(data stored in ACNUC8465 zone)

HOGENOMDNA: CRYNJ_3

ID   CRYNJ_3; SV 1; linear; genomic DNA; GRV; FUN; 2105742 BP.
XX
AC   AE017343_GR;
XX
DT   19-SEP-2006 (Rel. 59, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 67)
XX
DE   Cryptococcus neoformans (strain JEC21) chromosome 3, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Cryptococcus neoformans (strain JEC21)
OC   Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
OC   Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
OC   Filobasidiella/Cryptococcus neoformans species complex.
XX
RN   [1]
RX   PUBMED; 15653466.
RA   Loftus B.J., Fung E., Roncaglia P., Rowley D., Amedeo P., Bruno D.,
RA   Vamathevan J., Miranda M., Anderson I.J., Fraser J.A., Allen J.E., Bosdet
RA   I.E., Brent M.R., Chiu R., Doering T.L., Donlin M.J., D'Souza C.A., Fox D.
RA   S., Grinberg V., Fu J., Fukushima M., Haas B.J., Huang J.C., Janbon G.,
RA   Jones S.J.M., Koo H.L., Krzywinski M.I., Kwon-Chung K.J., Lengeler K.B.,
RA   Maiti R., Marra M.A., Marra R.E., Mathewson C.A., Mitchell T.G., Pertea
RA   M., Riggs F.R., Salzberg S.L., Schein J.E., Shvartsbeyn A., Shin H.,
RA   Shumway M., Specht C.A., Suh B.B., Tenney A., Utterback T.R., Wickes B.
RA   L., Wortman J.R., Wye N.H., Kronstad J.W., Lodge J.K., Heitman J., Davis
RA   R.W., Fraser C.M., Hyman R.W.
RT   "The genome of the basidiomycetous yeast and human pathogen Cryptococcus
RT   neoformans.";
RL   Science 307:1321-1324(2005).
XX
CC   This Genome Reviews entry was created from entry AE017343.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2105742
FT                   /variety="neoformans"
FT                   /organism="Cryptococcus neoformans"
FT                   /strain="JEC21"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 3"
FT                   /db_xref="taxon:214684"
FT   CDS_pept        join(1984..2196,2252..3449,3508..3809)
FT                   /codon_start=1
FT                   /gene_family="HOG000138213" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788709"
FT                   /locus_tag="CNC00010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42042.1"
FT                   /db_xref="HOGENOM:HBG068741"
FT                   /db_xref="HOGENOM:HBG175068"
FT                   /db_xref="UniParc:UPI00004B43B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLC2"
FT                   /transl_table=1
FT                   /translation="MIGDEQTFDDRIFRRYLDRFIQENCNYMAMATEFSHQANLKTVFY
FT                   DRYDKEWAKLDLVDMYRRRTGKILGAPSQSQGTSKSKKDVATTPDASLIGSVNDPSSPS
FT                   GRKRMLYAVIELKWMNLAALLTGEAKSQTDEKALSYLCQEGVFQTMWYVILGYAISRCI
FT                   FGLSIVNEYFYRIVYLYQDSASDSPVLALEASKEFLENAGRHFGYPRDGYSVEELAELQ
FT                   DFWSSPPNCLISDRANATLNKETRYHLDATILLFLAHAAALPTQRFLNDLPLPFAHHVP
FT                   VDATAHSATDMRLKGLEVGRRRHSLRSTKRNKRTLADLYDEEKGEEDKPGDQEDKSGDR
FT                   KPPGKDNRNNDPRNDGSQGGNSGSGGDNSRGGGSGPGGDNLHDGGSGSGRGHEGSDSRD
FT                   VGGYEGSESRDDGRDPVRDGAGGPSTHRAEAADIRTPTTRQEFLRGLQKLSTPGNMLDM
FT                   KSSIIASLISNPHTSTSVAPSSPGVNSTTSSEDVLFPDLSLDSNGRTLVHCDLSTDPLP
FT                   KVHKSTPLDLDLEDIDPETGELTLAAYRDRLAMLGVRVKLVTREEMDVLLARG"
FT   CDS_pept        join(complement(5823..6098),complement(5586..5755),
FT                   complement(5385..5503),complement(5018..5326),
FT                   complement(4655..4932))
FT                   /codon_start=1
FT                   /gene_family="HOG000227440" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18941837"
FT                   /locus_tag="CNC00020"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAW42044.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG407231"
