNRSSL
FT                   EICNIKIQEIISAIKSNPEARFELTQLSLDRPPSKLIIPKNLGDKVTGYSWKESIAEGK
FT                   EIQSENLLGRSVQKLEPTHSSGNEILKELNTENSNAGNGVNETGEITNKNIYFDSRDVN
FT                   GGSCVYIPFDQGKCGGCYAFVVSASISISNCIQKLVLPAPLSPQQIIDCSMSFGNLGCD
FT                   GGFYSNGWSYLLEQNVPRNYICSWNEYPYIDSISSCKASACNGCLTISKYNVFTGLALN
FT                   GDDGWDFVTTILPKVGSISLSINSNLPGFSSYSDGIYKAPKCTTHSELNHAVIMIGYGI
FT                   NDNGDKYYVIQNSWGVSWGIGGFMNVSADSCDMFWYPGIIRQVSSESLPDKCTGNKLLL
FT                   TGPGEINKPQKKSTEYNIFLKKTYYGICLIINILLLVY"
FT                   /protein_id="XP_628452.1"
FT   gene            complement(<678303..>680780)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2860"
FT                   /db_xref="GeneID:3372271"
FT                   /locus_tag="cgd7_2860"
FT   mRNA            complement(<678303..>680780)
FT                   /db_xref="GI:66362973"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2860"
FT                   /db_xref="GeneID:3372271"
FT                   /locus_tag="cgd7_2860"
FT                   /transcript_id="XM_628451.1"
FT                   /product="uncharacterized protein with predicted coiled
FT                   coil regions"
FT   CDS_pept        complement(678303..680780)
FT                   /locus_tag="cgd7_2860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized protein with predicted coiled
FT                   coil regions"
FT                   /db_xref="GI:66362974"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2860"
FT                   /db_xref="GeneID:3372271"
FT                   /translation="MSSKIPCLIRPTNLKKPSTISSQIKTDINNLSDSKQKLNPAKSLK
FT                   NENKENNLLRSKANSQSSMNFRVPRVAYLSDKVQSKNTKTEIKQSSKTVTKKVSSSSQV
FT                   NLKNISKNTLIQNSSLSNQNIKSERDNVSKCLSIRQQSLIKERELRLEKTKLKLESAEN
FT                   KLSQELLLSELIESELKLQLEYLDENNSIYFKEIELIQEFEKTLKCEIINLENQISKME
FT                   CNLYNLKDLDYIKSSIDDFKLQNVDIEQTIKLISKEILECEKSIEFYELEKDDGELIFQ
FT                   NLKVPFNKSIEYSLNLEKLLQNDKLLINQLQFRLHKLTKNPKFICRTYSSEIPQLSKVH
FT                   ISIPSCGKKTIAVDKTENKDIHQSISQKNRFVGNEVKLKIDIKKFQFSIGKETIRFDKI
FT                   IEFDDTKRPSTLLLTDLSIIDKQISNIIDKIDEPQSSTCYQPKIHYKNNIIRRQSLIYS
FT                   KIDSETEKNPFEMSSLNNCVEKSKYYLVDINEQKEVEMDILLLINDLFNNIKLVFSEKS
FT                   DLHDKSKSNNSPISEISSIFITNVGSNSAASRQTFWGTNDARIVSICDGISEYNDRQGI
FT                   KDRNKKIPGILHSVIYQIFQNINHSSLFNWKLSADVLIQKSTNIHEDIENKSNQVDFGT
FT                   QQSFNCEKLLNFDGGLSGYISTEQNLSLENFALVNNHSKSNCNNILSGLNFRNTAIGKS
FT                   KTISNCEYKSSEEFISQIYKEIETLSPNFLSSINAYRLKEELLSLSKESPNFHLIIILK
FT                   IEAIISNSSISSNIVLTDFFIDEDGTADNNIVDYFSTVKGNPVNNQFMEIFSHLRKNSQ
FT                   TEPLIYTLVHSII"
FT                   /protein_id="XP_628453.1"
FT   gene            <681594..>685421
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2870"
FT                   /db_xref="GeneID:3372272"
FT                   /locus_tag="cgd7_2870"
FT   mRNA            <681594..>685421
FT                   /db_xref="GI:66362975"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2870"
FT                   /db_xref="GeneID:3372272"
FT                   /locus_tag="cgd7_2870"
FT                   /transcript_id="XM_628452.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        681594..685421
FT                   /locus_tag="cgd7_2870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66362976"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2870"
FT                   /db_xref="GeneID:3372272"
FT                   /translation="MREIALNNIELERRPNWWRGSESENILDPYFKKPIYSGKSKFNFF
FT                   PKFLKDNMKWFKNRIPSNNTNDDYSQLNEYDKKAIIEFSKQQKITQGQESSRYKYISPY
FT                   SEYLLERLKWKIALRIYYTLDPNDKGYIELEHSKKLLFEMLKVDTEKAQTLLLLLETIK
FT                   PFYAKDGCVEKNDIIIYLAREIFDDTRGYGLFSKLNNIFKNPISRSKKRNNDCFINGFQ
FT                   DVYMPNKKQICFSSDPNAIKLNETNVKQSNSKDTNYNCTYCQNKNKACITCKMKKNCTG
FT                   KLRDHIKISEDRKRKLIERIKEEKKEINDKNMLECTFKPEILWPIGKFINKNNKSWLKN
FT                   KKNLKGSKLPQEKKNEICGYEIINEQNIEDKNIQVFLNQGYYFDSLNNWNGYIHDSITN
FT                   QVYVIHKGYFMDDHNVDKNEIFYRKTDKEEQKEIRNKMLDSIMRKINIEFQTLENNENG
FT                   NEKKKSLNFGTKKLVDKLRAERETGTNDPRLNTPEFTIEVNHPEFVEKIVDFSEIKPYK
FT                   NVTNHEDSEIKREYSTSPCYYYLPRGYERIGNCFNEIRFRRKLDFLKDSVRDNRNIDTN
FT                   NSSNLKVKSNSFINKEFNTKNSSLCLDEKPAGLIEDTKMSKIFNKSAKIDPSSLKDLNK
FT                   IVGAGQSKNVQVESLGGLKKNNGLDQHLLLKSPSKNETNIIGSHVNDESDFQKGSILAT
FT                   KFKKELEASIKTKNSLKVSSKIDSSIHLIKKEADTSIQTKSNLKIPPIKKEADTSIQTK
FT                   SKLKIPPKKDLSTPPVKKEADTSIQTKSNLKIPPKKDFSTPPIKKEADTSIQTKSNIRI
FT                   PPKKDFSTPPIKKEADTSIQTKSNLKIPPVKKEADTSIQTKSNLKVPPKKDFSTPPIKK
FT                   EADTLIQTKKSLVIPPKKDSSVPVMSKEADTPIPIKNNLKIPSKINPSMPPIKRVVVTS
FT                   TQAMNCLKIPQMEAASVPPIKKEVDTSIQTKKSLIIPPKKDASVPVMNKEADTSIQTKS
FT                   NLKIPPKKDLSTPPVKKEADTSIQTKSNLKIPPKKDFSTPPVKKETDTSIQTKSNLKIP
FT                   PKKDFSTPPVKKEADTSIQTKSNLKIPPKKDFSTPPVKKEADTSIQTKSNLKIPPKKDF
FT                   STPPVKKEADTSIQTKSNLKIPPKKDFSTPPIKKEADTSIQTKSNLKIPPKKDFSTPPV
FT                   NKEADTSIQTKSNLKIPPKKDFSTPPIKKEADTSIQTKSNLKIPPKKDFSTPPVKKEAD
FT                   TSIQTKSNIRIPPKKDFSTPPIKKEADTSIQTKSNLKIPPKKNGLVTSLN"
FT                   /protein_id="XP_628454.1"
FT   gene            <686315..>686761
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2880"
FT                   /db_xref="GeneID:3372273"
FT                   /locus_tag="cgd7_2880"
FT   mRNA            <686315..>686761
FT                   /db_xref="GI:66362977"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2880"
FT                   /db_xref="GeneID:3372273"
FT                   /locus_tag="cgd7_2880"
FT                   /transcript_id="XM_628453.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        686315..686761
FT                   /locus_tag="cgd7_2880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362978"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2880"
FT                   /db_xref="GeneID:3372273"
FT                   /translation="MQDEFVDHKLETELFSILSPELLNEIMIEEFPHIRLGPSVSQVLT
FT                   TLTNGFIQDVVKNSYIISKHKNHSEVQADDILVYLRMKYPDTKLEEFCETISQRKEGRS
FT                   GAGTLESEEGNAVSNSGLLSIKLFNTERFKSNSKIINNLRNSSI"
FT                   /protein_id="XP_628455.1"
FT   gene            <686799..>687860
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2890"
FT                   /db_xref="GeneID:3371974"
FT                   /locus_tag="cgd7_2890"
FT   mRNA            <686799..>687860
FT                   /db_xref="GI:66362979"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2890"
FT                   /db_xref="GeneID:3371974"
FT                   /locus_tag="cgd7_2890"
FT                   /transcript_id="XM_628454.1"
FT                   /product="SLBP family of RNA binding proteins"
FT   CDS_pept        <686799..687860
FT                   /locus_tag="cgd7_2890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SLBP family of RNA binding proteins"
FT                   /db_xref="GI:66362980"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2890"
FT                   /db_xref="GeneID:3371974"
FT                   /translation="AALFIIITRSLGIFKLLSKIEERRISQRLKQINIAKNSVGYQRYT
FT                   TAVRKNERKRELSFTWHPSTPDPYSNTSKSCFSGRLKEWKLRLHLWGNLDDLEYSNLIQ
FT                   NNLKFPPGANSNPFSKVNYFENILDNGNDNTNESSLKFIRFSELRISPISFSGQNSLIK
FT                   TNRGERISKSDSLVNSIKLSRKILLPKVMDCEKSHDIMKYITLFIPDNYKGMLIWKSTN
FT                   FIRHCDIILTAHKHRLKILKHGLSLFEFNKRYNIDVSGLAHNSNNFLKDIQISISGIDS
FT                   NSNKLCKLSDKPYKNICTLISHQKMISHFSKKVVLTQNKLFGFREQDVFKLSFAYHPSS
FT                   IIYYKILEKLHKS"
FT                   /protein_id="XP_628456.1"
FT   gene            <688087..>689028
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2900"
FT                   /db_xref="GeneID:3372274"
FT                   /locus_tag="cgd7_2900"
FT   mRNA            <688087..>689028
FT                   /db_xref="GI:66362981"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2900"
FT                   /db_xref="GeneID:3372274"
FT                   /locus_tag="cgd7_2900"
FT                   /transcript_id="XM_628455.1"
FT                   /product="26S proteasome regulatory subunit, inactive JAB
FT                   domain protein"
FT   CDS_pept        688087..689028
FT                   /locus_tag="cgd7_2900"
FT                   /gene_family="HOG000209236" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="26S proteasome regulatory subunit, inactive JAB
FT                   domain protein"
FT                   /db_xref="GI:66362982"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2900"
FT                   /db_xref="GeneID:3372274"
FT                   /translation="MCLSGEHSGAALYKVNSSLSNRKNIIIHPIVLLSIVDHYNRIAKG
FT                   TSKRVVGTLLGELHDEDGIHVTNSYALPFEEDSRDPMVWYLDHNYHEQMYLMFKKINTK
FT                   EKIIGWYSTGPKTKVVDIDIHELFRKYCPDPLYLIADVTADDFEYLSSPISAYFSMDEP
FT                   NSVLKKKFAHVPCTIGAFEAEEVGVEHLLRDLKNTSTSTLITQISDTINSCKILVSKLK
FT                   ESKNYLNDIVEGRIPPNHSIISVLQDIFNLLPDLREPEAIYAFSNRYADMILTIYGMSC
FT                   LRSVLSMNDLVNNVSENRTAFEASMKTCNSDL"
FT                   /protein_id="XP_628457.1"
FT   gene            <689161..>691164
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2910"
FT                   /db_xref="GeneID:3372275"
FT                   /locus_tag="cgd7_2910"
FT   mRNA            <689161..>691164
FT                   /db_xref="GI:66362983"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2910"
FT                   /db_xref="GeneID:3372275"
FT                   /locus_tag="cgd7_2910"
FT                   /transcript_id="XM_628456.1"
FT                   /product="Abd1p; RNA (guanine-7-methyltransferase (cap
FT                   methyltransferase)"
FT   CDS_pept        689161..691164
FT                   /locus_tag="cgd7_2910"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Abd1p; RNA (guanine-7-methyltransferase (cap
FT                   methyltransferase)"
FT                   /db_xref="GI:66362984"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2910"
FT                   /db_xref="GeneID:3372275"
FT                   /translation="MSRETSKIRFLSLSRRSCLNDVVKNFIIQCSSHSDHEIIAKFGEI
FT                   KGYYSRMSINLPVACDCILEHGSSDYKFEEKIGRKQQSYLIERIIRANRESWLVAEKVG
FT                   IDLFFEEKYSNGTVSIDNNGDKSSFCELNLGEVVVYKPKSKVHFTITGISRSTIDQPKS
FT                   DIPLSRYKKSVISWNFQRKSGSAYPFWDLKIINVISSSERKRRREEHYDMRNDLTEGSS
FT                   PDSYSKDENDDEDEYWMVVFSGNKQLISKHVDLYNKGQINGLDRITNELIYNSSLIAKY
FT                   LDEAISSNSCNIYPISYYYPNFFGDITTSIRAHYNMKKIQNADYSIIGGLRKYNNEVKR
FT                   ALIDQYFERQLKYRQNRHLSVLDLACGHGQDILKFKGKKISRLIGIDISAEEISEARHR
FT                   LKRYENSLNFSVEYHVGNLLSRTTYSKILKNYTFEIISIQLSMHYMLINEETSLEFLRN
FT                   ISNYLKPGGFFIGSTISCDHIFYSMKQNSVKINLNENTEDANDSNGNLNNTKYVSGNSI
FT                   YKISFSCDDWDKYFSDNIDLERGIKLFRTEWGIKYDFWLIEHINQYEYVVPWESFCGLA
FT                   SKVGLELVQYSDFPSFTEFTQKNFPNIRFSNWLNNPKNSGLITQPENEVFGLYCVFAFK
FT                   KIENSNINLDEQGITCDFQLSKNLTSGFKIKR"
FT                   /protein_id="XP_628458.1"
FT   gene            <691316..>693691
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2920"
FT                   /db_xref="GeneID:3372277"
FT                   /locus_tag="cgd7_2920"
FT   mRNA            <691316..>693691
FT                   /db_xref="GI:66362985"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2920"
FT                   /db_xref="GeneID:3372277"
FT                   /locus_tag="cgd7_2920"
FT                   /transcript_id="XM_628457.1"
FT                   /product="DNA replication licensing factor MCM5 like AAA+
FT                   ATpase"
FT   CDS_pept        691316..693691
FT                   /locus_tag="cgd7_2920"
FT                   /gene_family="HOG000224128" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA replication licensing factor MCM5 like AAA+
FT                   ATpase"
FT                   /db_xref="GI:66362986"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2920"
FT                   /db_xref="GeneID:3372277"
FT                   /translation="MQNSIGTIYYSHPTRDLEKGDWNNDTVNSSVGLLSLEECRSKFSN
FT                   FIKNFNQGGEYIYREMLINNISIGEYTLRLELHHLSIDEVSCSEMGENTENASYDGNLI
FT                   DGQENDSDNFVNGVRTSNELCCLIQCFKNAPLKYIPICEGVLKEVYLELVGKHKKEISE
FT                   EEINEIVPDIQLQIVSNQEPTLIRDLRSNVMEKLVTVPGIVIQSSKPQKKASKLKILCR
FT                   QCKGTRNINIPIWRQGTMLPRVCNTTPIGDAPKCPLDPYFTLCDESEYIDIQSMKFQEL
FT                   PEHVPTGDIPRNISLHMTRGLIDKVIPGNRLYVVGVLSSTDKESSKAHSSSRNGSLRTS
FT                   YLYVIGVMNYGSSWSNKNTNTLIKNSSISNQYNEIEEFRRISSLPNIHELIVNSIAPAI
FT                   YGNETIKQAIACLLFSGSSKCLPDGNRIRGDLNVLLLGDPSTAKSQLLKFVEQVAPICI
FT                   YTSGKGSSAAGLTAAIVKDHANGVYALEGGAMVLADGGVVCIDEFDKMRDDDRVAIHEA
FT                   MEQQTISIAKAGITTILKARCSILAAANPTFGSYDDSKDLTQQHDFESTILSRFDLIFL
FT                   LKDEKNVERDKLIASHIVELHSGIKGKINGDCSESTNSLQFEQLQKYINYCREFIHPRL
FT                   SLDAAAILENFYVKIREDNREDTNKASKDRIPITVRQLEAITRIAESFAKMEMQNIASE
FT                   KHVEMAIKLFKNATIEAIKSNILLLDNLSPAEQSAIIDAEVAIKNRIPIKARAGKATIV
FT                   KDLALIGYDPYYLTKAMKILIQKGDLIERSDFSIFRVK"
FT                   /protein_id="XP_628459.1"
FT   gene            complement(<693718..>694380)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2930"
FT                   /db_xref="GeneID:3372276"
FT                   /locus_tag="cgd7_2930"
FT   mRNA            complement(<693718..>694380)
FT                   /db_xref="GI:66362987"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2930"
FT                   /db_xref="GeneID:3372276"
FT                   /locus_tag="cgd7_2930"
FT                   /transcript_id="XM_628458.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(693718..694380)
FT                   /locus_tag="cgd7_2930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362988"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2930"
FT                   /db_xref="GeneID:3372276"
FT                   /translation="MNSRYPGYDNEFNSNLAESFELDTDLNQLALQRGEAREKTNASIE
FT                   NSSSDHTAQNANGSLANKIKMNRSRNPKKSTSNQSSGIISSFKSWTHSLIAHSSRQNCQ
FT                   GRRQRPRNIDTTVNMETANTECHGSISQIENRESNILRTEISDEELARRIQIEELNGIG
FT                   SFHIMEDSSNLPLYSLGSFQDANYYPNVTVSSSESTAISPFQGVSYKFEFRSSDDEQ"
FT                   /protein_id="XP_628460.1"
FT   gene            complement(<694862..>696469)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2940"
FT                   /db_xref="GeneID:3372278"
FT                   /locus_tag="cgd7_2940"
FT   mRNA            complement(<694862..>696469)
FT                   /db_xref="GI:66362989"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2940"
FT                   /db_xref="GeneID:3372278"
FT                   /locus_tag="cgd7_2940"
FT                   /transcript_id="XM_628459.1"
FT                   /product="coatomer complex delta chain"
FT   CDS_pept        complement(694862..696469)
FT                   /locus_tag="cgd7_2940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coatomer complex delta chain"
FT                   /db_xref="GI:66362990"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2940"
FT                   /db_xref="GeneID:3372278"
FT                   /translation="MVVFSASIVSNRKILLSRQFVEMTRGDVEAYLNRFIKKIEQFCLS
FT                   SEYTYMEIDNIRFIYQAIDNIYLILMTPINSNIIEDMDTLQLFCQVLYDCCNNPPPITE
FT                   DLIANNCFDVIFAFDEIVSFGYRESINLSQIKTCLEMESQEEKLHKLIRQNKENEEKER
FT                   RRHIANRLDKERVTNEAFNQSNYASTNSNNNIVKSSLSGIAAFAESVGVGKIAQSVGIG
FT                   PIKNISRNDNNLVNNSDPAGDSRNFGMFVNESTAIQSMNAPGKGMLIGKKKPITESKPN
FT                   ISLPSKVMDNHSDFKLKENICNTLDIKYTEDDCSLIEEKIEFSLSVDGKIQSKVEIQGT
FT                   FQVALPSEAFPEYSITEDPRFQFKTHPNLNKEKFQDCGILELKDGINCTLPVNTLMPLV
FT                   KWRPSSHFQNNQIELPFSFSYWPLDAGNGYTNVTIEIEPSQSITNFKLNIPLTFVSTYN
FT                   TNLGAFESNKNSYSWDIPQLSPSETAVLEFSTNQSNFLPIDLCASTSISVCKVRIMKDK
FT                   NYVNPKRCITKYNIAINQ"
FT                   /protein_id="XP_628461.1"
FT   gene            <696835..>698052
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2950"
FT                   /db_xref="GeneID:3371975"
FT                   /locus_tag="cgd7_2950"
FT   mRNA            <696835..>698052
FT                   /db_xref="GI:66362991"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2950"
FT                   /db_xref="GeneID:3371975"
FT                   /locus_tag="cgd7_2950"
FT                   /transcript_id="XM_628460.1"
FT                   /product="phospholipid cytidyltransferase HIGH family"
FT   CDS_pept        <696835..698052
FT                   /locus_tag="cgd7_2950"
FT                   /gene_family="HOG000283367" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phospholipid cytidyltransferase HIGH family"
FT                   /db_xref="GI:66362992"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2950"
FT                   /db_xref="GeneID:3371975"
FT                   /translation="LKLINMNTKNSNNSRIFVDGVFDLMHAGHFNALRKAKQFGNELVV
FT                   GINSDLDCFNLKGCYPIYNQDERGELMKGCKWADEIVIGTPYIVEGSLLNQLNCEFVAH
FT                   GDDLVLCSDGTDPYNEPRILGRLKIFQRTEGVSTTSVMTRIFRVLGLELEDILPLNKFD
FT                   NSGMNGKENFIASKIDKFLDGDYSPCQSLISASRVLSFACGIASAKQVYNSNPNVTYID
FT                   GSFDIFHIGHLRFLERVKKIFGGVLIIGIYDDSTAQLIYGDGFPILKMMERALTLLSMR
FT                   VVDDVIFGAPIKITKKLIETYKINNVVSCKIIENYVSSEHLKKNNFDSENSAEYASKLE
FT                   EFCYEIPKKMGIFCNTTILKKEEICTNRDIFSRIMNRRDSILYVIKKRWAKELSFYENE
FT                   VNTKLH"
FT                   /protein_id="XP_628462.1"
FT   gene            complement(<698072..>699112)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2960"
FT                   /db_xref="GeneID:3372279"
FT                   /locus_tag="cgd7_2960"
FT   mRNA            complement(<698072..>699112)
FT                   /db_xref="GI:66362993"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2960"
FT                   /db_xref="GeneID:3372279"
FT                   /locus_tag="cgd7_2960"
FT                   /transcript_id="XM_628461.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(698072..699112)
FT                   /locus_tag="cgd7_2960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66362994"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2960"
FT                   /db_xref="GeneID:3372279"
FT                   /translation="MMNMDKKHNSFFSNLKGKYKVFSMNNAKHRIFSRKKAGSKKCENE
FT                   KIKGINVSFENTYLDSIVNSSNEHISSNCMSSSPDNMSHDSNNCNSQERQGSKFEYKLS
FT                   KSTTKIENKTAINSNSSPSLNETFSDNSSTSLFSDSSTILSSKYKSNHSSDTQSSTYNR
FT                   SNIQDYNQNTDYNCSDTSRKENISQEQGIPIKKRIENAVEGKKKTKLQPYKRNNSGENN
FT                   NCRESKPYLNKEILDILNSKYHNREEKRTTQQVVAIEDLGVDDKNTEINAISRSENNSY
FT                   RQEVERYLFKDLNVYFGWETPLVIPIITEPDCCYQSSYSNYDILIDYACIDGDKCHLCS
FT                   FIEGIH"
FT                   /protein_id="XP_628463.1"
FT   gene            complement(<699218..>699718)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2970"
FT                   /db_xref="GeneID:3372280"
FT                   /locus_tag="cgd7_2970"
FT   mRNA            complement(<699218..>699718)
FT                   /db_xref="GI:66362995"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2970"
FT                   /db_xref="GeneID:3372280"
FT                   /locus_tag="cgd7_2970"
FT                   /transcript_id="XM_628462.1"
FT                   /product="possible acyltransferase"
FT   CDS_pept        complement(699218..699718)
FT                   /locus_tag="cgd7_2970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="possible acyltransferase"
FT                   /db_xref="GI:66362996"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2970"
FT                   /db_xref="GeneID:3372280"
FT                   /translation="MQENKNLASLICQESNISGNVELDEGCIVHPSALIDGGVGGIIIG
FT                   KNNIIEESVKIVNKTINKMPIGNNNWFHVRCEVDSALSIGDNNSFEVGSRVNKNVKIGN
FT                   NCIISLKSSLPPNLEICNDMCVSQVGDSLLYAPINSSPNKHLCEQVNFLNNILRGSSME
FT                   KKR"
FT                   /protein_id="XP_628464.1"
FT   gene            <700264..>701595
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2980"
FT                   /db_xref="GeneID:3372281"
FT                   /locus_tag="cgd7_2980"
FT   mRNA            <700264..>701595
FT                   /db_xref="GI:66362997"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2980"
FT                   /db_xref="GeneID:3372281"
FT                   /locus_tag="cgd7_2980"
FT                   /transcript_id="XM_628463.1"
FT                   /product="Low complexity protein witha potential C2C2 zinc
FT                   ribbon"
FT   CDS_pept        700264..701595
FT                   /locus_tag="cgd7_2980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Low complexity protein witha potential C2C2 zinc
FT                   ribbon"
FT                   /db_xref="GI:66362998"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2980"
FT                   /db_xref="GeneID:3372281"
FT                   /translation="MEELINDIENISINSNNVDESNTKDPEKNDNFFDYEILLPTRNQL
FT                   EDDSILSLTPVKDNDKELFKNCILCRDYSSPICKECSKHNSKTSRKSKLKKNKIIPDGK
FT                   VKALAMQFENILPEVTNSSPSFSIVNDNFMLEKSEPAHFQADISINSIIEHTNVDNRDY
FT                   LNTSLLGDQTNILSIDSENDNAKSKMAKNQLTPIIDPNLCEKIDPIKAIITSSNSYINI
FT                   VGNTEIGNCASADTKVRSIATEINHLFECGFPENDLIFDQFESLNPLEQRALLLKWITE
FT                   ILKTSEASSKLSNNEFKEIIKILKSIVDELERNETYKISKSSPNNNSTEYQSILSHVFD
FT                   EKDERLIIKRNGIQIPNTKNSIKLVNSKLQINISIPEDEEIEEERINELILNKYIYSSS
FT                   NFESNSIIIDENSLSPKSEIVLDDEEIVGNSIKEIGNNFFGFFK"
FT                   /protein_id="XP_628465.1"
FT   gene            complement(<702706..>703572)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2990"
FT                   /db_xref="GeneID:3372285"
FT                   /locus_tag="cgd7_2990"
FT   mRNA            complement(<702706..>703572)
FT                   /db_xref="GI:66362999"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2990"
FT                   /db_xref="GeneID:3372285"
FT                   /locus_tag="cgd7_2990"
FT                   /transcript_id="XM_628464.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(702706..703572)