FT                   /db_xref="HOGENOM:HBG533598"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B43B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLC1"
FT                   /transl_table=1
FT                   /translation="MASFTLSWGIISTGGIATTFAHDLLVDPASRNTKDVKHRIAAVGS
FT                   RSLQSAQSFINKLKESSEGKSWAWGVKNGVLDGVKARGTYEEVYNDPDVTAVYVGTPHV
FT                   FHHRNAKDALLAGKHVLLEKPACLEVEELDELIKIAKEKNLFFMEAVWTRFQPIAYAVE
FT                   EVIKSGILGKPRRFSADFSMDWNLDASPDSSRMVNPALGGGSLLDMSAYPSVWAMLLVH
FT                   RNPFNTDKDPKVLFTNQTIYPRSGVDINSRWLVEWKGLCQGMLMTDLDNAGQKDSTAVL
FT                   QCEEGDLVVAYPPYKPETFYIHPRPSRFPGTITSSTTHHHPLHDGNNGMSYEADEVARC
FT                   IRDGKIESERMPWEESRVVQGWVDKVRKEGPTETAKLVGTAGQ"
FT   CDS_pept        join(complement(9716..9901),complement(8925..9638),
FT                   complement(8613..8783),complement(7811..8565),
FT                   complement(7675..7762))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804368"
FT                   /locus_tag="CNC00030"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42046.1"
FT                   /db_xref="HOGENOM:HBG067700"
FT                   /db_xref="HOGENOM:HBG176020"
FT                   /db_xref="UniParc:UPI00004B43B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLC0"
FT                   /transl_table=1
FT                   /translation="MSIHSISDTYYTGPINSTLRGFSNVVRLFGTGKAAHSDGKDVDEE
FT                   NSDDADIDEEGLLWDAQTALIANEPEIATRLYVQAALPPYCSPSACLALGNLLIRSSVY
FT                   MESPSAPISSSNELTSGRSGTSLWSKLFGTISTPQSPSSAHSSSPTRKRIDLVACGWQM
FT                   PKVGKRAVRDVEGMGVAGAWFVLGLGWVVRVEMEREKRLRGKVVIKPSKETFEDSEEEA
FT                   IFTKKKGKGNGRLHSSTIYIAPPQRADDPFPIVAGNPKTALSESTKTEESSLIGTPAMG
FT                   DVESLEDEDESEMESLSIMLPPALRPKNEADKGRNVWWLGRVVAQQLIKLDILKAAKGK
FT                   GQKEQLRKAVGVSVNYIIATTSPDLQAEMYFRSIASTPSIGLEYADDLVTNAKKRLQII
FT                   TSTPRDEKMLRFFPFPSMLDKASPPNPQKTSISSPRSILTPPKVMVQSAKSTVSLAALA
FT                   GEEEVASLVAPGPKKLGALDTLKRVHEKAVMQDEEVGREEVHDEPGVSYSEVRPTIRRV
FT                   STSPHLQTHLHPPPSSSRTRRRLPFELPSSEPIAPVDPVLAAAEMSSALTKHVVCNVCG
FT                   MKGVNFPECRKCGLRFCSRECRVGEDRAGNGKRHICGLSESRRNHGGLSHGIEYGVVGD
FT                   VH"
FT   CDS_pept        join(11155..11286,11336..11405,11461..11936,11996..12132,
FT                   12182..12324,12382..12516,12568..12676,12745..12983,
FT                   13052..13167,13339..13386,13447..13572,13626..13745,
FT                   13794..13856,13901..14344)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804369"
FT                   /locus_tag="CNC00040"
FT                   /product="Expressed protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAW42048.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG067699"
FT                   /db_xref="HOGENOM:HBG176077"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="UniParc:UPI00004B43B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB9"
FT                   /transl_table=1
FT                   /translation="MSIHDSTFSALKDMGIDPMLAREAASRFHSVEPAVNWCFGDGANW
FT                   QPTTVAESMYGGFNPRHREGTSVEHREVIEVFDSPSGSPKPRHSHIPLGSNNPFLPTQP
FT                   RSPHPASHPLPQPPLPPRSPSVRLGTQGLPVEVDDGNDSEGEELRKAIALSQNVEHSVS
FT                   EAAPLQDAMDVDGKRDSRERSERASGAPPPSPKSDMPGTIGVTFGPSTKDDVDGKLALV
FT                   PTSQNNNTTSNEDADLDKAIQESLMTASFHSASAEANKERPQPTKRGDGVPLVFYSPSG
FT                   RYTYVAQILQAFAAVPRIQTAFQENVDSASSGDDILTERTQALSDSFGRMIDEPFSFYE
FT                   IDDTAKIITEGSERNQLPPLLPTMDFQLIFIDLFERAAIPRLQGMAKDEDELNRLREEC
FT                   RRVFETKVTGHTPDSITSASYVTFVRQPTGNDVYTQLADVFWGPEAQTTSIKKLGDVLT
FT                   VYLDWKPSSAREVWKLDEEITLDRFLQSNAAWAANRRGLQAVSAGNARRIKEKIESLTL