FT                   /locus_tag="cgd7_2990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363000"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_2990"
FT                   /db_xref="GeneID:3372285"
FT                   /translation="MFCSSINSFELFPFQVLSTEKNERFMGSTLLLTTKDNKYIYKILK
FT                   NDNCNELDFYSSINKQHLLKRHDIIPKFIRFVLIIEVGKKSKKIYLRKSFINSILNKKM
FT                   HNLQHFKIESAIEMKNFLSGYSNINIIDLKLGTSWIGESKNDSIYNLREVFTKTFPDED
FT                   LVQEFNDIFCKIERIPEKTEFMNGMLYKLKSLRKSIKQYMIINNSCQYEIGIRIQGLIS
FT                   DKITISRQRGKELTSNETMKLLSEFLKLSPNLIRLTRKKVELLKFWLERQKSYRFIATS
FT                   IVLAFDR"
FT                   /protein_id="XP_628466.1"
FT   gene            complement(<704242..>704898)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3000"
FT                   /db_xref="GeneID:3372284"
FT                   /locus_tag="cgd7_3000"
FT   mRNA            complement(<704242..>704898)
FT                   /db_xref="GI:66363001"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3000"
FT                   /db_xref="GeneID:3372284"
FT                   /locus_tag="cgd7_3000"
FT                   /transcript_id="XM_628465.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(704242..704898)
FT                   /locus_tag="cgd7_3000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363002"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3000"
FT                   /db_xref="GeneID:3372284"
FT                   /translation="MRFLEHSGLNRLSVLLSNLDVGDRILNGRIELFTCSEKVVEECDL
FT                   SERVDREVCVSPQWISNSPIGPVQRQDVRELLVNLISTMNQCFPDYEFSLIKPDNLFKE
FT                   KSFSIVYNNINYHLSSIVERIYPSFLLELWENIRDAVEIKYTEIYSYRLMGNDELSPFL
FT                   DDGSLFSFDYFFYDTKSQKILFFACTTKSKLNIGFTDNGLDSSEESIDDNEIGSE"
FT                   /protein_id="XP_628467.1"
FT   gene            <705286..>705900
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3010"
FT                   /db_xref="GeneID:3372283"
FT                   /locus_tag="cgd7_3010"
FT   mRNA            <705286..>705900
FT                   /db_xref="GI:66363003"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3010"
FT                   /db_xref="GeneID:3372283"
FT                   /locus_tag="cgd7_3010"
FT                   /transcript_id="XM_628466.1"
FT                   /product="cysteine-rich protein"
FT   CDS_pept        705286..705900
FT                   /locus_tag="cgd7_3010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine-rich protein"
FT                   /db_xref="GI:66363004"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3010"
FT                   /db_xref="GeneID:3372283"
FT                   /translation="MPSNNICSPITNSNDENSNALISSGCKSTDCHCEGNGVVTTHTTS
FT                   PNVTQKCYITNSGCHEAIVTTTTQEVKRHKCPPKIQKIHEHISQPINYNCSSQLGNVPC
FT                   NIMMNPCACSVSRSSCHRTNHCNCSNGSVQFMCCNKYANSGCGCSCCCCSTSSVQTTLY
FT                   PVYMSFPYNQGRNINVPYTVYSTPLSHTYNPLTDNQYSYQY"
FT                   /protein_id="XP_628468.1"
FT   gene            complement(<706024..>707418)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3020"
FT                   /db_xref="GeneID:3372282"
FT                   /locus_tag="cgd7_3020"
FT   mRNA            complement(<706024..>707418)
FT                   /db_xref="GI:66363005"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3020"
FT                   /db_xref="GeneID:3372282"
FT                   /locus_tag="cgd7_3020"
FT                   /transcript_id="XM_628467.1"
FT                   /product="rhomboid family membrane associated protease, 7
FT                   transmembrane domain"
FT   CDS_pept        complement(706024..707418)
FT                   /locus_tag="cgd7_3020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rhomboid family membrane associated protease, 7
FT                   transmembrane domain"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363006"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3020"
FT                   /db_xref="GeneID:3372282"
FT                   /translation="MSDRKIFDIQSLNSHTELMNQQMPLSEDSSVVLSKEGNSKELDIT
FT                   TESFKFDESDSSKNHVVQPKSEENIEGKSSLKNGRTIEIKRGKHTPRNSLFLTMFCCIG
FT                   GDSSVARLKVSYLATTFFASSIIFVFIQELVISQLTNGYSIIKIPDGYLFGPPPQVVFD
FT                   MGALDTNLVRNGQLARLFWSFWLHTGFIHLFINLSCQIILGIILETRWVIWRYAILYLL
FT                   GGISGNLASAVLDPCTISAGSSACFFALLAGIIVLLLENWRNSRWQFLYVLLVIIASLI
FT                   GISLSFMSNTDNWAHIGGFVAGLLWSFASMESFSRKSKALRKSIKSSGKNTIQLPSQDN
FT                   VQLSLQIKPTDVEVGHSKSQFEETSIVDSISDNEAKNEYVKGRFIPANCACSGGVQTVR
FT                   VISLLLLLSLLTIGFLFLLYKPLYTKFNLVLGHLSFSGIQKCSCCDSPEGVFWCSSSPT
FT                   WIRRCG"
FT                   /protein_id="XP_628469.1"
FT   gene            complement(<707825..>710473)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3030"
FT                   /db_xref="GeneID:3372286"
FT                   /locus_tag="cgd7_3030"
FT   mRNA            complement(<707825..>710473)
FT                   /db_xref="GI:66363007"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3030"
FT                   /db_xref="GeneID:3372286"
FT                   /locus_tag="cgd7_3030"
FT                   /transcript_id="XM_628468.1"
FT                   /product="importin/karyopherin"
FT   CDS_pept        complement(707825..710473)
FT                   /locus_tag="cgd7_3030"
FT                   /gene_family="HOG000204108" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="importin/karyopherin"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363008"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3030"
FT                   /db_xref="GeneID:3372286"
FT                   /translation="MDLTQVLLNCHNSVESIRKNAEQQLQAAQEQNIGEYLTLLAEELF
FT                   NESKPELSRQLAGLLLKNAVSGIEPRIDIERRGMWISLPQNVTSKIKALVLESILSPVA
FT                   SVRGASCQVIAKLGRVELPCKRWPELLPYLIRLVQNNSDNKMSIIYKRSSLTALGYLCE
FT                   DSKILENEVSSLIITEDISNQILTAIVQGMNDPDSETALAATKSFYYALYFARSNFSNE
FT                   MERNLIFQVLCTLCGTEGNKRELLQTAAYECLVSIATEYYDYLGSYLSVLTPMTIKGIK
FT                   GVYEPVSICCIEFWNTIADLEIELSLEDEHNNTSPSTSCMHYISQVQAALIPVMLETLL
FT                   RQNDDDDLESWTVSKAAGACLTLCSQLLGDNILEPTLGFIHSNFSHSNWHNREAAVLAY
FT                   GSILEGPSIQKMQPIVETSVTNLCQALNDNVVAVRDTCAWTIGRIVTFHPTIIFPLLGL
FT                   PPQQSVEHSNGLLSLLLQRLLADEPRVCTNICWIIHQIAESSQYVEGGQKVLDIWFPYI
FT                   VQSLLQAFKRENSDENNMKQACFNALSMVVANSGADNDMNLVNLAHELIIGEDIGLQKL
FT                   MEKNPIPRSDAAVLNIQLICGALYALTTKLGKRLTLQYSQILLRLYFELLRQGGSSEES
FT                   ILSLTSLIVAMSHDFSPYVNECISIIIPLIQGYDELDTCKYSIELVGDLVRSVGKGINP
FT                   SLEIIIKTLCALLAKNDVDRKVKPLAIIALGDISMNLGEDFIPYAISVLQLFQQASITQ
FT                   YNDGPVNSEDWIEYLGELREAVLQGYTGIVYGMKDAKRLEILGPYVPSIIQFIDNIVND
FT                   YSGEFPNDSNLKNATALVGDLITAFNGQLIQYLLSKDKRSILENICTVGETSRDPDIIS
FT                   NIKWVRKLCNM"
FT                   /protein_id="XP_628470.1"
FT   gene            <711473..>716437
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3040"
FT                   /db_xref="GeneID:3372287"
FT                   /locus_tag="cgd7_3040"
FT   mRNA            <711473..>716437
FT                   /db_xref="GI:66363009"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3040"
FT                   /db_xref="GeneID:3372287"
FT                   /locus_tag="cgd7_3040"
FT                   /transcript_id="XM_628469.1"
FT                   /product="membrane protein conserved in eukaryotes"
FT   CDS_pept        711473..716437
FT                   /locus_tag="cgd7_3040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein conserved in eukaryotes"
FT                   /db_xref="GI:66363010"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3040"
FT                   /db_xref="GeneID:3372287"
FT                   /translation="MVSFQEFILLELIKYLDKSYMLQRRWKVVIWDLSIENLCDEEASV
FT                   FIEIDFGTSREEFRVQLESKEYILSNGELKHRLRTPIVHSLLKDKPQKIKFHPSFEYRG
FT                   SYYDIEKEKLKLSAWKYHNFRLNTLDAMFEIKLNTCANSDLQHQCYLMRLGDGHTLEKV
FT                   YRICFNLYFQEIYDFQLSLDRFEIKELLTHDNIMDRVSSLKKKAVEKVPFNNNSFFEID
FT                   TEINSNEFLSEFTIIENTEFESINKSRYRNLLGNNNRIGNDPIKKIFQYISFNYSENEM
FT                   GNVLTEKSKANSKTLNLESSINEQENKGKIESNIVDQRKGIWDTFLGFIGLLKEDQKDN
FT                   IQKLDSLLIEAELDQAKLHPANCSPRLKINITWPTTLKNYTMYSNIQKGTNWPVWENLG
FT                   SIYLRGTIADLENCFIDIDVIDNNKDKTINSQARTHIPLKGLIETNTVIESNLSEPLWL
FT                   AEKVKKTEERRILATWEFGMITGNISFKNYPSQRQKGNFIHFVKDRLYLMIKIIKVDNI
FT                   ITFENLENTLVNISITHQGLTSKSNSNICSSLKDRPIDDYIILPLQLPPISELYFFHLE
FT                   SLGEIYIDLWVTSDNQSGSKMQHAGFTSFTIWDTIFSIKGAKRPTSERYYSSYTSGSNE
FT                   KLKVRVLEQEVPLKFLFPTDRVANISFEAFITPDILSIKPKGNQAICSKDTGISEKIDI
FT                   FLRSRVELSPSQAPKVYQNEKASIEVTLISKLGTGIIGRFFIFSSFNHRGNELMLTQFV
FT                   RPIPAPSGIITPRAIFHFVRCIPFINTSFREPPKRTRDKFNNETSKNDSLKRGSQESKS
FT                   AYSFDKSHYWFTPDFTLLSNGGGVIDHCLLHVSLLLKQKIQAFVCIGTVAGGHFHSWVM
FT                   SWHFSEVDNSTYIKFWEVTTGQIYILKNRFISQQRAREVTLRFRKRERLLSAGVEPQSN
FT                   SAHIKTIKLPYRSIDTIFNEINIWYNVQENINPGSIFFDLWNGSLFISCTNTPLVHNPG
FT                   FRSQPYSSILNKSTIKNMKNLLKNILHYEIQSRRSAQNLGTRWNMDPTLNLFLEKGLEI
FT                   IELSEISSEEEYPDVMTKFSDWKFAMESKVPLMHRVLGFPLSFNHANPKIIAETVLGKL
FT                   EILFTRDKSATLTIAVLINGYPNHVLCCRIFILVIQKVSERERKKILERQEKKKLKQEK
FT                   SFKNEKSNSLKLDLKSSKFEENNDISQANINYQDGFNIENNNQIISEDTKKDVHSSVPL
FT                   VTADFIGILDKENKMIRKRRVALPEGSISGNLWISKKIKDDGNFRYYIEGIENSVSESL
FT                   NISKNRVCATELNYEGQRVGFAILPGLNDDEMSPLDLMYEMALKVDELLKSDKNFIEFT
FT                   GGDAVLEWDYEQMESGGEDEEAIQYIENEDNSDVQSEISEFEEDLSEEELDETLESESE
FT                   ENTENIESENEDDINCLSSNSSSSISNTFSSLVEENEQNTTSRHLLKRESNEDFNSDIS
FT                   NGFSDTSVKNGIKTVRFEVKENSDNLNSSKNNLKTKISSSVSEKKNLKRFTKTGKYIIY
FT                   RRPEYEQSKIVSKELINSDTITSDLSVFPAATLAISLARGHSEIRESGLLSANKETYYN
FT                   IEKSRYIKKTDNSGNKMLTHSSSNDLLSNMFYKGNYNAFAQTLNKKNSTNNEMINSIKA
FT                   NKRSIPRANSITFRRN"
FT                   /protein_id="XP_628471.1"
FT   gene            <716534..>718489
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3050"
FT                   /db_xref="GeneID:3372289"
FT                   /locus_tag="cgd7_3050"
FT   mRNA            <716534..>718489
FT                   /db_xref="GI:66363011"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3050"
FT                   /db_xref="GeneID:3372289"
FT                   /locus_tag="cgd7_3050"
FT                   /transcript_id="XM_628470.1"
FT                   /product="protein kinase"
FT   CDS_pept        716534..718489
FT                   /locus_tag="cgd7_3050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /db_xref="GI:66363012"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3050"
FT                   /db_xref="GeneID:3372289"
FT                   /translation="MNNELNTTIKNILKINEIQNDDLALMLSRYIQKNFLINTNNDFFA
FT                   DGEYIHEEIIKVSIAIVANCNLISSTNIKGRDNILINSERVPIYTNYIEFENFKDLNNW
FT                   MINLYDRILFSKKDSFQTENMVEEKMQKLINELNNCEIIPFELPIDFITSIYNSGTISS
FT                   GKIVDYLRSMYLLFNADDGNILKHEPEVKDNIFHEDIYIYNDELTEYLSDDQELKINNI
FT                   GNQGSFSKTVETELCEPSINLNLRVNFSIGKFFEKMETDLKTLEDIALIFFGTISSTSE
FT                   HMNNLDKKDILLNVFYKNQLIHLIKQNINSINISNRFLLIKVLHRGNFGQVYVGLDLLS
FT                   FKLVCLKRLMGSLSDDQYLRNSIIEANYLNILSKSSVSKFVPHFIDVVVNYNDIFIVSE
FT                   LQGKNLLSFIEDDSAKMYLTLGRIQRIINQLLVCIKHLHESLKLIHCDIKPENIVIAGI
FT                   DTQDIFGYLNNTNFDKKDEINIKLIDWGSCLSIYQASNTRNSYIQSRYYRSPEICLGLA
FT                   YNEKIDIWSVGCVMAELVLRKPLFDHNSSTQQLLANIITTIGKKIPIRMINNSSIINHF
FT                   ITHDGHLFDKNLNKIRLFTTLKENSIHKNRINELFSNNDPLFVDLLNKLLCIDPDERLS
FT                   ASQALSHPWFSYNYHN"
FT                   /protein_id="XP_628472.1"
FT   gene            <719459..>722410
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3060"
FT                   /db_xref="GeneID:3372288"
FT                   /locus_tag="cgd7_3060"
FT   mRNA            <719459..>722410
FT                   /db_xref="GI:66363013"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3060"
FT                   /db_xref="GeneID:3372288"
FT                   /locus_tag="cgd7_3060"
FT                   /transcript_id="XM_628471.1"
FT                   /product="gamma-tubulin complex associated protein"
FT   CDS_pept        719459..722410
FT                   /locus_tag="cgd7_3060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gamma-tubulin complex associated protein"
FT                   /db_xref="GI:66363014"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3060"
FT                   /db_xref="GeneID:3372288"
FT                   /translation="MQFSQLSIGNTSISGRGSYWTIIPLKIEGTVYPNWFLMKEILKNK
FT                   KNNTLKFLDSKIIEKLIYNQSNCSKVKIEPIQLETFELVLNRPIGWDKPSINFSENKLT
FT                   LNTSNKFLSKSVISLPSITGFVFDHMEIGINNTIKHNIIPNNLSSFSVKIQEQLILEDI
FT                   LNCLICNNGNYIKVTEQIIEFFHNCEHLDFVSEDLYIFEINSTCNEKYLNLHFISGREG
FT                   ISAFSHQIFDDPSNLQYIYKDMINNKILEESKPENTLDDLLEIKNILPANIIKKNPSLY
FT                   PLSYKTLELSSLHRRIRKFLKVHESGNSQFGIISNTLCDSFRELLKHFMIKITKFESYL
FT                   RKGQLTVQNICTYSQQALITLKALDLISAQVLHKKGCEIIDQVYKIANNEFKGEESSQK
FT                   IANFVFNQVFLSWFKHFLTPWLKFGTVFDHFSEFIDYNLSTKKKKFNKENIHSKNFYRE
FT                   KERKIYFILPSFMHELVEKVNYIGLVSHFVSHINHLHSQNLSFDTVRENRVLNCKKLEN
FT                   TLEQMLHSLSNKSDLIRNEEVKLYINAMFFESQLLIYSVCNSITDVSYCINKFYEIFFC
FT                   ANDSLIQEFIEHIHKLGFRGERADCNSSSNITRKWSELMVKYYGVLNDSDKSDRFVCKV
FT                   EKNLITESVTEELFNPVKWEIKSVLFEEDFKFIQKDKQNISCSDAFKYLTIEFHEIKTF
FT                   GLIWPRELLCKYELIFRLVFHLKYINYLLNNIWILHQTSNNLDCEMSKKKPNVSISGLI
FT                   YKSYFLRQKMLLLTTGILEYIYQDIIIPKWGKMMQNIKNISTLEELNSYQDRLLNEILT
FT                   LCFFSEGELLHSLYMILSLCYLFASHSNLLNIYGFCELEKKISHKITGTKNEKYEENAH
FT                   ISTYGRNLCKKGEFERSNDIFCTNTHIKGLLIDTTYINLVEKFSSKFESLLSRFFNNIS
FT                   NCKSKNINLINKLLLKLNFNSFYIGKIPASVETWGEYTLNENSSCDELIDESG"
FT                   /protein_id="XP_628473.1"
FT   gene            <722698..>723477
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3070"
FT                   /db_xref="GeneID:3372290"
FT                   /locus_tag="cgd7_3070"
FT   mRNA            <722698..>723477
FT                   /db_xref="GI:66363015"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3070"
FT                   /db_xref="GeneID:3372290"
FT                   /locus_tag="cgd7_3070"
FT                   /transcript_id="XM_628472.1"
FT                   /product="hypothetical protein, signal peptide,
FT                   transmembrane domain near C-terminus"
FT   CDS_pept        722698..723477
FT                   /locus_tag="cgd7_3070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide,
FT                   transmembrane domain near C-terminus"
FT                   /db_xref="GI:66363016"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3070"
FT                   /db_xref="GeneID:3372290"
FT                   /translation="MLNTNSLFLLCCIAFILLGELYAVNLSCDARLRECEVEVKSLLKK
FT                   NSECSSDLDSLKAEVSHLSEIISQYERNVNFTQDSHHTISWRVAANQLKNFSIFFKGLI
FT                   TASYSNIPKELDLQIRSIYSKIFVYLDPAIEKYSEAYPLVCQHIKSYMNRYINLLNPYI
FT                   DYMLVYSEFINEKLDGYVSRIESFEPNIVGTIPKSLHDRVFYILCAFLALYVAMESICI
FT                   ALRLLFRCCGIKCGSSCTNKKNIKSPTSKSTPSNRRK"
FT                   /protein_id="XP_628474.1"
FT   gene            complement(<723563..>725560)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3080"
FT                   /db_xref="GeneID:3371834"
FT                   /locus_tag="cgd7_3080"
FT   mRNA            complement(<723563..>725560)
FT                   /db_xref="GI:126653840"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3080"
FT                   /db_xref="GeneID:3371834"
FT                   /locus_tag="cgd7_3080"
FT                   /transcript_id="XM_001388355.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(723563..725560)
FT                   /locus_tag="cgd7_3080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126653841"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3080"
FT                   /db_xref="GeneID:3371834"
FT                   /translation="MNSSANDIKKYASNMSYFISPQTMVSRMFESQQNSISDINITHNE
FT                   SSLTTSLIPYNRLFDSTNEDKKIHDEIIQRSNPENLAIASRYFNLHCPMCGRIIPHKFF
FT                   SNSFKQSTSEDNLFNLKNLQEQRNRGYDSFNIGNESQVEKSKTLLNNSDNSEFGNVSDI
FT                   SDKLNKRFNGRYANYSVDNQNYFFFLEELYRQINIRSGISRLQYSVMNNLVEKNFDSKE
FT                   ANNEGDILEFNTIKPPKGIDAEINNLINLNSDLLMTGYYEKFFVEIRKLGSGSFGQVYL
FT                   CAHVLDGITLAKYAIKKVPVGDDKNWLSAVLREVKIRELLHHPNIVQYRHSWLEMYSSN
FT                   EFCPKVPWLFQLMEYCNSGSLDTLIYSAPTFSGNVKSYEEHEHRANYLLSFSKSNGKYI
FT                   GDELNFDYNYFSEKYMDENHIWKIFFDIIFGLQHLHHRGILHRDLKPSNILLHITFDKF
FT                   LEQPICQALLSDFGTAQVLKNVNFKLFSSEIIPDFNSIMPEGQNILSDDQEECTILSNQ
FT                   RHGFTGTVEYTAPELLTKDENGNFIGEYNIYSDIWSLGITVYKMCYNQVPFRVDTRNGL
FT                   DPEDPEECIKAIFKGMNSLEFPNVPNRTNEIKFLIRSMLDPNPVNRPNTDDILRHPIIQ
FT                   DKLRSSEMINASIELANIIGHKNYKLNNQI"
FT                   /protein_id="XP_001388392.1"
FT   gene            <725856..>727916
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3090"
FT                   /db_xref="GeneID:3372291"
FT                   /locus_tag="cgd7_3090"
FT   mRNA            <725856..>727916
FT                   /db_xref="GI:66363017"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3090"
FT                   /db_xref="GeneID:3372291"
FT                   /locus_tag="cgd7_3090"
FT                   /transcript_id="XM_628473.1"
FT                   /product="uncharacterized low complexity protein"
FT   CDS_pept        725856..727916
FT                   /locus_tag="cgd7_3090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized low complexity protein"
FT                   /db_xref="GI:66363018"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3090"
FT                   /db_xref="GeneID:3372291"
FT                   /translation="MEICDVIWLLSIGFKFKEKILIGNSDLETKTIIDNMFRYEKINDN
FT                   KFYREISSSEIKVIHSIFAQINKQFEFSFKSSPHDFKLLICHIIDKILINYNILAGDTD
FT                   CQYYSNNNNKLMRLDLFPNPYIYGNKLFLYLYRLKVICTEKLGYYEWSNLLSELNLIIE
FT                   KYEAIKEISNHVSFYDSFNDFLISDLERIILVNKKSSLTFNILQNSHVFGNLSKFSIFL
FT                   RGINLLKTPEMKKLGQQYLLKSISIQSLSKVNFDSFKFLVDKANIFQSDQLFQIYCTIS
FT                   MFMNSNDFRNSIKYIIRAERLLRNLSKSASIGAIVLIKIYVLISKLYLLMRNINAKDGR
FT                   FCLYNSKFNIFDCLPYIIISTLELIHSEILENSKFLTKEEQDKILDHLSEYICHLQSDY
FT                   PSLLTMKFVESYPSGEPSNSRYLCLKVDKNKKKNLNSFFPIYNIFSYLNTAENDQVNYL
FT                   FEVNSLICWNKLIPNFLLCYSEVNSIYNENIYNNIFLSQLADQLSYYIQILNTSNSEYA
FT                   KAFPKIKIAELCLFISLYSYYAKDEVSKVSEFILRGSEILESCSESFNVCSIKCIFAYI
FT                   DLLIHLRSSNDISNIESQLGRIIRNGKMAFKFIYSNQTIPMYKKRAVNLAFIQALTLLI
FT                   LIKNDFSALESDELNMHLQFERNEVVEESYIDGNIIISKYISITRSLNNCI"
FT                   /protein_id="XP_628475.1"
FT   gene            complement(<727945..>729609)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3100"
FT                   /db_xref="GeneID:3372292"
FT                   /locus_tag="cgd7_3100"
FT   mRNA            complement(<727945..>729609)
FT                   /db_xref="GI:66363019"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3100"
FT                   /db_xref="GeneID:3372292"
FT                   /locus_tag="cgd7_3100"
FT                   /transcript_id="XM_628474.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(727945..729609)
FT                   /locus_tag="cgd7_3100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with PBP1 and Ataxin-2_N domains"
FT                   /db_xref="GI:66363020"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3100"
FT                   /db_xref="GeneID:3372292"
FT                   /translation="MDSNEPNIKVLRNQSKNSKISNGKSSSMMNKSFNQYNIKKKNNKP
FT                   FQRNYESNSIQARSGLISDRIANAEVTNGNSTEFAVFILVLIGSEVELKLIDNRVYHGI
FT                   FHSISKKEGSNEQFVCIRFCRRIHELYSNELSKPIEDYCMFPLGSVYRLSTTNTNGIPT
FT                   RFDSVSGELKGNKICGINAFRTDNEISHDDRHVHERILKPWMSEDHSSDIIEDILGSEP
FT                   IDRWDQFEENLNKFGIQGTFDENLYTTPLDYNEISEEEKRKAEILASEIEMEQKNASVN
FT                   NFENDEEMNFSSVHRDITEQSNSNKGVNSKLQNESVYELNQPKTNDEHSEATEELSNKD
FT                   SLSKSRKSKFSFNPNAKEFLPRAISNNSKMCGDRLDKFDNIRTNEVANNSNEYQNDNYH
FT                   YSQKGVHYDHSNRHFQRHYDNQLSQTHRDLSIVNSVQSKGAQFIDGLRNEVINDMSVNQ
FT                   ISYDEYYSLNTHRPDYVESKRIGSQYPEFSYDVSNTQTVYYYAPESEDIQSSGYYMSDY
FT                   NTGKWSNYSMHNQYYIPSNNSEVYNHYCNYQGRGAYY"
FT                   /protein_id="XP_628476.1"
FT   gene            <730108..>731358
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3110"
FT                   /db_xref="GeneID:3371835"
FT                   /locus_tag="cgd7_3110"
FT   mRNA            <730108..>731358
FT                   /db_xref="GI:126653867"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3110"
FT                   /db_xref="GeneID:3371835"
FT                   /locus_tag="cgd7_3110"
FT                   /transcript_id="XM_001388356.1"
FT                   /product="S1/P1nuclease, putative"
FT   CDS_pept        730108..731358
FT                   /locus_tag="cgd7_3110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S1/P1nuclease, putative"
FT                   /db_xref="GI:126653868"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3110"
FT                   /db_xref="GeneID:3371835"
FT                   /translation="MLVFLSIKCTIKVLLLLGQVLAFDAEGHSAIGMTTISGLQNNFSQ
FT                   KLRRLMNGKDIVDISGWGERVSKKHPSTLPFHFQGQSKGDYFKNGELGNDFKEKFILKS
FT                   DSNCKHTGHCLVPMIKHLYYRLIGDNSKFKINYPEGIQLTDSDSIKFLINLIGDLHQPM
FT                   HFGFIEDGLGREIKGMMSINGTNERLSLFEIWESGIARKLKTEKPQFWFGGWTHILAIR
FT                   DIFDKELLLWKERGIEMINDWAKENFEIVTNEIYFHPISKQPIIDNFNVDVTLEFAWLE
FT                   IFRSRILIAGARLSIILNDILKLREGKEKPFRVTNSLLLSSDEDISHNISDPIIGINVN
FT                   RKQTLEINVFGKKIGISVWIRNLIINLIIILICLAVLAYISIFRLRDNYSILNNAQLPV
FT                   SEVKTKSVQMKQTSAID"
FT                   /protein_id="XP_001388393.1"
FT   gene            complement(<731533..>733293)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3120"
FT                   /db_xref="GeneID:3371976"
FT                   /locus_tag="cgd7_3120"
FT   mRNA            complement(<731533..>733293)
FT                   /db_xref="GI:66363021"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3120"
FT                   /db_xref="GeneID:3371976"
FT                   /locus_tag="cgd7_3120"
FT                   /transcript_id="XM_628475.1"
FT                   /product="pyruvate decarboxylase"
FT   CDS_pept        complement(731533..>733293)
FT                   /locus_tag="cgd7_3120"
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvate decarboxylase"
FT                   /db_xref="GI:66363022"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3120"
FT                   /db_xref="GeneID:3371976"
FT                   /translation="IQNILYFYFKMNSIIESSSNEMVNVAEYLCIRLRELGCDHIFGVP
FT                   GDYALSFLNVVMDSEIKYIGTCNELNAGYAADAYARVKGIGALSTTFVVGELSAINATA
FT                   GSFAEDVPVVHICSAPISKHHKNGTLLHHTLFDYSKTLKMFEQVTASAVKVAEKETAAE
FT                   IIDNALLKCVTLSKPVYICLCADLVNEYIKRPESPLKKPISRSNISELDAVMKKTVQLI
FT                   KNAKQPVFILGYELLRVHTTESMNELLEISKIPFSAMIMGKTTIDEQHPQYMGIYLGEK
FT                   GNPHVKQYVEESDCLIVLGEKMMDFNTGFFSEKLPKHCMVYNHLGKSKIGEQEFKEVYV
FT                   EDIIQRMINLYKAGELKQYNFSGSTPPYPQAMHLFTHRKNKGLGLEPVRNLSIDRMFDI
FT                   VASSLPDSVNVLAETGISLFSGLELMLTKNSQFFGQSFFGSIGYTVGATLGLCIASKKR
FT                   VFSFIGDGSLQVTVQDLSTIFRNCLNPIIVIINNDGYTIERVICDDTYNNIANWKYSKL
FT                   PKTFGFPNIPSFICKTEGEFHKSLKFALENPENACIIEVVFERWDCNIILKEMGKEMAT
FT                   NSQIIEHKKK"
FT                   /protein_id="XP_628477.1"
FT   gene            complement(<733476..>734669)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3130"
FT                   /db_xref="GeneID:3372293"
FT                   /locus_tag="cgd7_3130"
FT   mRNA            complement(<733476..>734669)
FT                   /db_xref="GI:66363023"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3130"
FT                   /db_xref="GeneID:3372293"
FT                   /locus_tag="cgd7_3130"
FT                   /transcript_id="XM_628476.1"
FT                   /product="ER vesicle protein; Erv41p, transmembrane region
FT                   near C terminus and possible N region transmembrane"
FT   CDS_pept        complement(733476..734669)
FT                   /locus_tag="cgd7_3130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ER vesicle protein; Erv41p, transmembrane region
FT                   near C terminus and possible N region transmembrane"
FT                   /db_xref="GI:66363024"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3130"
FT                   /db_xref="GeneID:3372293"
FT                   /translation="MEATYGESSTLRQRKRDIVLGNIVKTNEALQTKVKKIDIYGKIHE
FT                   DYCVKSTSRSIISLLVYIIVFFLTLNEIFKYFKGEMIDNIGVDNTINNKLDIMLDITFP
FT                   RLRCEEISVDSVDYVGENQVDSKEYMVKIPIDLNGQEVRNIKYNQQNDLKIECMSCYGA
FT                   ETNEFLCCNDCDSLKTAYRSKGWSYLDIVSKAPQCIEKVGCRINGRMQVNKVSGNIHVA
FT                   LGTATIKNGKHVHEFNMNDVSRGFNTSHIIHELRFGSDKIPFLFSPLENIQKFVHKGTK
FT                   MFHYYVKLIPTQYFSGNGEVNLYGNQYAFTERERDVHVQNGELSGLPGIFIVYDFQPFL
FT                   LQKIYKRVPISHLITSFCAIVGGIYSIMSLLDTFVAWLFKNNINRYINYIYKMNYSK"
FT                   /protein_id="XP_628478.1"
FT   gene            <734954..>735517
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3140"
FT                   /db_xref="GeneID:3372294"
FT                   /locus_tag="cgd7_3140"
FT   mRNA            <734954..>735517
FT                   /db_xref="GI:66363025"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3140"
FT                   /db_xref="GeneID:3372294"
FT                   /locus_tag="cgd7_3140"
FT                   /transcript_id="XM_628477.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        734954..735517
FT                   /locus_tag="cgd7_3140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363026"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3140"
FT                   /db_xref="GeneID:3372294"
FT                   /translation="MNELDQEYVQEKIHEFLDDERLIKSIKSYLRIHITKALRKKSNIK
FT                   FNLLQDEKLVILFKLIHEFLNFYEINNTCRMLEEECADIFQVNIEAFDDRLGELGALNG
FT                   GSECNTKIETLLENKLFCREKCEIDEVTNTVLIEASNCIESLQDEIKTLHNAYFEQVNT
FT                   AREIMEKKVSNIEKLYLESLLRND"
FT                   /protein_id="XP_628479.1"
FT   gene            complement(<735769..>737682)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3150"
FT                   /db_xref="GeneID:3372295"
FT                   /locus_tag="cgd7_3150"
FT   mRNA            complement(<735769..>737682)
FT                   /db_xref="GI:66363027"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3150"
FT                   /db_xref="GeneID:3372295"
FT                   /locus_tag="cgd7_3150"
FT                   /transcript_id="XM_628478.1"
FT                   /product="eukaryote specific membrane proteins signal
FT                   peptide plus 8 transmembrane domain"
FT   CDS_pept        complement(735769..737682)
FT                   /locus_tag="cgd7_3150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryote specific membrane proteins signal
FT                   peptide plus 8 transmembrane domain"
FT                   /db_xref="GI:66363028"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3150"
FT                   /db_xref="GeneID:3372295"
FT                   /translation="MLVAVVGVLGSLTLSFFLWKCMDEIASDDISTFTIIPCYLGALIS
FT                   ISPILILPFDIAGSLLGYENNNYFSIVKFFWKLAYLVLFILCWVVFPILLEYELSGDFD
FT                   HNKKLRTSLERNKNRWITQIIIIAITSILYLTVFNLHDSKFSISSMCIAVAHFWGMAQI
FT                   TFLWGFGLVAIPLKIKNSRKLVNKNDIIKTLNKYYTILHNLEDWKAINHHEIKKLNDKL
FT                   NYLYSISNEERKKTIIGKMIKTINESKTVLIKNNYLGETHHSNNIDFKNFSEKSILMIE
FT                   DLITLNRELKLLVTEQKRIYYLWESTLLNSWKLENLIVDIEPHLYSKNENNPLIFSSRA
FT                   TGSVHTSNNSLKNDDSLSVRSNYLVMNNETIDGVFLPNNNFRIKNAELIKNIRYLLEKL
FT                   FTINKEYLNQFLYIFSLVTSIGIISAEATMYFPNLNISLYSHIIRTCLRIKYMNNYIKF
FT                   ILVYFICQCLLIYVYVCTYWGLFYFKIPKKYGIYLNKHTDGPCIVFFSQFLCKLSTALC
FT                   FHYLSILKIEETEFGKFYGKQIQHLLDIFGKDFNIFFFPIIVVLVYAINVFDLQGKLIR
FT                   NSGIYYVFFEYYIFDDYVIGSNLENELSENEKISNGKRISEIQKIKKTMELNYCGRKMV
FT                   QL"
FT                   /protein_id="XP_628480.1"
FT   gene            <738101..>739255
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3160"
FT                   /db_xref="GeneID:3372296"
FT                   /locus_tag="cgd7_3160"
FT   mRNA            <738101..>739255
FT                   /db_xref="GI:66363029"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3160"
FT                   /db_xref="GeneID:3372296"
FT                   /locus_tag="cgd7_3160"
FT                   /transcript_id="XM_628479.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        738101..739255
FT                   /locus_tag="cgd7_3160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with 6 transmembrane domain; transcripts identified
FT                   by EST"
FT                   /db_xref="GI:66363030"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3160"
FT                   /db_xref="GeneID:3372296"
FT                   /translation="MNEEFKNIDSWRGSVAGTTLRINGRKRNENTTSFFRTEIFNLLIV
FT                   QITMISIMCIFIFIGVSLHVVKLKKIHADEYISHFNLDNDTSNILTENLRSIENSMGQM
FT                   SFFRVLRNNLDLSLPMKNNKDGNIIFCGGTHRRGTNWSEEVINITKRTIEIALGNRVLI
FT                   EFKRGLVFAINTVDIESSNIGVNQDHLNQLNNGSMLFKLFLASSGYVSPCYMFGKRLYS
FT                   YILGKNSGFLGYFMVMIPWFFSILSPQPMLLVHFPRLLIYFLIAMHRVIFLHIIINIAE
FT                   KKLFSFDFSDHIVLYAMYILIISIEWCAIGYNIKNKFVVSCIRGYCLSLLAIISYSSFF
FT                   TALYFHFPLETLAGFIIAFFGLFGIFWMLIFLEYIDLTKIGLHK"
FT                   /protein_id="XP_628481.1"
FT   gene            <739405..>740058
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3170"
FT                   /db_xref="GeneID:3371977"
FT                   /locus_tag="cgd7_3170"
FT   mRNA            <739405..>740058
FT                   /db_xref="GI:66363031"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3170"
FT                   /db_xref="GeneID:3371977"
FT                   /locus_tag="cgd7_3170"
FT                   /transcript_id="XM_628480.1"
FT                   /product="thioredoxin fold protein related to phosducin"
FT   CDS_pept        <739405..740058
FT                   /locus_tag="cgd7_3170"
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin fold protein related to phosducin"
FT                   /db_xref="GI:66363032"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3170"
FT                   /db_xref="GeneID:3371977"
FT                   /translation="INFLKALLLERLSLHLINSASKHFIDEILHGVEKKIMDSNSINVI
FT                   KKVLEESENIIDEEIRAFDNIQNDENELNRLREKRIEELRQEFKQKNKFIQFGHGKYDF
FT                   ISDEKEFFDVIKKSENVVCHFFRPSTLRCEIFDRHLEIISKKHLEAKFIKINAEKSHFV
FT                   CSNLNINILPTIALIKNSKLIHKIIGFEELSSRDNFTTTQLEELLVRRNMIQEQ"
FT                   /protein_id="XP_628482.1"
FT   gene            <740276..>741946
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3180"
FT                   /db_xref="GeneID:3371978"
FT                   /locus_tag="cgd7_3180"
FT   mRNA            <740276..>741946
FT                   /db_xref="GI:66363033"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3180"
FT                   /db_xref="GeneID:3371978"
FT                   /locus_tag="cgd7_3180"
FT                   /transcript_id="XM_628481.1"
FT                   /product="T complex chaperonin"
FT   CDS_pept        <740276..741946
FT                   /locus_tag="cgd7_3180"
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="T complex chaperonin"
FT                   /db_xref="GI:66363034"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3180"
FT                   /db_xref="GeneID:3371978"
FT                   /translation="KQHISGHILSLYCVIYLLSMNVAMDEYGNPFIILREQEQKQRLKG
FT                   IDAHKSNILAAKSVADILRTSLGPKGMDKIVVSPDGEIVVTNDGATIMEKMNINNECGK
FT                   LLVELSKSQDAEIGDGTTGVVILAGALLERSVELLEKGIHPIRIANGFEYACSIALKKL
FT                   EEISLKNGTVSDIQNNLLFNSAMTALGSKVVSSQQKHFAKMAVDAVLAVADLDRRDVNF
FT                   DLINIQGKPGGRLEESCIVNGIVLDKEMSHPQMNKKIENAKIALLTCPFEPPKPKTKHK
FT                   IDIKSSSDFDVLFETEQKYFSEMIDKVVSSGANMVVCQWGFDDEANHMLSQRGLPSIRW
FT                   VGGVEIELLAIATGAHIVPRFEDLAENKLGSAALVKEVTSGTEKDKLIFIEGCSKSKAV
FT                   TVLIRGGNQMVVDEAKRCIYDALCVVRNLIRDSRVVPGGGASEIASSIAVQKAVESVSS
FT                   IEQFAVEAFADALLSLPHALADNCGLDSISLVGEAKQKQVSQDDPNYGIDCDKLCVESM
FT                   EKIKVFESLASKQHQLALATQAVKMILKIDDVIKPTELF"
FT                   /protein_id="XP_628483.1"
FT   gene            <742433..>743368
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3190"
FT                   /db_xref="GeneID:3372297"
FT                   /locus_tag="cgd7_3190"
FT   mRNA            <742433..>743368
FT                   /db_xref="GI:66363035"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3190"
FT                   /db_xref="GeneID:3372297"
FT                   /locus_tag="cgd7_3190"
FT                   /transcript_id="XM_628482.1"
FT                   /product="protein with 3 CCCH domains"
FT   CDS_pept        742433..743368
FT                   /locus_tag="cgd7_3190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein with 3 CCCH domains"
FT                   /note="a domain expanded in plasmodium"
FT                   /db_xref="GI:66363036"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3190"
FT                   /db_xref="GeneID:3372297"
FT                   /translation="MESLRDNFSTNIGPSCFASNASLFQRRNSSELVRRQLYKTKMCAF
FT                   YNVGKCTRGNLCAFAHSVQELRPLPDLRFTRLCELTKRGDVCRDVNCTFAHSINDLRTT
FT                   EIPPTPLSEFNIMRSNENTALIRKLGSTSESKTKFRTGESIKDPFLSKSEGEDIFVSSA
FT                   DTTPQSLRPQLRNTEYEIPCQWRKIDNIISQNVGSIRSGIFSYLNETETSQIDNWVYNE
FT                   EFASRFSPDISTHSETSCKFVNNSDFQEPPNYFSSKCLLARGIPDWDFISNDDKISTLQ
FT                   CDILNIIGGDGNHHTEDICSIEKGALHMIN"
FT                   /protein_id="XP_628484.1"
FT   gene            complement(<744818..>745813)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3200"
FT                   /db_xref="GeneID:3371979"
FT                   /locus_tag="cgd7_3200"
FT   mRNA            complement(<744818..>745813)
FT                   /db_xref="GI:66363037"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3200"
FT                   /db_xref="GeneID:3371979"
FT                   /locus_tag="cgd7_3200"
FT                   /transcript_id="XM_628483.1"
FT                   /product="DHHC family palmitoyltransferase, 4 transmembrane
FT                   domains plus possible signal peptide"
FT   CDS_pept        complement(744818..>745813)
FT                   /locus_tag="cgd7_3200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DHHC family palmitoyltransferase, 4 transmembrane
FT                   domains plus possible signal peptide"
FT                   /db_xref="GI:66363038"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3200"
FT                   /db_xref="GeneID:3371979"
FT                   /translation="ELYFTMDGFAKCMDSIINCFECFAKFLGHFLIAFVFFAISFLYTS
FT                   GTFFIFPFMIKNSVILILTRLALFFFTVNLVYNYILCLITCPGFSKPISKREESRNEVS
FT                   QYDIEAGELLFLESRNIFNDRNSQIEDSFLPEEYFKDHDKNNLFIDQGKNYMINCSKCN
FT                   AIKHPRTHHCSICNKCILNMDHHCPWIGQCVGLYNRKYFILFLAWSFLSCFLISIFSIP
FT                   MIIILLSSLSGINYYSDASLYDNVTFQGLLFSSVLSVSFSLGTGTLLFFHIYLLVTNQS
FT                   TIEYHQNLFFRKSLNGGEALINRFDKGLSNNIREIMGTSRFPLLLFPCFY"
FT                   /protein_id="XP_628485.1"
FT   gene            <746263..>747219
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3210"
FT                   /db_xref="GeneID:3372298"
FT                   /locus_tag="cgd7_3210"
FT   mRNA            <746263..>747219
FT                   /db_xref="GI:66363039"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3210"
FT                   /db_xref="GeneID:3372298"
FT                   /locus_tag="cgd7_3210"
FT                   /transcript_id="XM_628484.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        746263..747219
FT                   /locus_tag="cgd7_3210"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363040"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3210"
FT                   /db_xref="GeneID:3372298"
FT                   /translation="MFQLRSGPPTSRGASEFGTPNAFSHRNNQVPQYTQRANPLMCCSP
FT                   PQINSMPINQAPPSRMISAAGLNVQSVNAPSRLVTGASITPAAVVAAPERQVTEPLQHK
FT                   QTFIYGGSETMEPEDCGWLEPIRLKVHAMEVQQYINPNNPEATPPFIYNVDHLMECVEI
FT                   PENWAPESVTGVAALTFENLNTNPPVIQHPLRLESDGSRNGTNNPYIQPIRYHVERIKD
FT                   KDSPEKLEKIIESEQDVTSPSGSKKDNETITSNSNFFSAILSKIKNGVKLTSDKQAISE
FT                   SKEETFENNELEAETVEDEVLTMKQDSTPEHNQFLDK"
FT                   /protein_id="XP_628486.1"
FT   gene            complement(<747332..>748165)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3220"
FT                   /db_xref="GeneID:3372300"
FT                   /locus_tag="cgd7_3220"
FT   mRNA            complement(<747332..>748165)
FT                   /db_xref="GI:66363041"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3220"
FT                   /db_xref="GeneID:3372300"
FT                   /locus_tag="cgd7_3220"
FT                   /transcript_id="XM_628485.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(747332..748165)
FT                   /locus_tag="cgd7_3220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="membrane associated protein with no close homologs,
FT                   transmembrane domain or GPI anchor at C-terminus"
FT                   /db_xref="GI:66363042"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3220"
FT                   /db_xref="GeneID:3372300"
FT                   /translation="MDWKYTRGFNEIEDLLKRVKHIELLCESDVKIDEVSSIEQEYIKH
FT                   KIKLFELYNTTYTILDHLENDENHPKLLTKIKLVDLISQMKIEIRELRKIYNKYSSSLR
FT                   INQLNKDDNKYIDIENYEKEFIEITESRFNKLFTDPFSKITHSTTLNDFLLKPDSANKV
FT                   EHREIGDSDKTKINEWSLENRRIDEDIKEVGNMALRIADKAAQLGREAKAHNISIEEIK
FT                   NTTEFATTDIFNLNRKVQEVIGTNNNTTFCCRITLVTLVFISVSLIIVLIFKKLI"
FT                   /protein_id="XP_628487.1"
FT   gene            complement(<748341..>749054)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3230"
FT                   /db_xref="GeneID:3372299"
FT                   /locus_tag="cgd7_3230"
FT   mRNA            complement(<748341..>749054)
FT                   /db_xref="GI:66363043"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3230"
FT                   /db_xref="GeneID:3372299"
FT                   /locus_tag="cgd7_3230"
FT                   /transcript_id="XM_628486.1"
FT                   /product="SLBP family of RNA binding proteins"
FT   CDS_pept        complement(748341..749054)
FT                   /locus_tag="cgd7_3230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SLBP family of RNA binding proteins"
FT                   /db_xref="GI:66363044"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3230"
FT                   /db_xref="GeneID:3372299"
FT                   /translation="MINLDNNTPLFCNPMTPHRVYEVSILLLIGKKVKEKNFVSAIEVH
FT                   PNLPKLEVKESEAKNLNSGSKYIQSKNSLFTLDSKNFDIYNEVDPPPNKGFFSFSDLTS
FT                   LLEKLPSTELIKYGNYKSDFVRQNTELKASEEPLTSRMISRLKQIAIGKSLPEYKNYIN
FT                   QVPLEKRSSEDPRTPKCDTRLTKREFDNLYREWRVKLHQYESKFSSGASTRVNTPEDDL
FT                   NHHSRYCPDIKTLKI"
FT                   /protein_id="XP_628488.1"
FT   gene            complement(<749260..>749455)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3240"
FT                   /db_xref="GeneID:3371836"
FT                   /locus_tag="cgd7_3240"
FT   mRNA            complement(join(<749260..749378,749425..>749455))
FT                   /db_xref="GI:126653936"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3240"
FT                   /db_xref="GeneID:3371836"
FT                   /locus_tag="cgd7_3240"
FT                   /transcript_id="XM_001388357.1"
FT                   /product="transcription activator, putative"
FT   CDS_pept        complement(join(749260..749378,749425..>749455))
FT                   /locus_tag="cgd7_3240"
FT                   /gene_family="HOG000191755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcription activator, putative"
FT                   /db_xref="GI:126653937"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3240"
FT                   /db_xref="GeneID:3371836"
FT                   /translation="MVEPVTYICGECGADVSLLSHGAAVRCRTCGCRILYKKRTRKMIQ
FT                   YEAR"
FT                   /protein_id="XP_001388394.1"
FT   gene            <749868..>750659
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3250"
FT                   /db_xref="GeneID:3372045"
FT                   /locus_tag="cgd7_3250"
FT   mRNA            <749868..>750659
FT                   /db_xref="GI:66363045"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3250"
FT                   /db_xref="GeneID:3372045"
FT                   /locus_tag="cgd7_3250"
FT                   /transcript_id="XM_628487.1"
FT                   /product="membrane protein with no close homologs,"
FT   CDS_pept        749868..750659
FT                   /locus_tag="cgd7_3250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein with no close homologs,"
FT                   /note="with 4 transmembrane domains; transcripts identified
FT                   by EST"
FT                   /db_xref="GI:66363046"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3250"
FT                   /db_xref="GeneID:3372045"
FT                   /translation="MATIEMDSVEGFQLKHGSLIGGARKGCLCLSLRLSVFLHGLLNII
FT                   LLFLTISVLFSIPISLLGSNQEEVLPSGSSHFEVLNRFGLNAVNLMNKYLPRDLLLIIT
FT                   EIIRFIRGSTIEGKFVAFTLDISILSSLVSIFGVFSKSKGLIKFSIFAFLISQLLTIFG
FT                   IFYAPTLGKLYNLKVLSNPVLLLSILILVMFYTMWYSHLLYSYYKVLRAGGSGGEYLSY
FT                   REIIDRRNFLRWKTWKERELERGSPYNPSFSRSSEKDRLLK"
FT                   /protein_id="XP_628489.1"
FT   gene            <750977..>751768
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3260"
FT                   /db_xref="GeneID:3372044"
FT                   /locus_tag="cgd7_3260"
FT   mRNA            <750977..>751768
FT                   /db_xref="GI:66363047"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3260"
FT                   /db_xref="GeneID:3372044"
FT                   /locus_tag="cgd7_3260"
FT                   /transcript_id="XM_628488.1"
FT                   /product="SWIB domain protein"
FT   CDS_pept        750977..751768
FT                   /locus_tag="cgd7_3260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SWIB domain protein"
FT                   /db_xref="GI:66363048"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3260"
FT                   /db_xref="GeneID:3372044"
FT                   /translation="MGYRHISSDDCENSIEVDCTIVKNMQAPSQEVENHFSSIPVTSLN
FT                   LEEKHEEGRTLKKIKAKEKTYTIKTVIDKHIGTDWANSRIMTNLIPSKDCIESQIAIIM
FT                   SSCNLNVITLRKLYAILSICFNINLLNIDIQNVYQIIRENLLKQRKTDKQEIKKTKRVR
FT                   DKKKNQIKGLIKFMGEDIVSIKSCALRIKQYCEENKLVHPSNAKIFTLDQNLKDIFPGR
FT                   DSISKNVNDIQNLLKISNTEIEKECSNLHEQTINENDALKL"
FT                   /protein_id="XP_628490.1"
FT   gene            complement(<751866..>755249)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3270"
FT                   /db_xref="GeneID:3372043"
FT                   /locus_tag="cgd7_3270"
FT   mRNA            complement(<751866..>755249)
FT                   /db_xref="GI:66363049"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3270"
FT                   /db_xref="GeneID:3372043"
FT                   /locus_tag="cgd7_3270"
FT                   /transcript_id="XM_628489.1"
FT                   /product="importin/karyopherin (Arm repeats)"
FT   CDS_pept        complement(751866..755249)
FT                   /locus_tag="cgd7_3270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="importin/karyopherin (Arm repeats)"
FT                   /db_xref="GI:66363050"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3270"
FT                   /db_xref="GeneID:3372043"
FT                   /translation="MDALCKLYEGFSSPDGSIRQESETQFNNLKQSDPNTFLQLTLGIL
FT                   QQQPNSQYRVQAAISLRNVFREFVLTPDNCIWNKVSAENQAICLATLLKCLETEQVNVV