FT                   HDNVDITRAVSREGMKGKIETILTALKTKVADLEEELKEQEKAASAEAFETDDPQYNQH
FT                   VFNLRAILFHDGAMVGQKHLYMYVRGKDDRWWKIQEHEATEVEWEAIIGDRTGIWMEGG
FT                   PYMLLYARQGDRPSSPESSPTRPSDVDVPPHSNSIILESNNTLTPTLPPDYSESTSTSA
FT                   SNGSKSQSSDTNEKNGEGLLLMDMETPEAETEWVEDAGSEANKDLMDIVMGEGGSPKKE
FT                   EEIKATVHEKADEENKEVEARSTNKDEDTVML"
FT   CDS_pept        join(complement(22667..23574),complement(22407..22620),
FT                   complement(22249..22356),complement(22032..22185),
FT                   complement(21906..21982),complement(21804..21847),
FT                   complement(21571..21750),complement(21432..21515),
FT                   complement(21256..21372),complement(21174..21199),
FT                   complement(20983..21109),complement(20856..20924),
FT                   complement(20761..20807),complement(20646..20701),
FT                   complement(20468..20595),complement(20333..20403),
FT                   complement(20111..20275),complement(19996..20050),
FT                   complement(19909..19939),complement(19623..19850),
FT                   complement(19513..19562),complement(19410..19466),
FT                   complement(19329..19348),complement(19213..19271))
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804370"
FT                   /locus_tag="CNC00050"
FT                   /product="Chitin synthase 8"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="AAW42050.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI00004B43B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB8"
FT                   /transl_table=1
FT                   /translation="MNPGDIYQPPGGYSPARQNQRPPQPQPFPQQPYPPPPAVQYGDPF
FT                   SAPPQRPPAASLQNMSPAWHEPPHASHPLQPTSPTGPPAPRYSLPTQSLSPFNGSPASA
FT                   PAPAPYTMGSPPNSHPPMHASPPQHIRFHANPSHLPPQQQPAPSYSYPNGIDDRLTSPP
FT                   PLLPHHSSQSSMSAMPAPVPDNINYGPPSYPPQGYGNAADDDMNDSRPLLAHAAPDSRF
FT                   GIPQSTSAMSMTAPAVRYQLSDAGAGDMGVTMYTGNGDAEGQNGFGTGDGVGAGGEDEV
FT                   NMHYGPVPARIVRRNRTQKRVQLFQGHLVLDIEVPTMLLEQCPIRQGNEFTKLRYTAVT
FT                   CDPNDFVEDMYTLRQRLYDPPRQTELFIVITMYNEDDILFCRTMRGVMQNIAHLCTRSK
FT                   SKTWGVNGWKKVVVCIVADGRKKINPRTRSVLAALGVYQEGVGKNMVNGKPVTAHVYEY
FT                   TTQLSINSSGKIGPAGSNTVPIQMLFCLKEKNQKKINSHRWFFNAFGACLRPNVCVLLD
FT                   VGTQPGPDSIYHLWKAFDINSSVGGACGEIVALKGMFWKNLLNPLVAAQNFEYKMSNIL
FT                   DKPLESVFGYITVLPGAFSAYRYIALLNDEKGNGPLKQYFVGETMHGSGAGIFSSNMYL
FT                   AEDRILCWELVSKRQCKWKLHYVKSAYAITDVPDTVAELVSQRRRWLNGSFFAAIHSIV
FT                   HFGYLYRSSHSFTRKFFLHIELVYQTLNMVFAWFALGNYFIAFFVLTESLNSLGTAWKY
FT                   VNTPLHYIYIALLLWCFLLSLGNRPAGSKIGYTSSMVGFALITIYMLFAAIYLTVKGVE
FT                   DIQAAGEVTASTVLGNKIFRNIVISLLATYGLYIISSLMALEPWHMITSFFQYLLLAPS
FT                   YINVLNVYAFCNVHDVSWGTKGSDKVSDDLGAVKSSDDNKDEVTVDVPIEQKDINAVYA
FT                   AELQILGNKAPKEVRVVNDDQKQEDYYKNVRTNVLLAWTMTNGALVAAILQVSGGDSAV
FT                   ATTYMGVLLYTVAGLAFFRFLGSSAYLLVRLFVGE"
FT   CDS_pept        join(complement(26425..26593),complement(26237..26360),
FT                   complement(26086..26178),complement(25979..26035),
FT                   complement(25856..25915),complement(25456..25790),
FT                   complement(25251..25390),complement(25108..25196),
FT                   complement(24917..25053),complement(24660..24850),
FT                   complement(24505..24590),complement(24247..24433))
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19788710"
FT                   /locus_tag="CNC00060"