FT                   SLNLSDTVSLIAMELFPCGKWPDLLPFLFRLISNLQNYTGATTAPESVSIPARHAFRII
FT                   GEIMPVLDDVVTSHRDNIVSTINTALQFPDVEIRFEAIGLISSIVESNDKKNWSPLVPL
FT                   IPSILETLQNLISAQHALVIDVLYRLTTISESEPAFYRQHFSIFFPQILNIAKNIQLST
FT                   DIRQAAMECLLCIVETRPMMCVKHPSFVNDMVSTLLSFMLEFDDDPNWSEISPEQEEND
FT                   LESDIDDDDCLYPIGEEGLDRLARALDADSFIPIFYQFVTIYMQETSAHPWKYRYAAIM
FT                   AIAQTIEYLPEDDDNYQDRIGQIISRVLGFLQDQFPRVRYACCQTIGQISLDHSPFIQE
FT                   AFHSSVIPQLIQAIDDPISKVSSHALSALINFTEEVVAEDLQPYVRPLMEKLLGILHKH
FT                   PQPPRIVREQCITMVAVIAGVIENDFTPYYSTVIPYLKKTMNEASPQLRTLKGKCIECI
FT                   TIIGFSIDYSIFKNDAQEIMLVFLQLLGSGLKGDDPLKEYLQEALQRMCRIMKQDFVPY
FT                   LPHLLPGIFNILETREDSLATKLLNSNDSSSDEVDKSDGGSLGMLSAHDFIGMRTSLVL
FT                   DMESSLDILNTFIEVLGPSYHEYIAGTIKVIHPLIRFSLSDEIKEKTYEVLSGLLKIMR
FT                   ELAERDSNIRTQFSQIMNELITLFLSVMDEECRTGTIDSQVIVINGVQECLDSFGNNIL
FT                   NNEQVAIIASRCFDMLQQSFVRRRKLDERSVGENGEIQAKLDVDDDDDKRCIEEEKEQE
FT                   QELRLNILGILGVLMKYYPNVYWERVGNITIQLVSQHIVKVHNNVEDRVLGFHLSADVF
FT                   QYLCPTAYQHCLPWIQHILEGINDPIASIQQNCAYSLAQAAKLEQFSGVLNDALQVLLL
FT                   RLQSKTKGKSFNLAKDNCISVLSNIIVHHQGSINNINEIVNLWISLLPIKYDTDEAQNS
FT                   HTALMNLVDSKNPLILGQNLENFPRILAIFIDIYGTSMSNDSLNSRIKLLIAQTGPNNL
FT                   QSFAANFSKKQIDKLQKLCQ"
FT                   /protein_id="XP_628491.1"
FT   gene            complement(<755608..>756180)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3280"
FT                   /db_xref="GeneID:3372046"
FT                   /locus_tag="cgd7_3280"
FT   mRNA            complement(<755608..>756180)
FT                   /db_xref="GI:66363051"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3280"
FT                   /db_xref="GeneID:3372046"
FT                   /locus_tag="cgd7_3280"
FT                   /transcript_id="XM_628490.1"
FT                   /product="JAB domain containing protein"
FT   CDS_pept        complement(755608..756180)
FT                   /locus_tag="cgd7_3280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="JAB domain containing protein"
FT                   /db_xref="GI:66363052"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3280"
FT                   /db_xref="GeneID:3372046"
FT                   /translation="MKIEFNQTSYEKILSHSIKYPQSFIDGVLIGYSSGQTNLIITDSF
FT                   PLSHGPKLPLMVTLGIQYAQGYCDILNRLDKSPKLEIIGFYSGLPDEKCLNSGGSKTYL
FT                   DLISEKLLANNKNSILVTFSGQKVLFKESINVYLLRNKQLLLHTFIEDPLRLETKRLKD
FT                   LEYYNLCDFEDHLCNIQPKLVNNPLPI"
FT                   /protein_id="XP_628492.1"
FT   gene            <756985..>758850
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3290"
FT                   /db_xref="GeneID:3372047"
FT                   /locus_tag="cgd7_3290"
FT   mRNA            <756985..>758850
FT                   /db_xref="GI:66363053"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3290"
FT                   /db_xref="GeneID:3372047"
FT                   /locus_tag="cgd7_3290"
FT                   /transcript_id="XM_628491.1"
FT                   /product="cleft lip and palate family of eukaryotic
FT                   membrane proteins (potential transporters) with 9
FT                   transmembrane domains"
FT   CDS_pept        756985..758850
FT                   /locus_tag="cgd7_3290"
FT                   /gene_family="HOG000282469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cleft lip and palate family of eukaryotic
FT                   membrane proteins (potential transporters) with 9
FT                   transmembrane domains"
FT                   /db_xref="GI:66363054"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3290"
FT                   /db_xref="GeneID:3372047"
FT                   /translation="MQNSDISGTTSARAEETQNSWFSGILGTVIRVIFFQIVMNYFMGG
FT                   HKNAAINKTTGESIKPLGNYYKPGNIYDLYAHIIFGNEEFVSNLKFEYLNKSSILLEAA
FT                   NIINITSVIEVWRIRNLKYDNSDVNFSKNISFNLPMELFRYNIEDISNTYNDINAFLVV
FT                   SLIGKDKNDFVPINYVDLTKTMNKLSDEDSLISLLDSNDQKSIVDQHDKKVKYWKDNIN
FT                   IRVIYDNQNYNIGQSNVPPLSFMKYNVAEGIYLPIIYPSDFWCIERNFKMLNSTTINQP
FT                   FNLTLTFNTFSLFKYTIQRQMMDTWELQSRYGLGQSQKDIMMIKRILVETNKYYLIFSL
FT                   AFFILHSSFQMLAFKNDISFWNKNESMYGLSGLSILASFISELIIGLYLFDSNETSWIL
FT                   LIEIFIGIAISAWKLWKTKIFILSGRFPFFSIKDDSDAHLDSPDEGTKLKLEQEKLSRY
FT                   YDSIAIKYMSVLLAPCIVGYAIYSLKYYKYKGWYSFIISTLAGTVYTFGFIMMTPQLYI
FT                   NYKLKSVDHLPWRFLVYKALNTFIDDIFSFIIDMPWMHRMACFRDDIIFIIYIYQRWIY
FT                   RSKKEYQSSIERTNASVIEGNEKGNDHSSLPINKPNDPNKKSKIE"
FT                   /protein_id="XP_628493.1"
FT   gene            <758962..>759798
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3300"
FT                   /db_xref="GeneID:3372054"
FT                   /locus_tag="cgd7_3300"
FT   mRNA            <758962..>759798
FT                   /db_xref="GI:66363055"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3300"
FT                   /db_xref="GeneID:3372054"
FT                   /locus_tag="cgd7_3300"
FT                   /transcript_id="XM_628492.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        758962..759798
FT                   /locus_tag="cgd7_3300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with 7 transmembrane domains"
FT                   /db_xref="GI:66363056"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3300"
FT                   /db_xref="GeneID:3372054"
FT                   /translation="MQKKPIFHNFAFILDVINFATALSWFCAYLALFLKLKREKNVVGL
FT                   SLQTILMLVVAECNHVLITAVLSSHYHVELGLDFYLCDCSTALLSAVTFAYIYFNFYET
FT                   YESNRDTFGLNVTNFIICWISRAGRSNHFIQKKSNKYYPTSQKIFWLTVYILNFFLGSI
FT                   IFFLRKSSSPPIISFWESYMDSLLSLALLPQIFMFYNKKPRKVSSLLAHFVAFILLARV
FT                   FMLFYWILYPLFKLSIVPGRRLHIFSESLNVTFLMHFMYYFIRSKLNGENDIFLPL"
FT                   /protein_id="XP_628494.1"
FT   gene            complement(<759910..>760206)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3310"
FT                   /db_xref="GeneID:3371980"
FT                   /locus_tag="cgd7_3310"
FT   mRNA            complement(<759910..>760206)
FT                   /db_xref="GI:66363057"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3310"
FT                   /db_xref="GeneID:3371980"
FT                   /locus_tag="cgd7_3310"
FT                   /transcript_id="XM_628493.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(759910..>760206)
FT                   /locus_tag="cgd7_3310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363058"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3310"
FT                   /db_xref="GeneID:3371980"
FT                   /translation="KMSIKVEFSGGLEVLAGDRQNVEVNLNNLKSSSMKSLILYVEENI
FT                   IQYRKDHFIETGSKIKPGIIVLVNNCDWEILGGENYALSDGDLVTFIMTLHGG"
FT                   /protein_id="XP_628495.1"
FT   gene            <760471..>763092
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3320"
FT                   /db_xref="GeneID:3372048"
FT                   /locus_tag="cgd7_3320"
FT   mRNA            <760471..>763092
FT                   /db_xref="GI:66363059"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3320"
FT                   /db_xref="GeneID:3372048"
FT                   /locus_tag="cgd7_3320"
FT                   /transcript_id="XM_628494.1"
FT                   /product="RING finger protein"
FT   CDS_pept        760471..763092
FT                   /locus_tag="cgd7_3320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RING finger protein"
FT                   /note="with conserved extensions that are present in
FT                   plasmodium"
FT                   /db_xref="GI:66363060"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3320"
FT                   /db_xref="GeneID:3372048"
FT                   /translation="MINNNMIKREVVNERKQDCEHGSDIINNKDNMFNITVNTEPYDVL
FT                   ENDIMKNKSRKVNNSSKNGFESTNISNKILSEFTCPVCLDYYMLPVTIPCGHTFCRYCI
FT                   THNRLLGKKCPVCRQLIGYNFRINMTIHNVIVSLGIFKQIENSSQDERLYNEILLTNNE
FT                   LIGQNRPKWWQLCFCKPIISVTLFARIISDEILGIGIVFAEDLTRCIIDHLSKLSSIIQ
FT                   DKKLKSMIWSNGIYMIGPLEVNLLTKWMGCPPLPFKLDDKETGNLEKNSDFTLNNNAIF
FT                   KNQVKKWVEECIALKPTILNIGQSPFTKTSTYPILRILSDRIHRVESKIYDLGALRSPL
FT                   PWDLGRHSKSTIQVSHSSVSTNHLLIVNIKEHDQVAQELKYKSNTSHKFDESSPIEKDW
FT                   GIGVIDLGSSIGTMLKIQPKHRLATDEVIHLADRVEIIVKIRKIEEITNEDNLNGDSRI
FT                   LINEWKKLRWSNKLNLVINIDDYNKGEHKTINRAKNSDFEDLFGICNDKDKLDSSELSQ
FT                   ESKIVQVPLEELEIEEIKECLEVYIPIGSKSFVPCEGAKKTENGMYWSVIVHPSGMVFG
FT                   RGKNGALGLRKVEVTESNGYISREHCIFYYSSIRNREYEGLDYLSRSNGCLSNWFVKDV
FT                   STSGTFLRLKPFSYPVRVLPGMVLKVGQCKMEILPYMIGALYSGQPNSSVRNNSINLVS
FT                   QDFQPIQTNLTEVESSQTHVSNTNQIPIPYLSNSALFTQTLNDQYLSNINNNVIAQLNI
FT                   LAAYNYINSSSITNLVNSNNIVEFNNQTYEDRIIQRQNSSFDNIILQSILRNSIVNNNI
FT                   LSAGHYLGNIQTSEDNSITGGSIGSLEVNSILNYDRRPREPRVTQEVDVSFQIESFENE
FT                   DC"
FT                   /protein_id="XP_628496.1"
FT   gene            complement(<763182..>764333)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3330"
FT                   /db_xref="GeneID:3372049"
FT                   /locus_tag="cgd7_3330"
FT   mRNA            complement(<763182..>764333)
FT                   /db_xref="GI:66363061"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3330"
FT                   /db_xref="GeneID:3372049"
FT                   /locus_tag="cgd7_3330"
FT                   /transcript_id="XM_628495.1"
FT                   /product="Ced12 family of proteins that are conserved
FT                   throughout eukaryotes"
FT   CDS_pept        complement(763182..764333)
FT                   /locus_tag="cgd7_3330"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ced12 family of proteins that are conserved
FT                   throughout eukaryotes"
FT                   /db_xref="GI:66363062"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3330"
FT                   /db_xref="GeneID:3372049"
FT                   /translation="MPHPDTVKGKIPSVFHDITTKNSFIPDITINSYEIHVDGSFQDII
FT                   KEKLRREKSGKTIYNKIQISIINRFWKLSKERKLLHYIRNKCLISLNCADPNHEQLFQD
FT                   YWALAYPDYPEINRISSNWRLLGFQNDDPRFDFKCAELLTLENLVYFAENYRNIFKVIL
FT                   KESQRFSSSEKIKYSHQHSIQRSIINSHKINGMMSPFETPHNFQPSSSNLSIITTPINM
FT                   KDSKKEFGSNFEPLLPKVTELRSTISEISNSSQIDQMNFSYPLSTALINVSIMICLYLN
FT                   FIPSIYKIPGVPNVSASRKAMKNFMRLTNEFSFNTISELFSVCAIRFHAEWLDIVKFLG
FT                   HKVAISEFDKVLKNVQVVMAETIENLPKDIIEFRQICNLEKYY"
FT                   /protein_id="XP_628497.1"
FT   gene            complement(<764585..>765130)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3340"
FT                   /db_xref="GeneID:3372025"
FT                   /locus_tag="cgd7_3340"
FT   mRNA            complement(<764585..>765130)
FT                   /db_xref="GI:66363063"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3340"
FT                   /db_xref="GeneID:3372025"
FT                   /locus_tag="cgd7_3340"
FT                   /transcript_id="XM_628496.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(764585..765130)
FT                   /locus_tag="cgd7_3340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363064"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3340"
FT                   /db_xref="GeneID:3372025"
FT                   /translation="MESKYGNKIMEDRDCLSSKNTSYGLSMSNCIKPLPKDIARLALYI
FT                   VCISDFSSIIQASYDIASSATVSTIFVIFSIICSSFGLLGFYSITKNNNSTMKYYVVYT
FT                   ILRLILESITSFGMSIIFYIYFKSAMYDENLPAWAVFLINATCLTLSRIAFSYVAFSFY
FT                   QRLETQNQENFEKVTDKV"
FT                   /protein_id="XP_628498.1"
FT   gene            <765433..>767394
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3350"
FT                   /db_xref="GeneID:3371981"
FT                   /locus_tag="cgd7_3350"
FT   mRNA            <765433..>767394
FT                   /db_xref="GI:66363065"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3350"
FT                   /db_xref="GeneID:3371981"
FT                   /locus_tag="cgd7_3350"
FT                   /transcript_id="XM_628497.1"
FT                   /product="eukaryotic DNA topoisomerase I"
FT   CDS_pept        <765433..767394
FT                   /locus_tag="cgd7_3350"
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic DNA topoisomerase I"
FT                   /db_xref="GI:66363066"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3350"
FT                   /db_xref="GeneID:3371981"
FT                   /translation="IELSNLIQIEENMASATDSSLSNTNKRRKVMKKTEMDYEPLNKWW
FT                   ERPPKEELGIQWEYLEHQGVMFAPPYKVHNVPLEYNGERIQLPPEAEEIASYWSVMKDT
FT                   EWAQKEKFSNNVRKAFMNSIPVGDKLHNNLEWEKCNFDIIKQYFEDEKEAKKNLSKEEK
FT                   ELQKKCRGDQESPFVYALVDWIKEKVGNFRIEPPGLFKGRGEHPKSGMLKRRIFPEDVT
FT                   LNIAEDAPVPKVPNSMKGHAWKDIFHDNTVTWLAYYRDSINNQFKYIFLSASSGFKGMS
FT                   DYNKYEKARKLKDHIDAIRDDYRKKMTSGDITQRQLGTATYLIDFLALRVGGEKDTDEE
FT                   ADTVGCCSLRVEHITFNQQEKSITLDFLGKDSIRYYNTVVIDPSAFNNLTIFCRNKDKM
FT                   ENVFDQINMSSLNQYLKSIMPELSAKVFRTFNASITLERELSKISAKSAVKSEKRTKME
FT                   LESYLKDELNLSNFNNEVDITNVNDILRFYNDANREVAILCNHQRSVPKQHESSMEKMI
FT                   KQQQELEEDLKICEAFLKILKKNNKSVTISDLPKLSTEVSFNGKQRKYPINLNSSLDVV
FT                   QKKIDSIKSKISNLYLKIKIKDDNKTVALNTSKINYMDPRISVAFCKKYDLPIDKIFNR
FT                   SLRTKFPWAMYTRSDFSF"
FT                   /protein_id="XP_628499.1"
FT   gene            complement(<767424..>769919)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3360"
FT                   /db_xref="GeneID:3372050"
FT                   /locus_tag="cgd7_3360"
FT   mRNA            complement(<767424..>769919)
FT                   /db_xref="GI:66363067"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3360"
FT                   /db_xref="GeneID:3372050"
FT                   /locus_tag="cgd7_3360"
FT                   /transcript_id="XM_628498.1"
FT                   /product="hypothetical low complexity protein perhaps
FT                   membrane associated"
FT   CDS_pept        complement(767424..769919)
FT                   /locus_tag="cgd7_3360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical low complexity protein perhaps
FT                   membrane associated"
FT                   /db_xref="GI:66363068"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3360"
FT                   /db_xref="GeneID:3372050"
FT                   /translation="MYTQNETSPNFENKKIKSEEARHLIDSSDESNSEKINNIIGISIE
FT                   DFWFDYRIWCFLFKVRLEKIQSINQFISNNILNKENGHACIKTIIIELEKKNPNNKIIR
FT                   YDFERFRPNIHEKKLSFPKIPKDFYGIDSFLEHAKQYFNFNASSKDYNEMLTLLSCDSF
FT                   PYISKLSFVDRLVFVTITVCEYLNFNYLQGIHEIIGCLAFLKKNPIPINYHIILSIEII
FT                   NRWAKFLILPNLFNSCKDLLNRNNVCKSEQNWKDHEIIEVSNENTIFGILHNYFISDQL
FT                   SEVEKLNCEDITENMQISVFNNISHNNLKVGVPEYFENNEFKPIYQNPSVKINAIEQIL
FT                   IICNEFHSFGYFHIPNIFDEIEKSIGSNIWSCNVFITCGSSLFIEIENVLLFWLNLIFS
FT                   SSDIDYKPPFFPKIRSSLQLSTFLIVFLKSLEHKLKNDIYLICTDRFKLDLDLNVRIGI
FT                   ISVLHPFLISNNNTESTDSFMSVQQSSFDEFIGEKKSLFLDLFQVILAMESLLMSTPIS
FT                   LQKRIINNLDSFESHSSFESIHPNNCINFIEPRELLFYDDDFSIKNKKCLDGIVNIVSG
FT                   KDIVLIDILSSFYFDNTMSLDLDRVINRLGSLEELIKLKELSNKNIDYELATLFDEELL
FT                   SIILLPILRLSLKTTRIVKIPLENEKDRINNQVICQFLEFATRRQRALLIQQRPCIWIL
FT                   YGPNNQLRDEFASKLIENGITGVQLIDANRVFYELLEKCNSVNNFDFLTNVIKDVKSNL
FT                   CLINSRPNYKNRALLKISTLKKKNTMNESLTAMKVIDHNQNLKTTNKLELKSSNEKQYL
FT                   NMCNRIIKFKPNRRKMYYK"
FT                   /protein_id="XP_628500.1"
FT   gene            <770007..>770957
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3370"
FT                   /db_xref="GeneID:3372051"
FT                   /locus_tag="cgd7_3370"
FT   mRNA            <770007..>770957
FT                   /db_xref="GI:66363069"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3370"
FT                   /db_xref="GeneID:3372051"
FT                   /locus_tag="cgd7_3370"
FT                   /transcript_id="XM_628499.1"
FT                   /product="hypothetical secreted protein, signal peptide,
FT                   possible transmembrane domain near C-terminus"
FT   CDS_pept        770007..770957
FT                   /locus_tag="cgd7_3370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical secreted protein, signal peptide,
FT                   possible transmembrane domain near C-terminus"
FT                   /db_xref="GI:66363070"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3370"
FT                   /db_xref="GeneID:3372051"
FT                   /translation="MILNQTKHIYIMNKLLFAIILVSYIYKFANCFISSFSGPFMLFYS
FT                   VLRTIDGMAENIQHISNSMDLSLQSFLSTQFLSKISDKVDNPIVIGADYHGSVSPCELD
FT                   FHPLISSNIFIERSIDKNNTNYFQVINNSSIVLPFTNNKNIQIFESTKYKTENIAGFDS
FT                   LLFKRMDVNLVNKQNDINNENNYSTLLEPFHYGTKMVSTEFKNQNGNGYVNDLILATKI
FT                   FNPLQNFEINNKNINNQNIPTRLGKSISSNEIFYNHQYELRETENTEFDLNSFRLYTYY
FT                   TTHYLFQITSIFSMGISLHSQYRRKSRQRKLHLVK"
FT                   /protein_id="XP_628501.1"
FT   gene            <771689..>772315
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3380"
FT                   /db_xref="GeneID:3372052"
FT                   /locus_tag="cgd7_3380"
FT   mRNA            <771689..>772315
FT                   /db_xref="GI:66363071"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3380"
FT                   /db_xref="GeneID:3372052"
FT                   /locus_tag="cgd7_3380"
FT                   /transcript_id="XM_628500.1"
FT                   /product="putative secreted cysteine rich protein, possible
FT                   transmembrane domain near C, signal peptide"
FT   CDS_pept        771689..772315
FT                   /locus_tag="cgd7_3380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative secreted cysteine rich protein, possible
FT                   transmembrane domain near C, signal peptide"
FT                   /db_xref="GI:66363072"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3380"
FT                   /db_xref="GeneID:3372052"
FT                   /translation="MKFYARLIILHYIYFVEIINHIFVEALVNDAICNVASGIMVKEAC
FT                   SAVTNAACSTVGTVACQTAGDIACQAMGEAICQTTGNIASDAVCHTACQIASNTAGEAV
FT                   CNIVSQISSDSVCATACQVASTVIGQSSSDILAGFGAEITSSLISKSASSQLMAASAAA
FT                   NSVTISVTISTVMSILQVMISLFGMGFNLYTHIRSLNARRPYYVR"
FT                   /protein_id="XP_628502.1"
FT   gene            <772665..>775049
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3390"
FT                   /db_xref="GeneID:3372053"
FT                   /locus_tag="cgd7_3390"
FT   mRNA            <772665..>775049
FT                   /db_xref="GI:66363073"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3390"
FT                   /db_xref="GeneID:3372053"
FT                   /locus_tag="cgd7_3390"
FT                   /transcript_id="XM_628501.1"
FT                   /product="secreted alpha beta hydrolyse, signal peptide,
FT                   secreted patatin like esterase (ralstonia best hits)"
FT   CDS_pept        772665..775049
FT                   /locus_tag="cgd7_3390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted alpha beta hydrolyse, signal peptide,
FT                   secreted patatin like esterase (ralstonia best hits)"
FT                   /db_xref="GI:66363074"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3390"
FT                   /db_xref="GeneID:3372053"
FT                   /translation="MHILQLFFLCLFIASYSALCKFSKKGIPIPNRHHLEDAHNNICYA
FT                   LIMSSGSNKGPWQAGVVRGIAQKYHDSGKKLRWDLVGGTSVGAINALASQFYPPGEELA
FT                   WTTELVILWKMARQKDITTCKTPLKKNYARWAVSFLKGWISSRNPFRYLCDNSPARKLL
FT                   RELFLHRKHKQRLFFTNTMRYTDRTAHVFTEQLELEEIIEAVIGSGTIPGIFPIKYLRN
FT                   LGYHVDGGFIAAGDLETAIKRCIAVGKAKTPRDVVIDFISAEEPRELKRNTSFLEGEDH
FT                   RSPHQLPLYYIVLQSLGILSDMVSSTSVVRQIISKYPDVTIRYLIQPNEEALMWIPGVM
FT                   VDFSQWKKMHRVIEAGYKSGYNALPITGEKLKTIMEPAETHFHPPDPADVSSILEQYYQ
FT                   ECEARKISSGFRPMGLDDVTLYLLTSNVEKAIKTVFTEVSPYKDIFPYKDSIAFATFMG
FT                   PFFITKRCIDLMHYFALARGVRSPTQSQFYSWVGKLCNIIASKVNEYNTGEIRNLSKQY
FT                   FVEELPITLQDQGSAEITYEFGNQSIHDLSENFVENSLDDGKDIDSDNIATKIRNLIYA
FT                   LSNDNKHIIGMTFLEFTNTKRSIAGLSQCVNILLNDLQEKLDQISPGAALRRALLIKER
FT                   KLKNTHQTLNSFVVVLKSLNDDIQRLNKTMITIDSFLKSSNNISNKATKLLKYIEDKQK
FT                   KGIFSAKFEDVITLLSLYEDYVEKLQGIRIKEINSRRIIVDSKHSQLILARIIIALREQ
FT                   NEHFPKLINGKSTEGISESINRCISIVDEQYKPILAAKDSS"
FT                   /protein_id="XP_628503.1"
FT   gene            complement(<776186..>776623)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3400"
FT                   /db_xref="GeneID:3372055"
FT                   /locus_tag="cgd7_3400"
FT   mRNA            complement(<776186..>776623)
FT                   /db_xref="GI:66363075"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3400"
FT                   /db_xref="GeneID:3372055"
FT                   /locus_tag="cgd7_3400"
FT                   /transcript_id="XM_628502.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(776186..776623)
FT                   /locus_tag="cgd7_3400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363076"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3400"
FT                   /db_xref="GeneID:3372055"
FT                   /translation="MMEFKYIVVCVILYLIHDTIEANSIHNKIQLGSFAEYDILDIIAN
FT                   TKRSGTNLRRNLSSLEINKQFNSSIVPAYMKINHGACKEQYREQTIHISSSPVFISLNY
FT                   SIDNQIEVNGTDSISIKCCSTIISPKLITNVNTTHVVDLID"
FT                   /protein_id="XP_628504.1"
FT   gene            <776919..>778697
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3410"
FT                   /db_xref="GeneID:3372056"
FT                   /locus_tag="cgd7_3410"
FT   mRNA            <776919..>778697
FT                   /db_xref="GI:66363077"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3410"
FT                   /db_xref="GeneID:3372056"
FT                   /locus_tag="cgd7_3410"
FT                   /transcript_id="XM_628503.1"
FT                   /product="SNF5 like protein"
FT   CDS_pept        776919..778697
FT                   /locus_tag="cgd7_3410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SNF5 like protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363078"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3410"
FT                   /db_xref="GeneID:3372056"
FT                   /translation="MGRRKIKNVLRMESNDRSDEFVAKPSPNLVMSEKKLIFEDHLLEN
FT                   IQLENITIADVKRITSKTFDFLRATGLRQTHISATTGINQSILSIILRDPGTKTISINR
FT                   KKDVVFKLCEYYNKINLGLISHDPLTAPKISNSKKSGEIIQKKRTLSRRNTFEDGSNDN
FT                   SIIPNPEIFVHSNPCQYNNFELEKKDDESQESVIDSECAIYGLKESKMKRIDDSSNNKS
FT                   LGKNILLFSSCIGCSIIPTKIREEKKLFIEYSSSGPMSSFINDNNTLIKFTELNHSCKL
FT                   SENHLNFDCNQDFTSRILEPILIPLSVNLRHFITSSFTDNCIAENTNISSVSRSNSSAI
FT                   LSTLKGKNFKPERFIWSSVSDSTALWGFVENLSRERHLSIFMSNSEKRKAFNWLVREIE
FT                   NYKSLYLQFLCVTLPSNIRPGNDSLLIREIRLNESYEDVIVNDRFEWNISNPTNQLLRY
FT                   VECLISDLNLPQELFSELLYSALKQVFDEITNFVKRFNHKNITDELNSAQYINDQYEDD
FT                   TSSNYSFGANFETRTNDENIDKESTRFVSYGNFIKWGSRADLEYDSDDNAKRFPTIENA
FT                   EERRQIENRNRFRKRR"
FT                   /protein_id="XP_628505.1"
FT   gene            complement(<778751..>779251)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3420"
FT                   /db_xref="GeneID:3372057"
FT                   /locus_tag="cgd7_3420"
FT   mRNA            complement(<778751..>779251)
FT                   /db_xref="GI:66363079"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3420"
FT                   /db_xref="GeneID:3372057"
FT                   /locus_tag="cgd7_3420"
FT                   /transcript_id="XM_628504.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(778751..779251)
FT                   /locus_tag="cgd7_3420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363080"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3420"
FT                   /db_xref="GeneID:3372057"
FT                   /translation="MRHTRRFTIEIGRCLTFDCYYCEPEKTTLLRSQNDKESSHKINTI
FT                   DVVKPDYLINRNDLLSSFFPGLYKVTKIQLCKNELLVYAQHDQQFIDISVLEIPAQEKC
FT                   LFPSTVHETLANETWNFVVVLFRKVKKTTKPKRKRLGASVLARKGQIILVENIRFVRCG
FT                   KSR"
FT                   /protein_id="XP_628506.1"
FT   gene            complement(<779380..>781293)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3430"
FT                   /db_xref="GeneID:3372058"
FT                   /locus_tag="cgd7_3430"
FT   mRNA            complement(<779380..>781293)
FT                   /db_xref="GI:66363081"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3430"
FT                   /db_xref="GeneID:3372058"
FT                   /locus_tag="cgd7_3430"
FT                   /transcript_id="XM_628505.1"
FT                   /product="protein kinase"
FT   CDS_pept        complement(779380..781293)
FT                   /locus_tag="cgd7_3430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /db_xref="GI:66363082"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3430"
FT                   /db_xref="GeneID:3372058"
FT                   /translation="MHYGANKVVPTAIMPQNKFMNNYTINGVRNNIYNFHSHAENNNFQ
FT                   SLSPCINNLDIVNLNQRQFILHKQFTPPQTSNNLRCASLSPFSRLDNLKFKREPSNILI
FT                   QKYSTQIIMPSLTSRRDGLNAPPVSFKKFNVFQHCNIQGSQSSPYNLHAVPGTPSSRET
FT                   YFFSKQSNLILSDNKTNKNSTDKVSTTMLPSCDKNKKASKSERSLFSVSASNLQLNNGN
FT                   SVSKAVRMDNTPKGSQYDSFSTKIEQSETKYTDVNSEYPSETFSQLTSNNEIIEVKKDL
FT                   IKRVPDASNGVLQRLKPNEYIKMDDLMLEPATQRGSFGVVFKGRIRSGIWSNKEVAVKR
FT                   WKFDNESRISEEHFKSLEREVYAYRLLRHPNICSYIGVCLEPGFYAIITEYLTNGNLFE
FT                   LLYENKVVVSASDRLKISRQLCDAVNFIHHNNMVHRDIKTANIILDRSNNVKLCDFGQT
FT                   RTMNIATKTSPPGVVLDENGGSPRYMAPECFYIGRSIDEKSDIWAIACCLLEIFGGPIP
FT                   FYEYSSNEEVINAIIVEKKKPKIPSWFHPSISNLLSKCFERKPFKRPSSYEVLMILNGI
FT                   NSEDIKEYGMNVKRNINGDLVPGNNVNCNSINMRNGGRVVGNCVGVAQQKRIVVRAPPA
FT                   LD"
FT                   /protein_id="XP_628507.1"
FT   gene            <782000..>782398
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3440"
FT                   /db_xref="GeneID:3372059"
FT                   /locus_tag="cgd7_3440"
FT   mRNA            <782000..>782398
FT                   /db_xref="GI:66363083"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3440"
FT                   /db_xref="GeneID:3372059"
FT                   /locus_tag="cgd7_3440"
FT                   /transcript_id="XM_628506.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        782000..782398
FT                   /locus_tag="cgd7_3440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363084"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3440"
FT                   /db_xref="GeneID:3372059"
FT                   /translation="MNNRNFRGLNFKIENIQHDSNLILQLTELICNEPLDVKMYIETLV
FT                   ERINLKNIDFANLMLEKIKTTLNDALNTILINCEDLKTLEANSVILKEGSRKLFKGILR
FT                   DNCYIEKDMRNLLFASIAIVAIIILLNK"
FT                   /protein_id="XP_628508.1"
FT   gene            complement(<782487..>784394)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3450"
FT                   /db_xref="GeneID:3372060"
FT                   /locus_tag="cgd7_3450"
FT   mRNA            complement(<782487..>784394)
FT                   /db_xref="GI:66363085"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3450"
FT                   /db_xref="GeneID:3372060"
FT                   /locus_tag="cgd7_3450"
FT                   /transcript_id="XM_628507.1"
FT                   /product="major facilitator (MFS) superfamily transporter
FT                   containing 12 transmembrane domains"
FT   CDS_pept        complement(782487..784394)
FT                   /locus_tag="cgd7_3450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator (MFS) superfamily transporter
FT                   containing 12 transmembrane domains"
FT                   /db_xref="GI:66363086"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3450"
FT                   /db_xref="GeneID:3372060"
FT                   /translation="MKPSANDDSIYELDSKKFDLYKETSVANGCYRHERYMKHPRAVRF
FT                   VFAWMLIAQVLRNYDTGALPVLLGLISDEFGLDEMKLGVLGAVPYVSAMATAFIMNHPL
FT                   QKYSQKWIIVTSLFFLSFGLALLISSTTSTLLYISRIIMGSMQAPLSIYIPVWVDEFTP
FT                   PNKLTAWMGASQVTMIIGVATGYLITGFSLNYHNGWRYSLLAPCLLLLIMSICLVFTKS
FT                   EYFNVKYFNHEGRNSEIEMGGGKMNSDDAISLDRQIKDSAAIQCSIPSSCSTELVESPY
FT                   NSIAVSTKLITLNKSQENISNSNNTFSFDTRVQKISGDFSAEITKSRIEKSALSDLNDT
FT                   KNTVTVEKSTDFQPTLTTHYISISRSLSLSEFTNGTSQSSQPLNSSIINLNQEPSANAT
FT                   NEEKLESENSKSSVLKRLIAYSKWKCLLANSIYMLSITTLSVIYYVVTAVQFWTTRYLQ
FT                   QIYTTRDGIIFMSFSATAVIAPTTGIVFSGFIIDFIGGYKSERGLFYTMLFCMVSAIFA
FT                   TLFGALALIVDNFTVTIVGVWGLLFFGSFLVPPITGISVGVVEPQARQFATTVAMVTYH
FT                   VFGFALGSLLPGAVLQLSGINRTGMTIVYGFSGLGVIVNFFACIIAYRKLRASKESIHT
FT                   "
FT                   /protein_id="XP_628509.1"
FT   gene            complement(<784523..>785395)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3460"
FT                   /db_xref="GeneID:3372102"
FT                   /locus_tag="cgd7_3460"
FT   mRNA            complement(<784523..>785395)
FT                   /db_xref="GI:66363087"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3460"
FT                   /db_xref="GeneID:3372102"
FT                   /locus_tag="cgd7_3460"
FT                   /transcript_id="XM_628508.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(784523..785395)
FT                   /locus_tag="cgd7_3460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363088"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3460"
FT                   /db_xref="GeneID:3372102"
FT                   /translation="MSNQEKNKFALQIDTHWGDPLYVIYKNSSGFILNFETWKYAKSRS
FT                   KSIGILLEMSDSNGLNKYPFCLTILSSGKLINTLSNSRIFLDKFIKLLISSPMVNELNK
FT                   FPLGYGQIVFFDELLFLVERGSLLLFSWSRSRLEWVQTPILYLFDAFIRNEEQFKLNNY
FT                   ISYSRMKRSGYKFKTSSNENKVIVQDNIHSDTKFLKCIDEAEHVQYGTAIKQTIVLSSI
FT                   NSNLESYLITNLESKPKDGEKNDLFFASKQPHDTFLIGNNITRSNNNFIVSIISINSET
FT                   RLKASIYKF"
FT                   /protein_id="XP_628510.1"
FT   gene            <785835..>789827
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3470"
FT                   /db_xref="GeneID:3372061"
FT                   /locus_tag="cgd7_3470"
FT   mRNA            <785835..>789827
FT                   /db_xref="GI:66363089"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3470"
FT                   /db_xref="GeneID:3372061"
FT                   /locus_tag="cgd7_3470"
FT                   /transcript_id="XM_628509.1"
FT                   /product="large low comlexity protein, potential zinc
FT                   ribbon"
FT   CDS_pept        785835..789827
FT                   /locus_tag="cgd7_3470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="large low comlexity protein, potential zinc
FT                   ribbon"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363090"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3470"
FT                   /db_xref="GeneID:3372061"
FT                   /translation="MSVNIYASVIDNSLIKVLFVKTKAADSALFDDVIKQIQNSIIHYS
FT                   LNIDQLKTSLKCDYINQNRSLLETKPFKINTVYRTICSNSNKTNIPRSLICIDHVVIFV
FT                   TLKKKKCFNNKIFDNETNIPDHPFIYRVDIDIIDSINKEIELNCEDKNGIQFNSINELA
FT                   ENVILNIFCKFNSIVNKYIDKGYDKITKIELLEDKTLEIIRYRMRIAGIYLALGSPISS
FT                   AMYYNSILELIEDHDLDLAYYLAHCFEGQATMLYYFYSNSENSLEWWEVVSNSLSSFIQ
FT                   DLPIPIQVSLQSNNYNSTNYNDSIYIIQSRKQIFFDSILKKLNLSLNLLWKINHFTNGF
FT                   IISDNNTKLNYNSDFSVSIYELIIKKSRFLIENFVSHFYLDRKIIIDFLDPFVNLNIPP
FT                   DYSRNDLYNYAMFLIGCAEIYFNINSKRRVGIILIKLSQLFNQNKIYNHSYYISCAAYQ
FT                   WYSSIYTGTNNFDLLKIIQNLAAHILKEEDNYSTHIQCALCNVSNNSNILLGSNYRLDQ
FT                   ITEKKLGIMFEKHYVPGKLYLDNNYLQYLSIYKHDLSLSYSALISNGGTSLYQDLECSN
FT                   AHYELLASLKPFVNSFVSYGVHSMLQAYRKFYLNTIDLQKLKAYPSRYEMLALITMIES
FT                   SILFGCASRSATVLLLILDKIIYFPPIYNYDTLKIIQSKCIDSLSIISNTIQLPIIRAP
FT                   YYSVTNGKNRCYTSIESLDHLFNTLLHTTQLILIFDVTFEQIPLNTECYKCNNEISLSS
FT                   IFSAKVNDYCSNCESKMLKTDSSPMIFCKTSNISYFSDPKFIIQPEFKWVPLKVNNAKI
FT                   PVLNSLKANQSNLFLYNPFEKKVNDLREICNHGKSQVETQTNIIWQAEKQYTIYVSLFN
FT                   PFLIPIILDCFSVIIKGEVKCEISPVSVVIPPTPRFSTPGEVKVAIAVIPKNSGNLSII
FT                   GVTYKFSGINYVNFGSKLSFFNNKNNLKQYLNIFVVPNISYDDIIFWEKNDMQKQNLCI
FT                   NNNGKVVIKSKKKLNYEAEKKIKLLTSEVFIDQTEGTNEIFSFENMITKDNELIVTIEC
FT                   SNIYKMNRYKLLVTHWLEINGKVIISSKLFDLFSNIPPLPKITNISWIPKLDFQQACFK
FT                   SNNNKWKVSNIWVIFTLENNSRVYPIEFSFSSNLLEGKKALLLPDKRNYRWVVETKIKN
FT                   LIELQSNPLLLNWKAFFPNIIFDKNKSEFIIAGNLTANILIPEFLSRYEFYVEIKCNGT
FT                   KIENRQAIPVNSMANIEIYAISERKSTSLTSIRIIPFGDTMKSKQIYLDYYESDINVSE
FT                   VPILYFSIIGLEKKTYEWIVGVEELETSTQERVFHWKNDLLSISFT"
FT                   /protein_id="XP_628511.1"
FT   gene            complement(<789816..>791734)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3480"
FT                   /db_xref="GeneID:3371960"
FT                   /locus_tag="cgd7_3480"
FT   mRNA            complement(join(<789816..790835,790880..>791734))
FT                   /db_xref="GI:66363091"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3480"
FT                   /db_xref="GeneID:3371960"
FT                   /locus_tag="cgd7_3480"
FT                   /transcript_id="XM_628510.1"
FT                   /product="cytidylyltransferase (HIGH family) exon-1"
FT   CDS_pept        complement(join(789816..790835,790880..791734))
FT                   /locus_tag="cgd7_3480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytidylyltransferase (HIGH family) exon-1"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363092"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3480"
FT                   /db_xref="GeneID:3371960"
FT                   /translation="MSEIESGFLILDPQWWTDVNISDSARHTLFKLLYSCIFHTSHSLF
FT                   IYYSVLPQSDEYSHEINKSFIKPSEADCNSQRSSFVNLTYKHVNSIVKAYEIALDIIET
FT                   LNKMPTFDIRFIPVKNDCLSHIYKTMGLSDQTLFWSNSYKFCEKHGNLVQCANIINNIF
FT                   SCICRKNMYYINFNSENTDINSIICKKYTAHLVSHGFQTFEVSESPSIPLWKDKLNTVL
FT                   ENVNDNFFDSPINRTLFAGTFDRLHPGHKVNITVATWYAKELVIIGITDKLFNANKSDK
FT                   DIIQDFSFRSANVHSFIFSLSPDISVAILRISSIVGGADIFEFDALIATPESYNNAAKI
FT                   NDLRVACGSPVVKLVKVPFVYRPLINHSEGVKPTNGSSVKFCSTGLRYSLKQNLDNPLN
FT                   LSILRKSITLLLNKMLPSELIFNDISAITNMIFSFIDDIIFEILYGWRALLGYEKGRAV
FT                   FEKWFSQLILELEKEGKIADLNLVENNSFLSISKHLTLIIIYLISTLNLIKKKKVEISH
FT                   GDLKKINLLFNKLLMDGDSKVKWGCEHSEFCIPYIFCHSDVEKNIFFSKASSIKYSAFE
FT                   YQFGDLIGDEVLNLALNYKGSSNVDIYEDYYLKFEFVKRRLDEFFSSK"
FT                   /protein_id="XP_628512.1"
FT   gene            <791914..>792666
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3490"
FT                   /db_xref="GeneID:3372104"
FT                   /locus_tag="cgd7_3490"
FT   mRNA            <791914..>792666
FT                   /db_xref="GI:66363093"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3490"
FT                   /db_xref="GeneID:3372104"
FT                   /locus_tag="cgd7_3490"
FT                   /transcript_id="XM_628511.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        791914..792666
FT                   /locus_tag="cgd7_3490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to ribosomal protein L10/L1 family"
FT                   /db_xref="GI:66363094"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3490"
FT                   /db_xref="GeneID:3372104"
FT                   /translation="MDRFKLSNPIKAQKHLEDAVNALKELVKIKKCPEDLLFNKNSQFI
FT                   TLIISLSNTPEFVKSKHVRIKIPNSLYKHPGNEVCLFVKDPQRKWKELISSSSIEPKVV
FT                   SKVIGVSKLSKKYSTYKDRRELCSGYDLFLSDDRIIEKMPKLLGSYFIKANKMPIAIKI
FT                   RESNFKNSLESALSSTFMSIKKGKCIGIRVARVDMNTKQVVQNLIEAIKQVSDFFEGNG
FT                   SKNWRNSIESLYIQSTNTMSLPIWFKEK"
FT                   /protein_id="XP_628513.1"
FT   gene            complement(<792775..>793581)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3500"
FT                   /db_xref="GeneID:3372103"
FT                   /locus_tag="cgd7_3500"
FT   mRNA            complement(<792775..>793581)
FT                   /db_xref="GI:66363095"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3500"
FT                   /db_xref="GeneID:3372103"
FT                   /locus_tag="cgd7_3500"
FT                   /transcript_id="XM_628512.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(792775..793581)
FT                   /locus_tag="cgd7_3500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363096"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3500"
FT                   /db_xref="GeneID:3372103"
FT                   /translation="MMLGHFDNHKDSPSEAIHDSNIDESDSDLFGESDSTPDQVHNDGH
FT                   CFMIEKDDAKTHTSINDNINCDRINNFEDIKNLKLQLPTNYFGIDNKDQVLLTLKLPER
FT                   LKVVNKTNVDNTTESGLCIKGGIKGEGDSYSNSKLVSWSDGTYSLFINDELVYDCVIGP
FT                   DKAFIFDDTFDKKYKVCIERVDNKLTVRPRTIEKSKLLRDSRSRAMMPTTLEEINIHEV
FT                   ESRKRIDELNTISSIKIQQKRTICTTESRKKQMTSHFLEESSEESI"
FT                   /protein_id="XP_628514.1"
FT   gene            complement(<793624..>795994)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3510"
FT                   /db_xref="GeneID:3371837"
FT                   /locus_tag="cgd7_3510"
FT   mRNA            complement(join(<793624..795228,795272..>795994))
FT                   /db_xref="GI:126654046"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3510"
FT                   /db_xref="GeneID:3371837"
FT                   /locus_tag="cgd7_3510"
FT                   /transcript_id="XM_001388358.1"
FT                   /product="helicase, putative"
FT   CDS_pept        complement(join(793624..795228,795272..795994))
FT                   /locus_tag="cgd7_3510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase, putative"
FT                   /db_xref="GI:126654047"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3510"
FT                   /db_xref="GeneID:3371837"
FT                   /translation="MCYSKRFGFPNEPYEIQSEFCSAAWKLYEIDGGIGIFESPTGTGK
FT                   TLSILCSSLSWISQQIYGPVSFARESKPMPLWVANAIRKSRENSCEQYINEKINFLKSI
FT                   NKDILTSTKKNVKELISSENLDFFSSYYQIIISSRTHTQLMQFVEEFNKIKMANKDNTH
FT                   ISNIYSIVSLASRSHLCLNNEVKNYPNHLINEVCKMYSSEEKKENKCLYKENYMELAKK
FT                   CLIEPMNIEELRKEGKNLIACPYYAAKEASKYSDIILAPYSIIFNKTTRESFGIFLDKK
FT                   KTLCFIDEAHNLVNALESNNRVSLTLLSCQILSYSFEKLISLDNSVPGDNFVATFKQLA
FT                   RLVKCIHSSTSKIISSKKRKYGENEVKSNQIFLGPLEFLNFYQINTFNLNKIINFIVEN
FT                   ELCSKIKNIIIKFGRDFPIKFRKFEEIISHSNSLFLLKDFIVALIRSDKEFDKVIIETS
FT                   FNHSDGKQATITVVPINVQTSFNDVFANTKSTMLVGGTLEPLTEFSPLLLPLEPMNIVK
FT                   FSASHHISNNNLMCLIIPKFIDNSVIDLRYEFRTDIKQLLNLCELLSVLSSEIPNGVCV
FT                   FFTSHLFLDVFFKFLVSDKSSKDFYQTILKYKKIFKEKKQDSNSGKELLMSYRDHIVNN
FT                   KEYGAILFAVLNGTLSEGVNFSDELCRCLIIVSLPFPQKTEMLFSKERYFNRGSCDYNR
FT                   YENIYRKVLCMKTVNQCIGRAIRHRNDYSSILLVDHRYNSSEVKQMLPKWIAENIPNEQ
FT                   LIDWNFETNVILKLRNFYKNKP"
FT                   /protein_id="XP_001388395.1"
FT   gene            complement(<797415..>797636)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3520"
FT                   /db_xref="GeneID:3371982"
FT                   /locus_tag="cgd7_3520"
FT   mRNA            complement(<797415..>797636)
FT                   /db_xref="GI:66363097"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3520"
FT                   /db_xref="GeneID:3371982"
FT                   /locus_tag="cgd7_3520"
FT                   /transcript_id="XM_628513.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(797415..>797636)
FT                   /locus_tag="cgd7_3520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363098"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3520"
FT                   /db_xref="GeneID:3371982"
FT                   /translation="KLVPLAKYYLSFNIEMSSKSILGLNKFNNKEIKVKLCGGREVIGI
FT                   LRGFDAVTNLVLDETVEYMFGRLLILFV"
FT                   /protein_id="XP_628515.1"
FT   gene            <797710..>799194
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3530"
FT                   /db_xref="GeneID:3372105"
FT                   /locus_tag="cgd7_3530"
FT   mRNA            <797710..>799194
FT                   /db_xref="GI:66363099"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3530"
FT                   /db_xref="GeneID:3372105"
FT                   /locus_tag="cgd7_3530"
FT                   /transcript_id="XM_628514.1"
FT                   /product="PP2C-like phosphatase"
FT   CDS_pept        797710..799194
FT                   /locus_tag="cgd7_3530"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PP2C-like phosphatase"
FT                   /db_xref="GI:66363100"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3530"
FT                   /db_xref="GeneID:3372105"
FT                   /translation="MDYLNLKPYELFREITKDLLRGENVKFYLESKISQEILCDKNQFM
FT                   EFVNQYYINKKRAQRINKRCDSFKIPLLIDLNGEVVKIGWSLDWDKNLINFNSESAFFL
FT                   NNKYKFIYLYVVYDHFKDENIKMKLTAGRKLQTEKRDPQSINLNCGYYETKGTKSYMED
FT                   RTFLSLDVLNEESTQIKKPIVSFFGIYDGHNGEFTVDYLKSHLHKNFSLAFNQLKYDET
FT                   IQNTINALVDSFYLTENQIKKHYFNSNSEQIMKEFEIMDHKQGLNINLESSFKGQSIKY
FT                   ISSGSTAIVCCITSSTICVANLGDSRAILCKCGRAYSLTKDHRIKSNLEERERVKNEGG
FT                   TFDDEGYLSGNLAVSRAFGNWDMYSGMKLQGLSSTPEIYVHNITREDEFLLIACDGIFE
FT                   SFMDQEAISLIRRALVENNDPNLAAEKLVSAALQRQALDNLSAIVVVLTPPNYMAIGNH
FT                   NFCIDSSAESKKKTNYAHTSNRKIYNFSKLKNLLLT"
FT                   /protein_id="XP_628516.1"
FT   gene            complement(<799376..>800944)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3540"
FT                   /db_xref="GeneID:3371983"
FT                   /locus_tag="cgd7_3540"
FT   mRNA            complement(<799376..>800944)
FT                   /db_xref="GI:66363101"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3540"
FT                   /db_xref="GeneID:3371983"
FT                   /locus_tag="cgd7_3540"
FT                   /transcript_id="XM_628515.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(799376..>800944)
FT                   /locus_tag="cgd7_3540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to gi:23509694"
FT                   /db_xref="GI:66363102"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3540"
FT                   /db_xref="GeneID:3371983"
FT                   /translation="SVNTLGKMDTRNEEYAEFKKLRQNVKQLQDELQKRISAEAELESE
FT                   VKRLHEETIPLSAARALTHVALCKGRALEILSGMTSSNSVNTSNLRWAFRSLYKFAFGD
FT                   IAYAKKIGEDRSAQYHYNETQLRLFRQEQLLLLAENERLSSQIKNLQLELAQNYKATKL
FT                   EKIVNKPSKRRSQTQPRSGSNNEPIRENEADSVSNSELETESDSESETSSCIALNVELV
FT                   TRHLWSLIHCMHSAFQRRKLLAFITWRLTTNRSSHQISDGAPNSSSFTNDQGIHETSGS
FT                   MNINRFFELLQRRYRTMLLARGFWRIWSSCYSPLFKRKTNCGVVRGPGMSSFRPINHGG
FT                   LMHNDSAYKTIGGLEDVAYVTIQGSGASISSSSTSFATQPHYLANLPSFSKITYAPRNT
FT                   YFETKDLPPFPKPREGIKSQQHSLEQNKSIPPYFRPFDKPNNYIHERNCSSDLINNSLH
FT                   PSSTGTSDINAARTELISLLEPRITNNPLGLINEGNISQFQSGPMDNISTKLKYLDILT
FT                   EAIDE"
FT                   /protein_id="XP_628517.1"
FT   gene            <801272..>802720
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3550"
FT                   /db_xref="GeneID:3372106"
FT                   /locus_tag="cgd7_3550"
FT   mRNA            <801272..>802720
FT                   /db_xref="GI:66363103"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3550"
FT                   /db_xref="GeneID:3372106"
FT                   /locus_tag="cgd7_3550"
FT                   /transcript_id="XM_628516.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        801272..802720
FT                   /locus_tag="cgd7_3550"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="with possible plasmodium homolog"