FT                   /product="Sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42052.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042EC09"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB7"
FT                   /transl_table=1
FT                   /translation="MVAAVANEGGGLESWADWFKKDYRRPIFFCALISIAPVAYGYDGT
FT                   YFTSLLETPVFVEQFGDNTGNGTYALSSSDQSLWVSIIQVGEVVGSLGAGPIGDYSGRK
FT                   GGIFSAIVLLAIGVVLQMIIVGSSALLTVGRLIAGMGIGIISNAAPLYLSEIPPMEIRG
FT                   ACVSSWQLMLAIGQVIGAGVGLGTHTMSSTASWRIPVALNLVWVVLLFVVLFIVPESPR
FT                   WLLYKGKEAKAERALNKIHGGSEYRDVLVSEQLAILNKSREEEAEASSGESKWSDLWKN
FT                   PVERRKFFATVGILVSQQISGVQFIFSYTTTFFALVGISDTFIITIIVDCIEVLGVIAS
FT                   FFVVERWGRRPLLIYTGIFMFITLLIVGAMGAVSGQGDRFEPYLADHPSLGKAVAAMIC
FT                   LYVFAFNLSWGPLAWVVAAEMSTGRNRQKHLSIGTAMFWVSAWVVTFTLPYLFQPDEAG
FT                   LGPMIGFIYAFGGFLSVAFVYFFIPETQGRTLEEINFMMEARIPTRQWKGYDLATVVAR
FT                   DEKKITRGEAEHLEKVDELERPQNKRFMSLFAADSESS"
FT   CDS_pept        join(complement(30081..30402),complement(29947..30024),
FT                   complement(29806..29883),complement(29735..29749),
FT                   complement(29631..29660),complement(29439..29565),
FT                   complement(29247..29349),complement(29163..29175),
FT                   complement(28943..29104),complement(28761..28816))
FT                   /codon_start=1
FT                   /gene_family="HOG000138320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581861"
FT                   /locus_tag="CNBC7140"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42054.1"
FT                   /db_xref="HOGENOM:HBG067697"
FT                   /db_xref="HOGENOM:HBG176260"
FT                   /db_xref="UniParc:UPI00004B43B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB5"
FT                   /transl_table=1
FT                   /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAPS
FT                   LVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQRH
FT                   SATVVALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSDG
FT                   RTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGREE
FT                   EDKFRNALHRHIGFGKSRSMHFTLKGGKKMTNHSFILVLSSNPYKYNTVSLEGKEKKTW
FT                   FISLPRGVDSYPWDQGGEDGDFYGRSIKSGMTFQQVCQGLADDSSQ"
FT   CDS_pept        join(complement(30081..30402),complement(29947..30018),
FT                   complement(29806..29883),complement(29735..29749),
FT                   complement(29631..29660),complement(29439..29565),
FT                   complement(29247..29349),complement(29163..29175),
FT                   complement(28943..29104),complement(28761..28816))
FT                   /codon_start=1
FT                   /gene_family="HOG000138320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581861"
FT                   /locus_tag="CNBC7140"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42055.1"
FT                   /db_xref="HOGENOM:HBG067697"
FT                   /db_xref="HOGENOM:HBG176260"
FT                   /db_xref="UniParc:UPI000042C10D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB5"
FT                   /transl_table=1
FT                   /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAPS
FT                   LVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQRH
FT                   SATALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSDGRT
FT                   FGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGREEED
FT                   KFRNALHRHIGFGKSRSMHFTLKGGKKMTNHSFILVLSSNPYKYNTVSLEGKEKKTWFI
FT                   SLPRGVDSYPWDQGGEDGDFYGRSIKSGMTFQQVCQGLADDSSQ"
FT   CDS_pept        join(complement(30081..30402),complement(29947..30018),