FT                   /db_xref="GI:66363104"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3550"
FT                   /db_xref="GeneID:3372106"
FT                   /translation="MGKRNNKNVVKLRLLSSANGVDGSSPRWAPVSNREFTHDEKQGIR
FT                   KIIGNVYFHDELNDINFELKNLESKTSVQKNKINNDFNTDVFKDNYFPDDGYDYEQHLC
FT                   TIKKDGNYMNSTLKHKTNLDPKSLLFNSTSILSNSEIEIHKGDFLSELVELVNCLEEPD
FT                   DFEELNDDFILDMTGLKNKCELDKNIDMNDILWGGGKLNSSLKDDIQRLNSEFNQSELI
FT                   TQNFDSSSVFSEENYNNENDNDSLENLLNEYNDNIAVLDEDTNESSLIEFNKKLDVSEY
FT                   EHILDRYINQVKIRNSAKSKPEKSYGEIGMPLDKAQVEKIISILESTEIYDNSSEATLS
FT                   DISDFESIEKISESFSQASFEVINKPKKVDILSYYSSLNSKGQTNCPTPTRQNFFFENE
FT                   EYSHNQHNNLRAPIVASLPLRKKDETPEDRRNRKQAVKQAKREMRDLKRKNKQDTKNIK
FT                   KSVVRNLINSNNNDIKSGVRYFRF"
FT                   /protein_id="XP_628518.1"
FT   gene            <802804..>803400
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3560"
FT                   /db_xref="GeneID:3372107"
FT                   /locus_tag="cgd7_3560"
FT   mRNA            <802804..>803400
FT                   /db_xref="GI:66363105"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3560"
FT                   /db_xref="GeneID:3372107"
FT                   /locus_tag="cgd7_3560"
FT                   /transcript_id="XM_628517.1"
FT                   /product="hypothetical protein, signal peptide, possible 3
FT                   transmembrane domains"
FT   CDS_pept        802804..803400
FT                   /locus_tag="cgd7_3560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, signal peptide, possible 3
FT                   transmembrane domains"
FT                   /db_xref="GI:66363106"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3560"
FT                   /db_xref="GeneID:3372107"
FT                   /translation="MKISFRWILLSLIVAMDIYCQSVLIGCQIENNVSNYNNSNYLLGA
FT                   SGNIKDCIPNHPYMRSFFQINIIKNSLDLESFGRSLYVSFESSNEISYFLMVSAGMFAV
FT                   AERILLTFFILRIIIRLFVTPIIKTLSTVLIIIVILRVMFAIYNLSESYRLYETTVILW
FT                   NSLQSLFFLIDNKIYNYGDYLLQYFGMSTNQTLAF"
FT                   /protein_id="XP_628519.1"
FT   gene            complement(<803421..>805295)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3570"
FT                   /db_xref="GeneID:3372108"
FT                   /locus_tag="cgd7_3570"
FT   mRNA            complement(<803421..>805295)
FT                   /db_xref="GI:66363107"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3570"
FT                   /db_xref="GeneID:3372108"
FT                   /locus_tag="cgd7_3570"
FT                   /transcript_id="XM_628518.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(803421..805295)
FT                   /locus_tag="cgd7_3570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363108"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3570"
FT                   /db_xref="GeneID:3372108"
FT                   /translation="MQNFTEVYSCSSVQNPTEWGIPDSSIEEILQVIYIMTKLCKSQLY
FT                   SYSWYCYNHLITTLDQFIENSEGNVQYGHNKGVSFVDTSEKRKNLIKQLNEFDSLSEKV
FT                   QHLRFQDARQSHWDNNKFSKHLHWLGEIVETKIQTRDWIQTNYVGCLSWSERLLNRMEK
FT                   SIMVVPDVNQCVGHAFAFAFLQQVVVEPSVKYEAKLQNLLDKIKNTYTIETKFGQAVGY
FT                   KFQIIKKLSDNKEKLNSLKAIKRLLPTVGKYIIKLTRLQRMGTIWCNSILSISVGNTRK
FT                   FLNGLLPLINNLIISLSNKLYILGQFTKLIDDSVSLTTFGKYVKGKLIHPNFLKVFEDL
FT                   YELLNASWRIVTIASILVPSSKIELSNIVEHKYGTTLEALRRDILNRKSESHAFEWPSN
FT                   LDQETSNYFNGERNSLLISLFDTLDEYWSTCATLHPLLHKLCIITGRIRDILILLDLPT
FT                   ASPVSWKRFIPVNNFSGTNSGISSFTHATRAIVEGTLGYPSNYSIEWDFVNYQQSRLCG
FT                   IDAASSFITGDINKTVEKISIESTESSKNPIIHSNTPLCGVCALPVSTESTVNTHYFDL
FT                   DEFRYTSKSTLVRGRWYHKTCLELLNSESERESHSLFVLPKINIPQII"
FT                   /protein_id="XP_628520.1"
FT   gene            complement(<805825..>807795)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3580"
FT                   /db_xref="GeneID:3371939"
FT                   /locus_tag="cgd7_3580"
FT   mRNA            complement(<805825..>807795)
FT                   /db_xref="GI:66363109"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3580"
FT                   /db_xref="GeneID:3371939"
FT                   /locus_tag="cgd7_3580"
FT                   /transcript_id="XM_628519.1"
FT                   /product="kelch repeats protein"
FT   CDS_pept        complement(805825..>807795)
FT                   /locus_tag="cgd7_3580"
FT                   /gene_family="HOG000182790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kelch repeats protein"
FT                   /db_xref="GI:66363110"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3580"
FT                   /db_xref="GeneID:3371939"
FT                   /translation="LDKMVKKKKSDVKLKKAAEKREKQLCKSQNKHLKELKRDGIDDII
FT                   KTVEGFDLNSGGDDLEIQCSIIQSERPSPRISSSYNIHPISGEVIIFGGEYYDGKEVKC
FT                   FHDLYKWNIDKDEWRQVVIGNVKSSNNYSGGPKPRCSHQAVIFNECLYIHGGEYSTENQ
FT                   FYHFRDLWRLNLKNYSWQEVKTTGLSPTPRSGHRMVVWRHYFVVFGGFHDTIRETRYFN
FT                   DIHVFDTKTLHWVRIDSSKYESCPSPRSGVQMVLCPNSDRIFIYGGYSKIKDNSKNSVG
FT                   KTHSDSWFIDMKPFLNQGLPIWERVSKKGNPPSARSGSTIIGYKNQCIIFGGVFDHDDE
FT                   LGLNLNSTFYNDLYVFEVNNKRWYEIELSKHKIKQEFFGDNQPNANSNFADISTHKKDE
FT                   ARNINNTKDIDSSDKHLRVKGKLSKFGLEQQNSLNSNLPNDELGERKVSNSEIKFENES
FT                   IDLPLPRINCGMFLRGNVIYIYGGLFESGKRNITLDDCWCFNILKKDEWVCVLPLSVKS
FT                   QEWVDSDSDTESNISSEYFSSSNESCYLGEESDFSEQEYELSENEQNELSRKAIEDVIK
FT                   KYQLDDSNKTPFVNESIREFFMRTKAYWLNLIMKEEMGRISDGKDLSRRAFMMARERAD
FT                   QIKTYINLVSKFENSQTKFEN"
FT                   /protein_id="XP_628521.1"
FT   gene            <807892..>809547
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3590"
FT                   /db_xref="GeneID:3372109"
FT                   /locus_tag="cgd7_3590"
FT   mRNA            <807892..>809547
FT                   /db_xref="GI:66363111"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3590"
FT                   /db_xref="GeneID:3372109"
FT                   /locus_tag="cgd7_3590"
FT                   /transcript_id="XM_628520.1"
FT                   /product="Mpp10 family of U3 processosome protein"
FT   CDS_pept        807892..809547
FT                   /locus_tag="cgd7_3590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Mpp10 family of U3 processosome protein"
FT                   /db_xref="GI:66363112"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3590"
FT                   /db_xref="GeneID:3372109"
FT                   /translation="MEEINLFLKFFENGPVNLQEISHESSKMKKIIFSIFKIVITDLDK
FT                   KALIDGLINKFEIDNSSLWNSFELILRPELKKLNFNIENIVKKVEFELYNSNSITYLNK
FT                   TFKKALLFGDKENITKKNSKKFIDQTKSSEQALTNNKSSIQGIENIDFFDYDEMVKFVD
FT                   EGVKNPNFEYSESDISDFSDPSGVDDASNLKYDDFFLDTKSNDESVIENSLKDYEIDGF
FT                   SPSESEIVLNKNKLSENLINITQFPNTKLDHMSKLSLDKNKMDMIIDEFEANIIKEKEW
FT                   YKLGETSITDREKNSLLDIHLEVPQFSSANNSVKYIDGLSNEIISNDKSKVEDINPYLE
FT                   SIVRQRILNDLFDDVKPKIELLKEFDRENKNEGTEIQTEKSKLSLAEIYSKKYEEQIIG
FT                   NINDEHSDEKKQLSELFTEIMRKLDNLSNQYYATNLPILRDSILNENTPALKTEDSIPV
FT                   IISNSTRLAPQEIKPQGRLLKRSEMTRLEKRSDRNSIKRKIKKRKELGSDSKIDAKLSS
FT                   KIKGKSLNKRGKLVIEPHEHESFNKRFKSHHFIS"
FT                   /protein_id="XP_628522.1"
FT   gene            complement(<809587..>811524)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3600"
FT                   /db_xref="GeneID:3372111"
FT                   /locus_tag="cgd7_3600"
FT   mRNA            complement(<809587..>811524)
FT                   /db_xref="GI:66363113"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3600"
FT                   /db_xref="GeneID:3372111"
FT                   /locus_tag="cgd7_3600"
FT                   /transcript_id="XM_628521.1"
FT                   /product="Hs17p, histone methylase"
FT   CDS_pept        complement(809587..811524)
FT                   /locus_tag="cgd7_3600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hs17p, histone methylase"
FT                   /db_xref="GI:66363114"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3600"
FT                   /db_xref="GeneID:3372111"
FT                   /translation="MFTFFLDFYLARENWYRYPSDQLIMPIRISPEIFNIGLNLSENDL
FT                   NNYDNNRFGPALTEVSDSKKLKRALSDFKEIGYDFICVPVNQMVKDKNDTNFFSSKPKF
FT                   LGHYEISGSDWNTGVIGRFPAEGHSNLNEARKLLDWCDFIGYHAVIISIDKLSIHFLSM
FT                   ISSFIGLTSTGVQIWIEIEINENNSIDEQLSEWQITNTIINASPNTKIGLSLKIDSNLS
FT                   RISIEDYSRFFGEPIKCMFINYDFFESKRSGSSISEVLKHSMRAKVPISIYFNDNISSN
FT                   VKSIIKNSYNNIVKFIKSFPPLSSKQKYEYNYIDVLQMPLQPLSNNLKSIEYEVFERDH
FT                   IKYEKYFHAVKLFLSENNIKSEEIKVLIVGSGRGGLIKSAFNAFSYIGINSFKIMCVEK
FT                   NRNAVLTLKAKMNYKDNANWEKVDIINSDIRTVQLDEKYDLIISELIGSFGDNELSPEC
FT                   LIFAQRFLKPSGIMIPQRYTSYLEPISCRKVWNNAVSYLKSKTLEIPFVSRLKSHYKIS
FT                   LEGPKEVFSFHHPTEINEEIMENEIFTTVEFTSRAESTLHGFLGYFKCDLYNEVGFSTL
FT                   PSDLTNNPISWFEFFIPISNPILLKKFDKLTFNIWRKSNKDRVWYEWLVTKPSTSFIHN
FT                   LNGRAYNMHL"
FT                   /protein_id="XP_628523.1"
FT   gene            <812429..>813331
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3610"
FT                   /db_xref="GeneID:3372110"
FT                   /locus_tag="cgd7_3610"
FT   mRNA            <812429..>813331
FT                   /db_xref="GI:66363115"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3610"
FT                   /db_xref="GeneID:3372110"
FT                   /locus_tag="cgd7_3610"
FT                   /transcript_id="XM_628522.1"
FT                   /product="RPR domain protein (involved in RNA metabolism)"
FT   CDS_pept        812429..813331
FT                   /locus_tag="cgd7_3610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RPR domain protein (involved in RNA metabolism)"
FT                   /db_xref="GI:66363116"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3610"
FT                   /db_xref="GeneID:3372110"
FT                   /translation="MPFFTNTGFNTEEFESQLHLFAQKLQTINTQQDVICALSESIICI
FT                   KENTVILQLYMRVVEEYSSRAPPEHLIPLVYILNDFAQKCKSQAHYTSEALFNIFNQIN
FT                   LYHTEYMAKARRCYNIWKIREIFDNDTLRKLDCALLGLTPPVPSALSCGNLKELQALNS
FT                   EPYHRANAVNNLTDSSQRNQTNNDTYNEPNYLELQFNTHNEDDLKLESQYLTLCASVDN
FT                   VLKDAASIREKRKIIQNICSMNRTSKLSSNEKLLKLIEMEWDLRCNICLNLQETLNLLD
FT                   HLHSEVIIRLSNTVTTLQG"
FT                   /protein_id="XP_628524.1"
FT   gene            complement(<813417..>814775)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3620"
FT                   /db_xref="GeneID:3372112"
FT                   /locus_tag="cgd7_3620"
FT   mRNA            complement(<813417..>814775)
FT                   /db_xref="GI:66363117"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3620"
FT                   /db_xref="GeneID:3372112"
FT                   /locus_tag="cgd7_3620"
FT                   /transcript_id="XM_628523.1"
FT                   /product="PP2C phosphatase"
FT   CDS_pept        complement(813417..814775)
FT                   /locus_tag="cgd7_3620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PP2C phosphatase"
FT                   /db_xref="GI:66363118"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3620"
FT                   /db_xref="GeneID:3372112"
FT                   /translation="MKDNNDRTIEAYQGTLKHDKLNANLSNMNGTPLLVHEELNDFNYK
FT                   LDEEHGWYVGDNSVWLYNKDNDVYYSSSLSKLFRLDQEKLRLIEMSTNFELEEVSNKEI
FT                   NIAHVEDECTPFLERGIHAGTSVIPSPTKNLDLCEDRHITKKQFFFNFNNQTPSTFFFS
FT                   ALFDGHAGNNCVEYVHQRLLTNIYTVFSQNMSRFSDKRSLCRAENSVCRVDNTRIFSSY
FT                   IVESLCKGIKKGFEITNNSFLSIARKNKVFDGTTALVCIIFGPDPIDNKLKLVIGNCGD
FT                   SKLILGYKSGNNSISAKRLTRIHRLSDINERTRIEKAGGKVEFCNGAWRVLVKKQQRYS
FT                   FDVSAKCIGLCTSRSIGDINMKEPQLLCISDPEITVHEIDLENDLFLILATDGITDFFT
FT                   DEELVGITEKNLKCTPTEAANELTKEAEKKGSLDDKTATVIYFQWSISELLNN"
FT                   /protein_id="XP_628525.1"
FT   gene            <814886..>816328
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3630"
FT                   /db_xref="GeneID:3372113"
FT                   /locus_tag="cgd7_3630"
FT   mRNA            <814886..>816328
FT                   /db_xref="GI:66363119"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3630"
FT                   /db_xref="GeneID:3372113"
FT                   /locus_tag="cgd7_3630"
FT                   /transcript_id="XM_628524.1"
FT                   /product="TRF4/5 nucletotidyl transferase"
FT   CDS_pept        814886..816328
FT                   /locus_tag="cgd7_3630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TRF4/5 nucletotidyl transferase"
FT                   /db_xref="GI:66363120"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3630"
FT                   /db_xref="GeneID:3372113"
FT                   /translation="MFDTLKIKLDGPDAYLLEEEEKVKRSVVLNNMLRSAIQSRNKPDT
FT                   SKMVETSEFINISSLKRKRNTSNEQFLRSKLNSNGERLESRKYNFFGAGNENDAQGLDK
FT                   IMKLPWEKIPRYLYKSSGVDLFFIHLNNEIVQLVKWLELTNSEHMLRTRALARITLISH
FT                   SLWPGSKVQPFGSYYTGLSLPTGDLDVCILNVPGDPKRRLREFASILKEWRLCTGIELI
FT                   LTAKVPIIKYVDSEACISVDISLNQESSIDTTKHISECLKKFSTLRPLLIVIKLFLRQR
FT                   GLDETYLGGLGSYSQFCLVLSFLQQHSSSYSHTLYKSTTLGHLLFDFLELFGIVFNYSS
FT                   TGIRLKGKGEYFNRRTTKSDSTLFLESPLPPHNDLGRGAFKYNDVRESFRLAFLDLVES
FT                   RGRFNKICSSLEETKFKSPEYYSIISSIICTDYELFQCRARTVDKTQLSISAYRKPPYI
FT                   SNEIIKKVKLEMEKLDINVNAT"
FT                   /protein_id="XP_628526.1"
FT   gene            complement(<818775..>820412)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3640"
FT                   /db_xref="GeneID:3372114"
FT                   /locus_tag="cgd7_3640"
FT   mRNA            complement(<818775..>820412)
FT                   /db_xref="GI:66363121"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3640"
FT                   /db_xref="GeneID:3372114"
FT                   /locus_tag="cgd7_3640"
FT                   /transcript_id="XM_628525.1"
FT                   /product="YjeF family of predicted nucleotide binding
FT                   proteins"
FT   CDS_pept        complement(818775..820412)
FT                   /locus_tag="cgd7_3640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YjeF family of predicted nucleotide binding
FT                   proteins"
FT                   /db_xref="GI:66363122"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3640"
FT                   /db_xref="GeneID:3372114"
FT                   /translation="MNGFLSCFRKEVIAVSNSEDSTKIFTSDETGIKLPKKSGYKFEYS
FT                   WYPPISQGKLIDSVRYTIPQLSSDLRKGNLGRIGIIGGSKEYAGAPYFAGISSLKLGAD
FT                   LCHIFCTPEAAIPIKTYSPELIVHPLFPSYGELSKEEARNRSIDLIRPWLGKMDVIIIG
FT                   CGLGREKDIAFITAELIKICRCLSIPIVVDADGLYVIAQQPELISGYKHCILTPNLIEF
FT                   FRLEKSVNKETNDTKNGNSSNNNNKSNSDIGPGTTLSHIEISDKISRVDLSTDSSINIP
FT                   RVLPLGINEERLPESLSPCERVPRTEWPSTVEDTVLQMHDDGEEINLFYQADSINKQNI
FT                   KVNNARALSSNPLNMCFYEHVLNENCIGVGKTNKRCSQNALSGSQPTVNEEEFLCITNR
FT                   VFELSKSLGNICIVLKDKIDIITNGDVVAVCNIAGSYKRSAGQGDVLSGVISTLFNWSM
FT                   QYFTKNREDKQICQYPEVNSAYGSCLIVRLSAYIAFKKKFRSMLASDLIENIPYVFESI
FT                   FEVDKHDFTEEASLLLLFNEHQSLADDE"
FT                   /protein_id="XP_628527.1"
FT   gene            complement(<820511..>821350)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3650"
FT                   /db_xref="GeneID:3372115"
FT                   /locus_tag="cgd7_3650"
FT   mRNA            complement(<820511..>821350)
FT                   /db_xref="GI:66363123"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3650"
FT                   /db_xref="GeneID:3372115"
FT                   /locus_tag="cgd7_3650"
FT                   /transcript_id="XM_628526.1"
FT                   /product="DP1 DNA binding protein"
FT   CDS_pept        complement(820511..821350)
FT                   /locus_tag="cgd7_3650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DP1 DNA binding protein"
FT                   /db_xref="GI:66363124"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3650"
FT                   /db_xref="GeneID:3372115"
FT                   /translation="MDYSRSLNSYINPVNTGDSLSANNVGSTGYTFEMLTTETDSVHSN
FT                   QYNLDSRNNSLPYMGILGNSSNKGTLKQVAVRICTLLKVWRISTQTDIADNLIMEYLGP
FT                   IDSIRAANDPIYQKNRESSEKSIRRRVYDAINVLISAKIIDKSNKNIIWKGISSINHIL
FT                   CSENSQSCDNLPLIQQNIREKLVEYERLQYLYLSLKTIIENNASTKAMNNGQKTLLPCC
FT                   LVIANSKDSNISCIYRNNKSEVAIQVNSIVDFLDQYEIINRVAACIRMTAVDSDQLV"
FT                   /protein_id="XP_628528.1"
FT   gene            <821536..>822387
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3660"
FT                   /db_xref="GeneID:3371940"
FT                   /locus_tag="cgd7_3660"
FT   mRNA            <821536..>822387
FT                   /db_xref="GI:66363125"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3660"
FT                   /db_xref="GeneID:3371940"
FT                   /locus_tag="cgd7_3660"
FT                   /transcript_id="XM_628527.1"
FT                   /product="proteasome subunit alpha2, protease of the
FT                   acylase family and NTN hydrolase fold"
FT   CDS_pept        <821536..822387
FT                   /locus_tag="cgd7_3660"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome subunit alpha2, protease of the
FT                   acylase family and NTN hydrolase fold"
FT                   /db_xref="GI:66363126"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3660"
FT                   /db_xref="GeneID:3371940"
FT                   /translation="VHRTNCKLSLFIGNNHYGIINEPPFYSPHNKWQEFEYKIPQLDLF
FT                   IAMDADYSFSLTTFSPSGKLVQIEYALNAVNSQGRPALGIKARNGVVIATEKKVASPLV
FT                   EEHSIRKVELITSEIGCCFAGMPADFRVILKKSRKIAQVYYNTYREQIPVCELVREIAT
FT                   VMQEFTQSGGVRPFGISLLVAGFDSTRGPQLFQVDPSGAYFGWKASAIGKDMQNAKSFL
FT                   EKRYNPDVEIEDALHTALLTLKECFEGAMNEDNIEVGIIGEDKNFTILSPQEIKDYLGE
FT                   VE"
FT                   /protein_id="XP_628529.1"
FT   gene            <822605..>824968
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3670"
FT                   /db_xref="GeneID:3372116"
FT                   /locus_tag="cgd7_3670"
FT   mRNA            <822605..>824968
FT                   /db_xref="GI:66363127"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3670"
FT                   /db_xref="GeneID:3372116"
FT                   /locus_tag="cgd7_3670"
FT                   /transcript_id="XM_628528.1"
FT                   /product="heat shock protein 90 (Hsp90), signal peptide
FT                   plus ER retention motif"
FT   CDS_pept        822605..824968
FT                   /locus_tag="cgd7_3670"
FT                   /gene_family="HOG000031988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein 90 (Hsp90), signal peptide
FT                   plus ER retention motif"
FT                   /db_xref="GI:66363128"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3670"
FT                   /db_xref="GeneID:3372116"
FT                   /translation="MSFLLHLLVFFCLIINLCFGSESTGVPSGATFDESQLGDLNNIDL
FT                   SSFGANGGSFADESEAVVDSITPAPLPELSNDDEAAIQKTSESYEFQTEVSRLMDIIIN
FT                   SLYSQKDVFLRELLSNSADALEKARFISVTDDSFLGEQQELEIRVSFNNDKRTITISDT
FT                   GIGMTRHDLVTNLGTVAKSGTANFLESLAKGGDLNLIGQFGVGFYASYLVSDRVTVISK
FT                   NNEDKQYVWESSADGSFRVSLDPRGNTIKRGTTIVLSLKEDATEFMNFSKLKDLVLRYS
FT                   QFINFPIYIYNPEGVNKSEKDESGEKKESKGRWEQVNVEKAIWLRPREEITKEEYNGFY
FT                   KSITHDYSEPLRYLHFSAEGEIEFKSLLFIPSHPPFDMFDTYMGKSGNIKFYVRRVLIT
FT                   DHIEDLLPKYLNFIKGVVDSDDISLNVAREHVQQSRIIKVISKKMVRKVLEMIKQIQTE
FT                   QLNAEKEEANKPDEEKKKDAALTVYDKFYDMFHKNLKLGCYEDDSNRSKIVKLLKFHTS
FT                   KSGDSTVFLSKYIEGMKPEQKSIFYISGESPSALLKNPLVSLYLKHDIEVLFLTEGVDE
FT                   PCISRVPELEGFKFTSIEKSDVRPFEETEEEKNMHKRLSKFYEPLLKFVKDEFPGEFLK
FT                   VEVSKRLVSDPAVITSGPWGQSAYMQKIQKAQTFSNKADYKNKHMEINPNHALIKKLND
FT                   LVISKNNVEAKALALKIIQLSTIASGFDLENPSEFASGMFKIMLQSSGIDEKDVISSVE
FT                   LPEEVSTDEGVEGSDQEKGFDDEEDEKNEKRDEL"
FT                   /protein_id="XP_628530.1"
FT   gene            complement(<825034..>827409)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3680"
FT                   /db_xref="GeneID:3372117"
FT                   /locus_tag="cgd7_3680"
FT   mRNA            complement(<825034..>827409)
FT                   /db_xref="GI:66363129"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3680"
FT                   /db_xref="GeneID:3372117"
FT                   /locus_tag="cgd7_3680"
FT                   /transcript_id="XM_628529.1"
FT                   /product="TPR repeat protein"
FT   CDS_pept        complement(825034..827409)
FT                   /locus_tag="cgd7_3680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat protein"
FT                   /db_xref="GI:66363130"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3680"
FT                   /db_xref="GeneID:3372117"
FT                   /translation="MEDELLSILTYLDRWQLYDNIRFWAEVIDKLLESKEARIQISRFL
FT                   VKDLNLQEAFNYLRVECDKTKLQLSSNEDSINKEVNLYGDYLTIKCCYLMGRIDEAERM
FT                   ILKICSKPLTELADSCLISPSVSPKSWKGTPVTNEKKKSLSSIFSTICMNPTMLIKYIH
FT                   TGELKIPGDSAGLYLWGNILEELDAKVSALYCYAIALDWNPVLWKSFQKLVGLSCQYPH
FT                   ELVKICCCLNNWGEKHLEYVGTNSDALVISTVYKNEAECWQVKNIQDGNLLISISDKSD
FT                   SEELYVLNVSDFFYNVGDTLQKRHMLRYHSFTNWLENPVKDGNSGPKWPYSEFEDVKNA
FT                   NNKFSSSNISEINYNSVAYTENIDANIKPLDSRFHPLISMIQLLSKFTHQMEWYLCHSF
FT                   LKNIESIPNKISEMGYVRELHVRALFESNQWQECINVCKCINYETNYNLWIKCLDIYSS
FT                   CLWQLSRSIDLINLSNLTLKIIEKNTPQLWIVVGNCFSLHKEYESSIKCFKRAIQYDNR
FT                   YVYAYTLIGHELSIIEKYDEAIQMYQKALKIDPRCHRAHWGIGYVWFKREEYYQAKSHF
FT                   NLALKVVPNNSTLIHYLGLCYLTTHDFLSAYNTFQKGILKDQRNPWLKYHAGIVLLELE
FT                   RYEEALTMLTAAHRLASNEPNIHLYLGKTFSHLGRKDKALRHLNIAFDLTKDINEKQII
FT                   LNLMKELENGSNIEGRYCKSNETNRSGRISNSGAGYSSGSKLLSSFRNHHYFPIRNDPP
FT                   NPFIHHQIQQEHNIPQTVPSPAVSGGHSLLLTLMPGNN"
FT                   /protein_id="XP_628531.1"
FT   gene            <827620..>829830
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3690"
FT                   /db_xref="GeneID:3372118"
FT                   /locus_tag="cgd7_3690"
FT   mRNA            <827620..>829830
FT                   /db_xref="GI:66363131"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3690"
FT                   /db_xref="GeneID:3372118"
FT                   /locus_tag="cgd7_3690"
FT                   /transcript_id="XM_628530.1"
FT                   /product="crooked neck protein HAT repeats"
FT   CDS_pept        827620..829830
FT                   /locus_tag="cgd7_3690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="crooked neck protein HAT repeats"
FT                   /db_xref="GI:66363132"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3690"
FT                   /db_xref="GeneID:3372118"
FT                   /translation="MKEIDQNVKNYVSTYHKTSGISRIANEQESNVKNKSFAPIQITVE
FT                   QILKESYSGSANSVGGNNSLSRLHESFDFRGIDELEDYRIRKRKEFEDSIRRKRWKISL
FT                   YLSYAKWESLQNNIKNSRSIFERGILVNYENVRIWREYIKLEITNGNINNARNLFERVT
FT                   HLLPRIDEFWIKYIQMELILKNYINVRHIYRKWIDWKPDPSIYIQYSKFEEECGEIKSA
FT                   RGVMKDLIISYPDESNFIEYIKFEQRHKNLFSSEQIINILSETLIDINGSKITNLFFSS
FT                   ISDIFVEEKKIEEAIKLCNEGIKILTNEHCVKNLKDKLFQLFKMRIYEKPDENIEWIKH
FT                   KLQNYRDKLLHNPQDFDILFDYIIFITQYLELDSVLQEYENLIFNHNISDVVSWEKYLH
FT                   SYLLLIYFFEINQDVNSPNIYKLYNSFIQSIKNNQISEINIAELETKQSESKITNVEKN
FT                   NIFAKVFIYFSNHQLRIGDLNKARKILGIGLGRVPCINLFDHYIDIEFKLGNFDRCRVL
FT                   FTKYIEYDPVSTNSWIKYMQFEYNLCEIKRVISIAESAISMPELDSPEIIWQYYIELMI
FT                   NEKNIEFADIIYKRLLEKTQHIQVVINYSTFIISKLHDNKLNREFILGILNKYKERQFD
FT                   YQRSILLKYWLSLEEKLASKNIDPESNIWIEIVNRLLPRTILDVNSKNKTYVFKEENYD
FT                   FAHLISTNKDNEAQTLQTNNNDKVPTSLIDAAKEWKKAKILD"
FT                   /protein_id="XP_628532.1"
FT   gene            <830042..>830497
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3700"
FT                   /db_xref="GeneID:3372119"
FT                   /locus_tag="cgd7_3700"
FT   mRNA            <830042..>830497
FT                   /db_xref="GI:66363133"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3700"
FT                   /db_xref="GeneID:3372119"
FT                   /locus_tag="cgd7_3700"
FT                   /transcript_id="XM_628531.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        830042..830497
FT                   /locus_tag="cgd7_3700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363134"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3700"
FT                   /db_xref="GeneID:3372119"
FT                   /translation="MVNVNELNLLSVDFNAELAINNLESVFLPKHTQSLDNISKAALLL
FT                   PFAIQKELKLFNSCSTSSENNDDENLDKNINKAERQLNVIRNIEFKLNLKKKFSDKKKI
FT                   FNSVSNKITDKFSIQPNKYFFQTEEKEKSDVYDYFTRKEVSISCYFH"
FT                   /protein_id="XP_628533.1"
FT   gene            complement(<830625..>832631)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3710"
FT                   /db_xref="GeneID:3372120"
FT                   /locus_tag="cgd7_3710"
FT   mRNA            complement(<830625..>832631)
FT                   /db_xref="GI:66363135"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3710"
FT                   /db_xref="GeneID:3372120"
FT                   /locus_tag="cgd7_3710"
FT                   /transcript_id="XM_628532.1"
FT                   /product="LRR protein"
FT   CDS_pept        complement(830625..832631)
FT                   /locus_tag="cgd7_3710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LRR protein"
FT                   /db_xref="GI:66363136"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3710"
FT                   /db_xref="GeneID:3372120"
FT                   /translation="MTQQIEHYGIISGNIPPGIDIQNLPFKKGKLVTSDIRECSDDYIC
FT                   KLYLLLKNVGIKITESFLYGISGPNRKTLKVPFCNGVKASSFNYFFFNSPNLEIVDLSN
FT                   CYQVNNRVIKCIISNCKKLRELNICGCKLVTDSAFNTEFFSPTGSCMTNLKVLNIQGCS
FT                   QIIDLQSIIKRTRDLESLNISFCRNITISTFEDVIQCCINLKELDISSCDGINDYNYKF
FT                   NYSASTNIEKISLSRSKLSSSTLKKIISSMENLKYLNLNYNVNVNDEVFDKISSKLMKL
FT                   NTLYLRSCANISDKSFFYLGESLKELEHLDISWCPMLTSKTLKYLALRYSRNNVKKLKT
FT                   LKLSQNTNLGNFFESDDYFTDMINDYRKKIPRLYLDNQCESSNNEIDHTQTLNSTKYEQ
FT                   NNISESQKNTFQDKILEECIVKLIQHANVKTKLVGGGLTPLSMCLLIKYNCETLVDLEL
FT                   EGLRNVTTSDVLEHIGVLCRNLKNLSISIFENDDLCIESFNKICRKCTNLSSLSLDISN
FT                   VESRYHHSSIVDCISNGDSLLKLNELSIVINPKLGISDENLDSLSSCKFQLSKLRIKNF
FT                   QGFSNDYFKKNNSKFIQLFSSVIEISLSGNDYANDDDVILLLKLVKVPSSVELINFNNI
FT                   SMDLPKYIWENFQSIKKLNVFNNKTKVLLERFN"
FT                   /protein_id="XP_628534.1"
FT   gene            complement(<832970..>836503)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3720"
FT                   /db_xref="GeneID:3372122"
FT                   /locus_tag="cgd7_3720"
FT   mRNA            complement(<832970..>836503)
FT                   /db_xref="GI:66363137"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3720"
FT                   /db_xref="GeneID:3372122"
FT                   /locus_tag="cgd7_3720"
FT                   /transcript_id="XM_628533.1"
FT                   /product="RNA polymerase beta subunit"
FT   CDS_pept        complement(832970..836503)
FT                   /locus_tag="cgd7_3720"
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase beta subunit"
FT                   /db_xref="GI:66363138"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3720"
FT                   /db_xref="GeneID:3372122"
FT                   /translation="MQNILKMVSEQKNDEIQQEDSWALIGTYFRDRGLVNQQLESFNDF
FT                   IMYKLQEIVDEHPPIIITPQSQYRPDEQIDTKVRYVLKFGQLSLSRPSVEEREGVARGL
FT                   WPNEARLRNLTYSSPVFVDAEQKVYKLEDDGSETLVYETVYSRLPLAKIPIMLRSEYCW
FT                   THNISERELQSAGECVYDQGGYFIINGMEKVLVGQERMANNFVYLFQKNQPSKYTWIAE
FT                   IRSNREGMQATSGFSVKLRGSDGNQGQIVATLPYIRTDIPIAILFRALGVLSDKDILSR
FT                   CVYDFNDTQMLALLRPSLEETFEFFSQDVCLDFIGKRGPTVGAAREKRIQYAKELFEKE
FT                   LLPHVGVTSGSESRKAYFIGYMVHKLCLGALGRVPEDDRDHFGKKRLDLAGPLVAASFG
FT                   QCFRKMMKDVRRLLQRNIDNGKEFDVAGVIRSASYITQTIQYQFATGNWGKDKDGKIIR
FT                   TGVSQVLSRLTFTSALSYLRRLNTPLGREGKFAKPRQLHNTHWGMICPAETPEGHSVGL
FT                   VKNLALMCEISVGYRPYAIRTFLDEWGMDSIDEIPPEGIKRKIKVFLNGNWVGCFDDSE
FT                   DSISNLRMIRRSGEIPYETSIVLDVVNREVKLFTDSGRSMRPLYIVGEDGDLKIKKSHI
FT                   NSLLNENPSFDEKMEDEKHDYTWDDLVNTGIIEYIDCEEEETSMIAMFINDLRIDRGYC
FT                   STYTHCEIHPSLILGVCASIIPFPDHNQSPRNVYQSAMGKQAMGVYTSNYNVRMDTLGY
FT                   VLYYPQKPLVTTRAMTYMRFRELPAGINCIVGIMCYSGYNQEDSLIMNQSSIDRGLFRS
FT                   VFFRTYVSEEKQVGSNLIEAFELPNPEEVSGLRFGNYGNLDLDGLIEPGNRVLGDDIII
FT                   GKVGPINPEDRDTRIQKLTKRDCSVGIRTSEHGVVDEVLLSTNSKGVKFAKVKVRTIRI
FT                   PHVGDKFASRHGQKGTIGITYRTEDMPFTQDGIIPDIIMNPHAIPSRMTIGHLIECLLG
FT                   KACAIQGLEGDATPFTKITVEEISSRLHSSGFQKNGNEVMYNGHTGKRLESRIFIGPTY
FT                   YQRLKHMVDDKIHARARGAVTMLTRQPREGRAREGGLRFGEMERDCMISHGAAKMLKER
FT                   LFDQCDAYRVHVCEMCGLICIADLGKQHFECNACNNKSRISQICLPYACKLLLQELMAM
FT                   SIYPRLHLQTA"
FT                   /protein_id="XP_628535.1"
FT   gene            <836947..>838347
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3730"
FT                   /db_xref="GeneID:3372121"
FT                   /locus_tag="cgd7_3730"
FT   mRNA            <836947..>838347
FT                   /db_xref="GI:66363139"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3730"
FT                   /db_xref="GeneID:3372121"
FT                   /locus_tag="cgd7_3730"
FT                   /transcript_id="XM_628534.1"
FT                   /product="long chain fatty acyl diphosphate synthase"
FT   CDS_pept        836947..838347
FT                   /locus_tag="cgd7_3730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="long chain fatty acyl diphosphate synthase"
FT                   /db_xref="GI:66363140"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3730"
FT                   /db_xref="GeneID:3372121"
FT                   /translation="MYKYIKNNELKKSLNLFKRSITITKNQLVKEFLVDLDDSCIRSEI
FT                   FYPIRNLYHPPIDFINKNNPSDALFLKKKKINNWNELNNQEWSKILQNSTKCFRDNIAN
FT                   YIVNDDQNEFMLNENNAQRDLLQSQLLEFIPNEMKDIVKYVFQSEGKLTRQNYLSALVG
FT                   LLKFAIGVNHSQPIGLDHRMLIHSIQLIHSASLLHDDILDNSEIRRGKKAPYKIFGNKK
FT                   TILLGDYLFSKSCLNISIIENINAMKCISIIAENLVKGEFSQLNGLGSLIEGLNNSKDK
FT                   KGLVGNYFEKYLLKSYYKTASLFSFGGIACSELLKKAYGNKLRMEMIIYSYYMGLNFGL
FT                   AFQLMDDILDFTNSISQVNSGKPFFNDIKQGILTIPIYFLLLRDQERATKILVNTNFYN
FT                   SDKAEILKDLVNILFDTNSIQASIVCVAQYLERYIHFINLISKSERNVFSSFLVKMADK
FT                   LLKIIDDI"
FT                   /protein_id="XP_628536.1"
FT   gene            complement(<838351..>839034)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3740"
FT                   /db_xref="GeneID:3372123"
FT                   /locus_tag="cgd7_3740"
FT   mRNA            complement(<838351..>839034)
FT                   /db_xref="GI:66363141"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3740"
FT                   /db_xref="GeneID:3372123"
FT                   /locus_tag="cgd7_3740"
FT                   /transcript_id="XM_628535.1"
FT                   /product="apicomplexan P36 family of proteins, appears to
FT                   be a divergent HAD family phosphatase"
FT   CDS_pept        complement(838351..839034)
FT                   /locus_tag="cgd7_3740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="apicomplexan P36 family of proteins, appears to
FT                   be a divergent HAD family phosphatase"
FT                   /db_xref="GI:66363142"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3740"
FT                   /db_xref="GeneID:3372123"
FT                   /translation="MLTSHQKKFHDWFLSFKDSNNYDSKQNHSIKDIFNRFNHYIYNDL
FT                   GIRTIASDFDLTMMTKHSGGYIDPLDNDGIIFSKSLSKEFNVFGMQAENVNISISVVTF
FT                   SDPLLIPSNQRERFISGRRMIEHCLKESGAKFKVKNYYCFYPKIWQSQDLYSSIGLDAP
FT                   MPLFKKYHLLQVASADKLLPNQILFIDDDIRNCKQALQDGFIVLHVEGNAGFSLKSVSV
FT                   GFYYN"
FT                   /protein_id="XP_628537.1"
FT   gene            <839162..>841546
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3750"
FT                   /db_xref="GeneID:3372124"
FT                   /locus_tag="cgd7_3750"
FT   mRNA            <839162..>841546
FT                   /db_xref="GI:66363143"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3750"
FT                   /db_xref="GeneID:3372124"
FT                   /locus_tag="cgd7_3750"
FT                   /transcript_id="XM_628536.1"
FT                   /product="oligomeric golgi complex protein 4"
FT   CDS_pept        839162..841546
FT                   /locus_tag="cgd7_3750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oligomeric golgi complex protein 4"
FT                   /db_xref="GI:66363144"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3750"
FT                   /db_xref="GeneID:3372124"
FT                   /translation="MSSFISYEESGIDASILLNSNNFSSVKYGFNTSKLEIQNSLISCK
FT                   KELLSMKNEVLINLSNRLKCFSTKVENLPSIIKEKKATKLKLKNAIHIVNNIISLRKCD
FT                   QDFISSMSRKDYELCATCISEYLKIKSSCINFEKKICENLDHGRQELYLQLQESIEEKL
FT                   CAGELDKAIYYVKLFVPMGMPEEGLERYVKYIRGNITDICVSMYNEALANSKKTSEKVN
FT                   YADIFTGLFVSIIDCIKEHQNKILDLFVTIGDDENLDEKVCSQALDKNYVIWYFYTELL
FT                   REVNTQGSIIIDKFEKEYEIYLDDKWSNIENVDIIEMHISHRELDGFLEEMSQICHLFY
FT                   KFKVYMNDLVNSFTSINSQTKNIKRPEIKVENEQIPKENNLFIRIDEMSIQYVSCEYGY
FT                   VMYSINHALNTTDEVSWEDQDSLISTLVEDVFFLLHKTINRCISIGNIKSLKLIIVHLN
FT                   HILLNVIKQKIVQNLQNSRANYEVSLGNSNESISNFTLIHLLEIIKQKNENCRNLSNSM
FT                   YSWTHSLNNLQACIENLEILSGAITRDFESSYSDLIYFDICINGIILLDDEFNESNELL
FT                   EDKNATIEYINKTIEQIISEFKVIHDHYSKISLQILSKIGISPILIQLHEEISFDFTED
FT                   ESKDYSLNQSFIPSLTSSLKVINEHLKNYYNNQSSEFILSLMIERIVQKIEHIVINYPE
FT                   KKRFTIYGALVFENDVRNLLSYTNSLLSISIRHKFLRLLEICDILNITSLDELSDLLLT
FT                   DFPSRNWHLAKSDILKTLFLKQDIDHDKLKEIIKKSSHFFN"
FT                   /protein_id="XP_628538.1"
FT   gene            <841953..>842864
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3760"
FT                   /db_xref="GeneID:3371838"
FT                   /locus_tag="cgd7_3760"
FT   mRNA            join(<841953..842381,842435..842550,842597..842679,
FT                   842725..>842864)
FT                   /db_xref="GI:126654111"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3760"
FT                   /db_xref="GeneID:3371838"
FT                   /locus_tag="cgd7_3760"
FT                   /transcript_id="XM_001388359.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(<841953..842381,842435..842550,842597..842679,
FT                   842725..842864)
FT                   /locus_tag="cgd7_3760"
FT                   /gene_family="HOG000233029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:126654112"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3760"
FT                   /db_xref="GeneID:3371838"
FT                   /translation="VGSGSYGKAILVKDIYKGRDYVMKIINISKLSSNERKDAINEVKL
FT                   LSSIRHPYIVCFRESFVEDGFLNIVMEYADGGDLFRKVNAQKQLKKNFLENQVVRWLTQ
FT                   ALLGLAHLHNKRILHRDIKSQNIFISYNGLKIGDFGIAKVLENTGAFAKTTIGTPYYLS
FT                   PEICLSKPYSWSSDIWALGCVAYEMCSLKVPFDAPNLKTLVEKITNGIFLPISNSYSEG
FT                   LRRVIMDMLIIDSSQRPTVMELLKYPIIEVRNN"
FT                   /protein_id="XP_001388396.1"
FT   gene            <843577..>843915
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3770"
FT                   /db_xref="GeneID:3372125"
FT                   /locus_tag="cgd7_3770"
FT   mRNA            <843577..>843915
FT                   /db_xref="GI:66363145"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3770"
FT                   /db_xref="GeneID:3372125"
FT                   /locus_tag="cgd7_3770"
FT                   /transcript_id="XM_628537.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        843577..843915
FT                   /locus_tag="cgd7_3770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363146"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3770"
FT                   /db_xref="GeneID:3372125"
FT                   /translation="MDTISNINTENDSSQQANISHSNVEESTQSLKFVMQDVQEHFKRA
FT                   SQTILSRIDEMGSRIDQLEFMLNDLISEVESSSPMKQKTAHNQNDLNHSKAEVNDLIPI
FT                   ESTEQVNK"
FT                   /protein_id="XP_628539.1"
FT   gene            <844545..>846335
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3780"
FT                   /db_xref="GeneID:3372126"
FT                   /locus_tag="cgd7_3780"
FT   mRNA            <844545..>846335
FT                   /db_xref="GI:66363147"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3780"
FT                   /db_xref="GeneID:3372126"
FT                   /locus_tag="cgd7_3780"
FT                   /transcript_id="XM_628538.1"
FT                   /product="cyclin"
FT   CDS_pept        844545..846335
FT                   /locus_tag="cgd7_3780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclin"
FT                   /note="transcripts identified by EST"
FT                   /db_xref="GI:66363148"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3780"
FT                   /db_xref="GeneID:3372126"
FT                   /translation="MIDEYAYNFLFPFSSVGSSGTAVSGRTNDRFDDIDSSYHSLANLR
FT                   KSEICTYKSILRNNSNLTDCDYFRPSVSQPINSQKSMHDIQTIKDSSIYHSITDEVDRD
FT                   IKPTNTEPGFIVALSSFLTQIATSNSSNSSCNVGVLTPFHSVCIPPIPIRAYLIRLAQN
FT                   FGCSNECFVLAIIYVGRIIKFNKNFTITLLNVHRIIVTALILATKFFDDIYYSNAFYAK
FT                   ISGVGTRELNSLEIHFLRLVRFQLFVTEHEYEIYKRCILNSAFLHSTIPSLPVSIFDKQ
FT                   VSDEFRGNHRIKDISFIGERKRLSLQNSFPYNYNYPGVYNSLLNGEKFESRDIQSMLIG
FT                   DYSLSSQARSTGNLYTQKLNSFNSNADIPSNCDFCSNQTSEIINSELTPSSQCAQNYGL
FT                   LSEKWVSQQLTFSNSGCVHNQIQDELCADQFRGLVKDERLSRKVDKTSFSSGSNVRNDY
FT                   LSINLKHSSAFNNGYARTQIDNSERAYNANLNSSNYLRAEIQSSDLTQRRIEGSEIQIP
FT                   NMHPEYKGIVNLNYSSYSNDSGYYNSVNASDINVLSTTGVITSSTVTLVNPTVNRYGQH
FT                   IFMNPYNVRCTTGIDRRLLV"
FT                   /protein_id="XP_628540.1"
FT   gene            complement(<846632..>849082)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3790"
FT                   /db_xref="GeneID:3372127"
FT                   /locus_tag="cgd7_3790"
FT   mRNA            complement(<846632..>849082)
FT                   /db_xref="GI:66363149"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3790"
FT                   /db_xref="GeneID:3372127"
FT                   /locus_tag="cgd7_3790"
FT                   /transcript_id="XM_628539.1"
FT                   /product="unconventional myosin"
FT   CDS_pept        complement(846632..849082)
FT                   /locus_tag="cgd7_3790"
FT                   /gene_family="HOG000283325" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="unconventional myosin"
FT                   /db_xref="GI:66363150"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3790"
FT                   /db_xref="GeneID:3372127"
FT                   /translation="MSAKDVKGLTRKVSGKFVFDAKTAKGSTVWCDSAPSVLNDPDSLF
FT                   AKCIVQAGSTAEKLCLKEVDSNATFEAKIDSCFIANEPFDPNTYPDIGLVPYTSIPCVL
FT                   DFLKQRYLVNQIYTTADPLLVAINPFKDVGLVGNDVILNYRDANDVSKLPPHVFAIAKR
FT                   AFDNIMSVSRCQSILVCGESGAGKTEATKHVMKFFASSKSGTMDLKIQNAIMAANPVLE
FT                   AFGNAKTTRNNNSSRFGRFMQLQLGKMGGIEYGVVRNFLLEKSRVITQESLERSYHIFY
FT                   QLIKGAETIPGLKEKLKLKSLNEYKFINPECLDVETIDDVQDFKDVMQSFKTMGLSDSQ
FT                   IEDILSLVSGILLLGNVEIEPEDVGGGVEGSRIADSSRESFNNAMELCKLDKEIVEKEL
FT                   IVKISYAGKNVIEGRFRPDETRMLKDSLAKGLYDKLFDYIILNLNENIKPPSGFKVFCG
FT                   MLDIFGFEVFKNNSLEQFFINVTNEYLQKNFTDIVFEKEQNLYSSEGISAANLEFKSNK
FT                   MVLEALCDKKNSILSAMEDQCLVPNGSDEKFLSAAYTNLKSNPCLKPAKIGGDVNFIVS
FT                   HTIGDIQYCASGFLFKNKDVLRAELVEVVQKSSNKLVADLFKDVFVERGKMAKGQLIGS
FT                   QFMNSLGSLMSIVNETEPHFIRCVKPNESKKPLDWLASKVLIQLHSLSILEALQLRNLG
FT                   FSYRRTFSEFIYQFKYCDMSAANDKKTDPKILAEKMLSGTNIPKNSWAIGKTMVFLSKD
FT                   AAKRMAQLQREKLAAFEPLVQLLEAVYLRYKLRREFRKNQLKPLVRIQAQLRRVLDIEI
FT                   SVMN"
FT                   /protein_id="XP_628541.1"
FT   gene            complement(<849399..>858104)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3800"
FT                   /db_xref="GeneID:3372129"
FT                   /locus_tag="cgd7_3800"
FT   mRNA            complement(<849399..>858104)
FT                   /db_xref="GI:66363151"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3800"
FT                   /db_xref="GeneID:3372129"
FT                   /locus_tag="cgd7_3800"
FT                   /transcript_id="XM_628540.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(849399..858104)
FT                   /locus_tag="cgd7_3800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363152"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3800"
FT                   /db_xref="GeneID:3372129"
FT                   /translation="MNSTDQMIKFKHIYLCLIFIATFIGYIFCSEYQNNDIISFNKARL
FT                   IFSKDAVNYRTIKDPETWKLADREIDSLKRANKLPVIYQNSGGRDLFVSVEIIQACERL
FT                   LNRIELDPFTPQVIDSDVSILNSGFKASFQDLGDRVAREIQYCFLQYGPEVLEIPALEN
FT                   YVERLKSWGIKSVFTDEAAKKSLEHVKQTVMTEGKKLNDKYTQTSLVTADSGNKEKYLI
FT                   ATRPKPEKRKLVTIDRSNTTKKIVKPQKIELEDKKQKRIIARPKKDIREIDRGNIKSSY
FT                   GTLANQALASTKKAGVDLIKLINQEDISEKLRVLGPEARLLLAWQSVVEAQSEFNEESD
FT                   YLVKGLPNVIDSSVLYQSGPNFSLLNFKAECVKFIMFRNSQISKGFLDGDLTQFFLKDG
FT                   EILITSSHIIRTAAEQLCLIAHESYLPEIMKNSEAYLERIHTIQSQSILGVDDNEMEET
FT                   TINPPSKSQAPKSRLFELYKKIITKRGAAPYLNEKDQIWDLISECNSGECINEIVYRDL
FT                   SYWLIPSEYLLYLIFRISSESYSDSLIVLDYTVPINSKVGNVIDPSGGNVVKICKTYVQ
FT                   GLASAGKADLVVGGTHSDLDKLLQELCRDVELEVSKNESILSNKRLLIGILYELELAFC
FT                   GVIGVSPKGRSTEGYNSRSELELLASAPVDLARDVWALEECGVIAQSQLNYLLCFGSFS
FT                   QGFISHIFPNSVESVIPITLLCKTFLSLEKEKKDPYNPSDFGTHLSNMLFKENLHELFP
FT                   FSSDNSNKAKKVTSSFFIELSNQFRMNLEKNMYINPKNTIDSIESIYSIRVCSAPLFAF
FT                   LPFDITISPINKKLINALTPFGCRANINTILIPGNKQTCVGLQQNIINYLHVLAAIIES
FT                   FTNHFIDLKKLGTKDVEIPVSSLCLWWKHPVNYPLSVVLADKLPFIKNSNISEYVLRYS
FT                   LMMESMNFPGPVKAEKRIEYIYSNPQIFSNRARDLPKNIIYPDFNPPSNVFEALEFYLK
FT                   KDAILGYRELQRELDDKPIEQSTFELISKKCPNLESWQVNFVIAFQNSVKTTMKMVLSK
FT                   LNEPSQFKIEIDILCSWVINNFPKDSIPGTTVDVDEAGESLEKEAKGTIPWLQPLIGSY
FT                   LLSTFNIWSQTEYILKLGGISKTKILDKNKIKLDEIKYLFEKKYTPVVTSNQDLKIIGL
FT                   DSLNPITRLKLNPFVDDTLSLPNPPLESECDSIWVANLMNAFRIYFMEFQRKLIDPIFH
FT                   GSFDPIIMCEIVKEIVKKKVFQSQFGDVFYRVFKDKEWIKNKQLVRVLVKNAGDWISQT
FT                   FELPEYPTHDTTQYGENLIECYRLSYSMENRPISSSLRLNIDEIEKELLPKLEISSFPS
FT                   LSLKSIIPFLQSLDPNTYYRNVETCKDLSESEIRMLVSLSSYLETISKSVFNSQVPEGS
FT                   TKKGLLEELKFEFPLDGLCSWWLNVKKINASPNYSSNTVCWASLLSKHVINSHLERVKS
FT                   DPEMNMQWKPWFTAPVAEALLFGFFNSINKNTKSGYKEINMNIVQEGFINQNQIRNMEV
FT                   LESIFSTNDNYRFATPFHRSTNDLNSMPITYFNYLHLPSEHYEEIVGFLQEGFKRPIGH
FT                   SDVMTGRNLHQIEINMSTFIAYSISKSSRLSKRNNWKITANNVMEAFHKYKSSDLSLRS
FT                   WLEHLQLSIPNASPSIQSVFMLFTNYLKEEAKLVKANLSNKDLRDESWNQIDSFYSLPL
FT                   HENMKYSRTPPFGYFPIFEMDTNLNFSNIQIPYLNKNKPAPQMKFSRFRGRYWRSKMCI
FT                   RQKETFLDDIPETIPSIWPSIGTVVELEKGIDEEGAELNKKEEKAPKVNILITSELEVK
FT                   SRFNCDGLFVWQVNRAVYWAGMLQRYINKGPRLLKDRKELLKKISKIWSINIKSRKLPK
FT                   VINTDHGNRSFNIFDMFFFYKVLNFYYNDLNGADYNQQIFGSWEDDLEKLPFFTINIFS
FT                   QLFIEHYRNLDFKHIVLFFYEMLLEEERIINLKTKSDGIFLTTKERLKAIYHAPLFPEP
FT                   REYIYPGIFFELEPPFPCSWERVKMIDSTIVPVISVNSVSLVSFNNTIYLSGYPRSDVQ
FT                   LRDTNKIKKIFLEMTKNNVLLELFGIKYFESLSPKIANIMSKKSSLSGFDFLNQFRDNE
FT                   NSGISSKSIYWDQISNTFTNGLDWFILHSTLGLESTFISPINIVETIIQVLKRELISIS
FT                   KYVEYFQDPSLLPSIFASHSSIHIFERGDTEMDKKLSNLCAEYLTRISPLSILIMELSS
FT                   FYGDSTEKDRSERICSEVANIWEPNLPFIFGEIRKIFLMEFIRRIKQDDARSGNKLIWP
FT                   NTSASLVTADWQLISKTSSYNQLIKSNSFVGFYNYHYFWDPALLLNAFYSQAEILSIYF
FT                   EKEFTEYIIIEMSQTPLIELGSWISTIHSPLYSRKKLITYDMINRLLISQISSKKATDL
FT                   KKLNNIKIDEDEITTLYKYCFNWVSQMLIYSKEEIITFCNDLEKKYGRTVIYIYSVSHQ
FT                   FELIFNTMQFLVEKHPLSDYSNHINMQKSIHNNIKDQFIETLFSFGVPSATEVRALNGS
FT                   IDTLIYIDPEMANYSFLKLAPVEMHKDLQSKNLLIYSDLIFFNTYVIRRAFQEAMSFLQ
FT                   LESMADIKLDFNKNTSLSDLESMCKVWTNSHSNEIIVLNPDDSQVFEYSVPVMEYPTDV
FT                   DGTVTIDINDQIKEDIIKVICQTFIDLISPNHFLFSIKDKKKIHSKLLEKISANSKTAS
FT                   KDKIIGWYTISNIVNMWAKDYSLSVGPHIFHQLITKLSVKNLNKLKKYSFSDFCQETEI
FT                   NQIRFFFNPESFIKMMIDSAYEIGYLLIVNAIPDGDLVDSGKLRIKMSEILSNCIDLMS
FT                   SLISGKNISLLKIENKLSEKSQSIDMKKVSESVCEHMVTNNRKLFRNFVESKSSRKNAV
FT                   KDLYYRIQNINKEDGSTSFAFIYE"
FT                   /protein_id="XP_628542.1"
FT   gene            <858475..>863622
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3810"
FT                   /db_xref="GeneID:3372128"
FT                   /locus_tag="cgd7_3810"
FT   mRNA            <858475..>863622
FT                   /db_xref="GI:66363153"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3810"
FT                   /db_xref="GeneID:3372128"
FT                   /locus_tag="cgd7_3810"
FT                   /transcript_id="XM_628541.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        858475..863622
FT                   /locus_tag="cgd7_3810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363154"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3810"
FT                   /db_xref="GeneID:3372128"
FT                   /translation="MVYIKKEREKRSLNRCLLLIILLIILEILCANGEGRISFEEYPSG
FT                   LDKNKQDEHLVNELIDTTSDLKFKQILIEKTCGEKGTNYTKDGLKFIKKNLEEFSSNEY
FT                   YRLKSLKKLPKIYSGKNEKLMLRSFRGGEILGSPLRLRSRVLKDEFSIPVIEDDFAIFS
FT                   DELDSSINIIYPRVMNEIRYTVLLCGGGLVTMLPIVRYMKLLNSYGEYMSNDRIILQGI
FT                   GIYEREKAESRRRSANIEAKYLSTLPYSDEIYTGQSIKRGGIIVGISDSIKEEQDLMKS
FT                   ILSKQNLDDGYQGAVLGLNIRAKEELFEKNRENAMSDAQGHFVYSSVFDFDSPNALFTM
FT                   FNENLSHFENNNLEFMASNSRNKIPHQITRAESIKNTTINRIKSNLMGLDNNSNEYSSE
FT                   GSIETGAIEFDKKKGEAVLPYDDPLNPESIIIGKRIRPNDQISTGSTEYQARLIPESKL
FT                   AASELEPIKGFPTNDKVDKVIVEIISELENQNYLNNLTNLKTSKAYTEAYRRFPAYVSQ
FT                   KKIIPVHDQAYIFWESLRLSNSIMNKRHGVNVSNFPEKANIPSDNILPNKIPVTNKEIT
FT                   RNCYRLIRYFQKSGIPFIFRAASKIQGSKNYNVNFVDPTKSEYNQEYKLYAKILCNQLL
FT                   PEIFVYTFHNVFELLISKREQKYFNELDEKRLELEVQQKEADALKKIRESVISRAHITP
FT                   YIVEKPFERYFNAWRRSFGYNGFIVYPRIKTSVLEKMYNIAKFGPQIIEKKKKNATPDE
FT                   VRSSISKALIRIIDEYFANLNTLDLFLNRVQVEEFINGTFSNLFSIAISELIKKMPIAP
FT                   EMDIKSHGNSFQIKELFVSCTDYIKAILNFNKNINKISDNLGLEDNLSKSGYKNSNLKS
FT                   TTDFSLGIKLLESGYESACMFASNLLKPNIIEYSLAMGSNGVITKLAERIKSSFIHQSL
FT                   TDGSSKIPLELGLKMFENSYIDVYKRVCEQHGILYFIPANEKQYFDSFPMFNEMSKRSR
FT                   VELASDTINFLEIEKIFLTVFESIVKPRDKGKKLELFNENIMAEFILEILIEKNVNVPS
FT                   EVNSLPPFPVSHKYPWSPFFNRGLNQWCVNMINSLVDQRLLSSANDNKVFDRTNIGPII
FT                   KSACTEDIFLKIRNNIEYEADEILRRNFAYHLATSFVYWHYYISLPKWVFYENWEGIYS
FT                   SNAVITLSEEPEISLVTFILFKCIADLEYLGNTLNGREMAIIKKELLDSSNDSTRNKAN
FT                   KAKLSLWSNTSAKSVDGGRVSLAYFLFPNVISRDILAKVTPEDVLAFTGPHDIFWVGAD
FT                   EKEFLPMCLNSIEKLNEYLNFKNLNSKEEINIWISNDTNSRELFCRDIAGRFFYPRLFT
FT                   NSDSDLSNEVNPKQIFSIEKLKLKRSQWLAIQEAIRRKTEKEQKESVAHKGEGENQLIS
FT                   MNIYSSFVLDFQESDELTNPGSFMKNCIAAFDTAMMLPEGSPYKLKILNKPNETIRDIC
FT                   DESMKLFYSSAVPMSWDEQQSQFNPIPLDDKYTVSRIALAQHEVILEQINEQNELGDYS
FT                   IRSSERFNNLFSSLIVNIGVSDSISKFMDICSEYIWECIKRKLLFLGNGYDISNSNDLI
FT                   ENICKKSSYRYFISKVPIKTEEIVLQVKSGKEISEWQRIRYKTEQWKMLQRVFDSFANR
FT                   FPGGYEAVISKTFRLPKYMQLANFNTSEDIFTIGEDCKKAMSYLINLHSCASNFVVIFG
FT                   KVTEFCDNVTQAFKQSNS"
FT                   /protein_id="XP_628543.1"
FT   gene            <863848..>868113
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3820"
FT                   /db_xref="GeneID:3372130"
FT                   /locus_tag="cgd7_3820"
FT   mRNA            <863848..>868113
FT                   /db_xref="GI:66363155"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3820"
FT                   /db_xref="GeneID:3372130"
FT                   /locus_tag="cgd7_3820"
FT                   /transcript_id="XM_628542.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        863848..868113
FT                   /locus_tag="cgd7_3820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363156"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3820"
FT                   /db_xref="GeneID:3372130"
FT                   /translation="MKLDELFHISLLILYFLIFLGNVKSSPTVTKKDDIDKEVAPGLPL
FT                   LNNDEVYSWNTLRDYVEYYESNIEIIREKYPSLEDHLIKSQWFSIIDVLRCEYEIEQDK
FT                   TLFPPRIKIKSLPKIINDVKSLWKEKNFLSVSLEKSEFIQRCTTAVRNLIFHKSIQVET
FT                   YDKSLLKSICNDSSIMFFNPAMLYEELKTKTDYDKQRIPISRLTCIDKHRIRIGQWSAI
FT                   VHLHALDSEDGRDRIFSQNDSMEQDFLPYSPPDSFHTEIEAENFELVCKEALSDYYSRV
FT                   EDKNVILEIFCKDAKDIYYNNPLEIHGKYAIYGTSIEKLKLNEIKKKAGRINPPSLMAL
FT                   NLMEYRSLRISEWVVIVDQLEIDKKSKPRYDRIVGNISIDPRPYGFIASLNSREFEEAC
FT                   INALMSRVKQQEEIMKLIHNFEMNPEKMELDEVIEWERQYSIEVIEPDTFCKDAAGVYF
FT                   GISRDSFTVMRELPLTNPPQFIDPGRGLLKSDLPTKVLDLNNERSARGSERINDIDWRV
FT                   EASCFLWESLIKSRVHSRIEDAITNIQWQAIKQQANGFVFLDIGIDGFYNGIEDPPKSI
FT                   FSFSDDPFGMYSQCLHAFSESNRRKTNINYFDKLPKFDYKWTISKNISEKLLNRGINSE
FT                   NFESFKEYSNPVKQSLCMEAVKEYFESASDCPIVNDEIELIKFSVKNAFPNNPFPDAKD
FT                   PMIADPDGELEAKEQWNFIYEYSLQSRNQKLTNDDFNENIIIVSQKMPLSYLEFRNLDW
FT                   RTKHECYQDMAINCIQSSWKMVESNWKNQNVQTDLASALAIFCDSVAILYFERKKQWRQ
FT                   LVKLMETPKYSSAFYWIRRGFYLPRSYNLLKISINNGKERKISEEELAIYKQSLANSIL
FT                   ELVKYRYLAPLTVDIGELCHSLAVDMSVATTRGIWIGLVPVDSEVIIEMERLSNNNINL
FT                   EKKDEAVGYYPIKNQFSPRRRVIKSESDSTSHRFKRNKKEQIVSMSSLKSPIKTTVMPN
FT                   IRLLQYKKIVEKDEDDLPLEYPIKNTQKADWRKYINSGIGEADQNIDQKSIHDFYKTGL
FT                   GKQWGSSDRYKYGYITYNSKAPYINKRIPFNSQMSGFDYGDSYIPEKENGVKLLTKVSD
FT                   IYRRSPDSYIGIRKNDQSTFLRAPSLLLGKKIPNYPLNLEEFVNVPDIPRVKPLSKEEI
FT                   LERAKHIHLEDSEIDESINVENIVEYLNRARKDNLNEAMVLEDEKESKGEKYPVKDYSL
FT                   PSAEIIHSIIKSSEYYKIKADCIPHFGYTIGRTLSERDLMRGARFVYRCLRMDGHFVTP
FT                   QTAYRIWIRSQFLRRDTPKVPFSPYKEEMKRFIKKRRDGDNQIYCPGKFQDQVDEMADT
FT                   IATAIYINGVFPADKMIHICKIAKEFIYKKIGTITQCVRAFREHIPRLNGDYIINHKLF
FT                   PTICTHIEQESGKYLFSSN"
FT                   /protein_id="XP_628544.1"
FT   gene            <868564..>870375
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3830"
FT                   /db_xref="GeneID:3372131"
FT                   /locus_tag="cgd7_3830"
FT   mRNA            <868564..>870375
FT                   /db_xref="GI:66363157"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3830"
FT                   /db_xref="GeneID:3372131"
FT                   /locus_tag="cgd7_3830"
FT                   /transcript_id="XM_628543.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        868564..870375
FT                   /locus_tag="cgd7_3830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363158"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3830"
FT                   /db_xref="GeneID:3372131"
FT                   /translation="MELVFLLTTLFIFVLKFVAIAANQDKNLTKSVASSLPLVEVSRIS
FT                   KIATKYVSGANIPEVVNKPGWGAKISVINNYKSAMFRREIWSQVIQTLNEPVIGYNVTI
FT                   SNHYIKNPPPVQAFMKSELPIEMNSQCLNAFNYFYVHPNLITCTPSPSKELLEILFRYI
FT                   CMKSVKKIFLSWTGFIFVLREIIEKAIFSIKNNKVPKSVFNSLMSEYYHNPYKDFVPIG
FT                   KRLGKHIKMDIEGQNIWQFIVSRSKLLYNIDSPTRAARRGEWAFVVISGNHTPAEFLYM
FT                   REIRFMNVDSVQLITAILFTMIMFKVKNPSKFKSFEVVIEDHNKKMKKSVNSNLLLAFS
FT                   ARIATYYSYIINDWNDQIDNLMEIDLEEKEKRRNQTFIWHSKPLLSLAFEPDITVPNEL
FT                   VSNCVRYCEDLVSRGIVSVVGVDNGAESSSFLQKKLENICKKLQNKILPYTEIYVEPEK
FT                   NVPKSILKSSVKPSSLKKKKLRFDNNVQVSIYNKGEHISERTPIGNFTLGSSLKTSLMK
FT                   PEGSSTARPEIPIDNIGSQTSQRVENTNAAFDNIDLQHLQKEDLFEKTPYPFEDDESSI
FT                   NQSNSENVKPVNSLNMVNNENKSSKKS"
FT                   /protein_id="XP_628545.1"
FT   gene            complement(<870518..>872770)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3840"
FT                   /db_xref="GeneID:3372132"
FT                   /locus_tag="cgd7_3840"
FT   mRNA            complement(<870518..>872770)
FT                   /db_xref="GI:66363159"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3840"
FT                   /db_xref="GeneID:3372132"
FT                   /locus_tag="cgd7_3840"
FT                   /transcript_id="XM_628544.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(870518..872770)
FT                   /locus_tag="cgd7_3840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363160"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3840"
FT                   /db_xref="GeneID:3372132"
FT                   /translation="MSAKNSSIIYKFKWVLIYLILLIFSAYIQLNCVGCYEVSSISKSV
FT                   YTSINKSLEICIKDFYTELTHKSENLGVIYQVVKKKENYIIKILIYESFNQVEDPNTAS
FT                   DYCNFKSCITKNYYSELDQLIGDKNEISYSTNFKFIMELPSKEELEEIERKDKNGKLVV
FT                   VRKMFKFNIASSIQNSNKSEISNPSEHDLPVESITSTTTNATTAMLSTEITTMPSKDNQ
FT                   INQVNTNFISFNEIVNLNIFCAELSSEEVIDAIKFQNTFMLPDIIYLEVAMLLRRLAKR
FT                   IDLFRSAEESLSAIMPGIGGLLVSDTHCEESLRVSLVAGELTIPGVGPNEFPVICQKLQ
FT                   QCLSDQSFHNSALVSLSKSKKYVDFALSRNRNFMWETLNKMVGILGNSSGLKSYQLWME
FT                   VEILIKNTTSDEDVLHSDLPKEMILIADLMKNSKSQTVECTISIMKIGSLYDIRLTQVS
FT                   EVARICNRIFSDSSSYLSVDEMRLISDTTILSRIADWMIGTFILEKHIPPGVTKPAACM
FT                   YLSAITSPMDYSSITNFLWPRIVFAISSSSSSALSFTTKSVDPENCRKSLVKILKIIGD
FT                   KIQINIDETCGKMASCILNGRIGRISVDDTISNALSQSQQTINYDFGTNSASLRLARFI
FT                   FESKAPKKSKRNGFSKLSAPLRGSVLFGHLQTIMPGGFSINDVVKFVHSFTKESPPNGP
FT                   AKKCFKVLIKYIPVFVSSDNELKTICINAFGPWIMPDILVSDVTFSQSTLSNEVVV"
FT                   /protein_id="XP_628546.1"
FT   gene            complement(<873022..>873735)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3850"
FT                   /db_xref="GeneID:3372133"
FT                   /locus_tag="cgd7_3850"
FT   mRNA            complement(<873022..>873735)
FT                   /db_xref="GI:66363161"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3850"
FT                   /db_xref="GeneID:3372133"
FT                   /locus_tag="cgd7_3850"
FT                   /transcript_id="XM_628545.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(873022..873735)
FT                   /locus_tag="cgd7_3850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363162"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3850"
FT                   /db_xref="GeneID:3372133"
FT                   /translation="MEFSCQNSQTQICRRAYIPNYSKDEVKDLIGCNNTEEPNDSIKRN
FT                   VGGFRYDLCSEKIYKIFQASNWKNDNVSKKNYNHEETPKVGQVSLKRSIVYDSSLGCCV
FT                   PLYTRKPGCSRMKLDIIGYGESENYGTQLERASDNSMGTILNNSNLHKNFNQHFSGCST
FT                   NIIGEIRDSFGRLPSKAGYKTSKVNKSSVHIENDFYMPEEGSSYENNTKTQHSVGKNFN
FT                   GSHLTFSGGFLTSIS"
FT                   /protein_id="XP_628547.1"
FT   gene            complement(<873954..>877733)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3860"
FT                   /db_xref="GeneID:3372135"
FT                   /locus_tag="cgd7_3860"
FT   mRNA            complement(<873954..>877733)
FT                   /db_xref="GI:66363163"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3860"
FT                   /db_xref="GeneID:3372135"
FT                   /locus_tag="cgd7_3860"
FT                   /transcript_id="XM_628546.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(873954..877733)
FT                   /locus_tag="cgd7_3860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363164"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3860"
FT                   /db_xref="GeneID:3372135"
FT                   /translation="MSYKFQIIITLILYLVILDYCICAEFVESLESIINGGYNEDEFNP
FT                   LFVEELNEIKNNPEQKKDNFYIRLRSGQWFALKQQVEYDSSEMGLKRVYGVLPVNPFAG
FT                   NIFTPSLSELELADKYCEALLDMRNKGISTKIGLKIAKDGLIREKFCSDAAELYFNGLR
FT                   PRPATLAQKQNEMESLGNIEYFDYANLGTITSQIDIPRISTGARARYGGKYASVSSSQE
FT                   AELITKQTLLRNFLHVVKQLHLNTLRKDPLRLREYFPGTLLQLRDAIESDDPEVVAVKL
FT                   LRLGPTSDLLEQFINNHRGKRDILLIKTKKGYKKKRNAIFEEWMDLISNTDLSVVTLPN
FT                   LEHLAYKHVALTPSIMTQIKKLYNLIVKEKEKKQNYYTPQIIEALDLLPGIVRAEIRIF
FT                   FELNTKYGYYRINTLEKIRSMIEVIQPLVKTVNHFSEEEFNKVLANTGLSQNEMNYYSR
FT                   NLSKILLTIMERRRLKIKENDDDDDLLNNEPSISVNSLIEMIQKMNNSSLGAIMDHIES
FT                   IVPNFTNKNMHSEATEQQKKEIEALVKLPTSPVVSRQLYGESVLRPLLSDAIPNEYGTL
FT                   DKFIKGFYILMAETGVRLQIYLRNGFEGQVPNKYENYYKQNAFLEDNLRHNSELWQASI
FT                   KSLLDETLFPYELATRRLLQYLKECKIGVKFGSNEEELKKRSSEIDQSYLQTLLDNFES
FT                   IKLTEKRLNPIFIGEKGNMLILPNRRHHLINYIFQKDGASLYRILKDEKLHQILVGLVD
FT                   LLEEIQIPKKEDVNIQGPYWDREKNEWVNADKMRKNEVEIVYEPQKVTDLPINREQEWE
FT                   RIALFSKWSDFVKGIPINSIPNGFKFSFGLYSNFIHFCQRGIRELAYRLIVRDKPTNTE
FT                   PEGKYWEYLPRNKFSILINADNSKAREEKVLSFCSAVYISIYSEKGVPEEYKGSLPNVW
FT                   SKETDKYEKEAFITPKDKSKQLRYHLDDVNEQWSFIASEARKPGIFMAPTMPTDSSLLG
FT                   DVWRKLYVDQHIATSSVNEVDAKISILTDMCSKAIRNLMQKKNYYGEQLYKMVYDGENS
FT                   IEVFCHDVSRRWFSKWPSDISNEMLLSSQHEYENQSFKPFDRSYLKSRKPAERKIREGF
FT                   SKTNKKISPVVMEEFNFNKISRNARSFEEIPTELCDESINGSCNHKNIGSSLTHSISSI
FT                   NLASGSTLLYSDKVKRVNSKVRSTGIERIKNPEVLSRNKIMNIRDILDSSDSGSKSQKE
FT                   LVRAIPTKKINESGIKKKPTKNTKIDKTFSELID"
FT                   /protein_id="XP_628548.1"
FT   gene            <877990..>882987
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3870"
FT                   /db_xref="GeneID:3372134"
FT                   /locus_tag="cgd7_3870"
FT   mRNA            <877990..>882987
FT                   /db_xref="GI:66363165"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3870"
FT                   /db_xref="GeneID:3372134"
FT                   /locus_tag="cgd7_3870"
FT                   /transcript_id="XM_628547.1"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        877990..882987
FT                   /locus_tag="cgd7_3870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein"
FT                   /note="cryptosporidium family of large secreted proteins
FT                   (CpLSP) signal peptide, secreted, gene within locus of
FT                   secreted protein genes"
FT                   /db_xref="GI:66363166"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3870"
FT                   /db_xref="GeneID:3372134"
FT                   /translation="MNSKRLFSKRMPNKIDGSIALCFLAFIIFFVVKVGGTNNENLSPN
FT                   IHSGDRMLWGIIKSELVTNSWLNLSKIPTEITESDMGISIGVINICSSNKIKIKKQLSF
FT                   KCINKLRTLLDYTNKKDKGYSIRVRKGVSFNEALARLCLDATNKYLNNSSKICKDKETN
FT                   RTSTKGKKLTRERKTNEKKISIDGLTRITEKLESSELLKKDNLLKLIQSVLFDYESSLT
FT                   PSRQLISQIRKPKQSQVSRLIVNRDLKGLAILLSNEKQEDALSFINVLINGDKSEETDN
FT                   LTFEDIENKINSKHNLSKITNKYKPFGFMPIPEDEWGAVVSWIQENTNKIQRPRGWMIK
FT                   KTYGKKALRLPENFVASKGVETVFIDNCFKSLRNMAYTVFTAPNGDKYYKYNKENDYGL
FT                   MIEGESQNERILNIKNACKEIFERYYEYLGIKTQKEEYRFKIHGKLNFLLPLKHDRLFL
FT                   NKLLKSFYKSINDREKEWHAVVNEARISPLVSSKDLTEEIVPYTFIDERIKRESNLEKK
FT                   ESLLSDVCFKTINTLRKERSQGSSDIPLYNIEIGSENEVSIAKFCKGLFERFILRHIEW
FT                   LKIIIKSIESDNIKLVDINDPYLEIPEVFLFPEDARLKENCITSLIVVFEKNLQAIENG
FT                   YPVKVYPQIDYLGDPSDMIENITLFCESLSGKVSPKTHRSKIPVKDEQETIKIMSSEPE
FT                   LIKLVRKNIESNLLLSFETKMETRIDKITQNVSNSNTFRLENWKSHFEEISSLDSHVES
FT                   MINIFKAQFSEFIDYEGLCEKKIRRYIAHINSKEDEVSDISWLEGYLMETDRLKGDWAT
FT                   ELQSIENLHKSMLAAEGELERYVNTIRSVVYGDEKQKELPQVRKMLNGWQKELSNKERV
FT                   YIKHKIDSLLSKQKHEYNIESLRYEQLERRKVFRDNLKKSFLDQDQNKPLFFDMENCFK
FT                   QDDEDLVPIYPEKETKEEEKIRNDRIASIETVLNEFKNRFALINSSLNAQLGGLESFLT
FT                   KARKDFQTAWTESFNTALALQLQLRTRALVEEYVRASERYLLIKRVKADYEYRKSIVSE
FT                   FQADPSFEVMLNRASEMIERADEEEAELEKELSSLHEQKDKLHLLVEEDMQTIYSQRLK
FT                   TIRDSKELIRAKIDHEKKLLMQEEKVFEDQLKRDLEYYNIREVSEAAIYRADKLKMLYD
FT                   ATNWLLNFNEKLTISSETQFREDLEKLDYVIPLKKLTNSRSENDERFNFDSLKANLRRH
FT                   KYTHNEGFDPNDIEDQQELKKEAGPFYNDDQTQGQIPVAAQTLLRMFKEKLVIRLNDID
FT                   EINQQILQLNLNVVGSFQYYDYNRERAYKSFRELKYSKGASNLFAIILSHFEWEHIQLR
FT                   WRVLDLAKHILNEKENKLNEISELRSSLDNKMREFEAIPLSRKLVPIGTSVDMMTNEIS
FT                   GSRKNEEDSLELLPSSIPSYLLSDEDFSQVRSYDLGAKKIILNRILFMLSANESRYVEL
FT                   LKDTITEINNKKKTAELEIQTIRSDLDEFRKTIGYKMLSKEDRDLEEEKFKKKITKITE
FT                   SKNLVPLLAKREILIRKSEKIDSFRDKVQHLFQDPSFTAEQARALENAINEFFGTKSAQ
FT                   FDEITPRIKLAEEINKLQFAEEEIAELEKSMNNMKKQENYAKLHGLKIKSVEIKENISR
FT                   LNEKISALNEFIQEFQDKHFSKVFEVN"
FT                   /protein_id="XP_628549.1"
FT   gene            complement(<883858..>885741)
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3880"
FT                   /db_xref="GeneID:3372136"
FT                   /locus_tag="cgd7_3880"
FT   mRNA            complement(<883858..>885741)
FT                   /db_xref="GI:66363167"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3880"
FT                   /db_xref="GeneID:3372136"
FT                   /locus_tag="cgd7_3880"
FT                   /transcript_id="XM_628548.1"
FT                   /product="DNAJ domain protein sec63 ortholog, 4
FT                   transmembrane domains"
FT   CDS_pept        complement(883858..885741)
FT                   /locus_tag="cgd7_3880"
FT                   /gene_family="HOG000280883" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNAJ domain protein sec63 ortholog, 4
FT                   transmembrane domains"
FT                   /db_xref="GI:66363168"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3880"
FT                   /db_xref="GeneID:3372136"
FT                   /translation="MSQFRDTFTKEEKSDSLYDDTAFFFFFGTIVICILIFWTYNVLSK
FT                   VLCPTRKFNKKEFPKSTPSGSQIQYCKCSGCVSNVENIRRKHRSFSNRFSLKMILQVAL
FT                   LGIMWSLTYYMLSKYSENRQIAQFNPYEILEITPSSNTMSIKKAYRLMSLKYHPDKNPN
FT                   DPTAAAKFMLIAKAYQALTDEVARSNYEKYGNPDGPTSMKVGIGLPSFLVSKKYQLFIL
FT                   CFLSLIILFVIPLAFIIYYRRQKKYASNGVYLTTLYFYSAAISDSTRFKALPEILALST
FT                   EFRSLKKNTSEDDKVISHLANILPEFKKRSFNNNSPSFFTAYYLILAHLYRKHSELTPS
FT                   LKKVLEDILAKSISLTSSMLEISISRNFFHTSTSILAFRRSLIHALDGGPNASFLQIPY
FT                   ITENEVQHIKKGKTAVRNLVEFIKQDPANRKGLAEFNESQKLDIEAFCNLISPIRVDSK
FT                   VIVDDEQDIVVGDLGTIEINIDRANLKENEACGPVHSPYFPTTKYEEWWIFAVTKGSNP
FT                   QIIGYTRCSSNEKIVDVKIQFLIETPGSIDISLHLINDSYEGLDQVVNVSFVAKTIKEG
FT                   IRQIYVHPEDEALDNEPTLFQHIMNQLDDNQLSTDTEDEDDDAAERSSSTE"
FT                   /protein_id="XP_628550.1"
FT   gene            complement(<887508..>888581)
FT                   /note="CryptoDB update."
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3890"
FT                   /db_xref="GeneID:3371839"
FT                   /locus_tag="cgd7_3890"
FT   mRNA            complement(<887508..>888581)
FT                   /db_xref="GI:126654146"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3890"
FT                   /db_xref="GeneID:3371839"
FT                   /locus_tag="cgd7_3890"
FT                   /transcript_id="XM_001388360.1"
FT                   /product="calcium-dependent protein kinase 7 (CDPK)(CPK7)"
FT   CDS_pept        complement(887508..888581)
FT                   /locus_tag="cgd7_3890"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calcium-dependent protein kinase 7 (CDPK)(CPK7)"
FT                   /db_xref="GI:126654147"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3890"
FT                   /db_xref="GeneID:3371839"
FT                   /translation="MGNNTSAIENVIQQSFGVCLNVKQYINNNNFNERYRIGGIIGTGQ
FT                   FAEVFYCHEKTTNHPYAMKVIYSTDEVSIDRIIEEVEIMKLLKDHQNIVSIIDSNIEHI
FT                   DEDKYEVKMVLELCKGGDLYQYVLANGAMEEKIVQKIMINLLDALKFIHKNGIIHRDLK
FT                   PENILIDEFFCCKIADFGLAKRCISSDSSNKVARSKSLCGSDFYLAPELVRQQEYGPEI
FT                   DIWSIGVLCYVCLCGGLPFHDNRAFDLYHKIVERGVNSYLFAQPAWKNVSSAAQHFVQW
FT                   LLESDPKKRPTAENALNHRWLRTSFAKQGIQTSTNPFNRAGHKNSLSIGVDSSPVTTQS
FT                   YENRNHISNHVYDIYKY"
FT                   /protein_id="XP_001388397.1"
FT   gene            <889090..>889983
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3900"
FT                   /db_xref="GeneID:3372137"
FT                   /locus_tag="cgd7_3900"
FT   mRNA            <889090..>889983
FT                   /db_xref="GI:66363169"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3900"
FT                   /db_xref="GeneID:3372137"
FT                   /locus_tag="cgd7_3900"
FT                   /transcript_id="XM_628549.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        889090..889983
FT                   /locus_tag="cgd7_3900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:66363170"
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3900"
FT                   /db_xref="GeneID:3372137"
FT                   /translation="MRKVNFFFNLKPFSENLKKESIEAVKEVAERMMECLETFGERIVD
FT                   QKKKFWQTIDYKLVRPAVSKINSFEFWLENNGVMEIPDVILKEYLYLMALVDDSKFIDV
FT                   DKAEESISITNEPIVVEDNEQKEANIDSLIADINSTITQTRVILLEVEKFGKILEQKKT
FT                   QLNTRIKGQQIVEVFSPVIDDLKIKYEHIKSEGTMESFQKLINEFCSALEERNELRYRL
FT                   VHGEDRIEIPDSADKNELNQDVSIDQNVNIDSNNSQNQIIDSVNSIQEKSKRYTSVVDK
FT                   NAMKLFARWSLPNHPG"
FT                   /protein_id="XP_628551.1"
FT   gene            <890190..>891887
FT                   /db_xref="ApiDB_CryptoDB:cgd7_3910"
FT                   /db_xref=