FT                   complement(29806..29883),complement(29735..29749),
FT                   complement(29631..29660),complement(29439..29565),
FT                   complement(29291..29349),complement(28946..29082))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581861"
FT                   /locus_tag="CNBC7140"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42056.1"
FT                   /db_xref="HOGENOM:HBG067697"
FT                   /db_xref="HOGENOM:HBG176260"
FT                   /db_xref="UniParc:UPI00004B43B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB5"
FT                   /transl_table=1
FT                   /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAPS
FT                   LVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQRH
FT                   SATALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSDGRT
FT                   FGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGREEED
FT                   KFRNALHRHIGFAIPTSTIPLAWKEKKKRRGSLVFPEEWIAIRGTRAGKMAISMEGA"
FT   CDS_pept        join(30765..30944,30981..31337)
FT                   /codon_start=1
FT                   /gene_family="HOG000206059" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804371"
FT                   /locus_tag="CNC00090"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nutrient reservoir activity"
FT                   /protein_id="AAW42058.1"
FT                   /db_xref="GO:0045735"
FT                   /db_xref="HOGENOM:HBG050981"
FT                   /db_xref="HOGENOM:HBG065647"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000042FAD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB3"
FT                   /transl_table=1
FT                   /translation="MSPLTPNPLSTLRVTKKQIPSYQNFPNTALHRHPLIIYHSAYPSS
FT                   LTADQVEKHLSSVGVHHYHSNTHELLVVVSGAGTLCFGGPRDEENKSRTEIDVEKGDAM
FT                   LVPSGVAHAMIEDKGGFSMVGSYPIGAKNWDMCTGQDGEKNDAWETVKGVKWFDKDPIY
FT                   GDEGPAINTREGDAK"
FT   CDS_pept        join(complement(32687..33431),complement(31726..32636))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15804372"
FT                   /gene_name="MRH4"
FT                   /locus_tag="CNC00100"
FT                   /product="ATP-dependent RNA helicase MRH4, mitochondrial "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAW42060.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG175913"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000042E2AC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KLB2"
FT                   /transl_table=1
FT                   /translation="MPPNLTPRSFNRDDGVTEEYINGLPAYPTPPTTLANEEQARPRTF
FT                   DDFGLEEGLVKSLKGLYGEDGKTTPIETLSFHHFTQPDIASAPIGSQRVLLGAETGSGK
FT                   TVSYLIPLFHHLKRTDPGPSVTSSFFADSENTLHPRSIILSPTHELTRQSTQFAKILTH
FT                   NTKLSVHGMSSTVSGGVGEKRGSVDVLLGTVGSLRRMFGMTRSEEEQEKEDYIRGKRIW
FT                   QDEQEKGMVEGDKVEWVVIDEADVLLGREFYLDTISVLSQVKQANLILCTATLPPFLIN
FT                   LLTTNPFFTKKEPFIHLLSPGLHKLPPKLLTRFIRPSTTGNKHGDVAHQVRLTLAEDAK
FT                   AAKAEGREGEEPSKIVIFCNSDKQVEQVSGILGTKKIDCLAWTGAGEERLRGRNGSLND
FT                   FLQRPHLPGHEPPAPLPSLEPRETKPIFQDKNGTTPNVSQVTRRRVLVTTSLLSRGLDF
FT                   HPSVSSVFLVQPPRDVLDFVHRAGRAGRAGRPGRVVVFGIDEGGTLGEGAKNNKGGKGQ
FT                   GPLKKDGKTALGDRLKDVLGKREVVGAMGKRVRT"
FT   mat_peptide     join(complement(32687..33392),complement(31729..32636))
FT                   /gene_name="MRH4"
FT                   /locus_tag="CNC00100"
FT                   /product="ATP-dependent RNA helicase MRH4, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KLB2 "
FT   transit_peptide complement(33393..33431)
FT                   /gene_name="MRH4"
FT                   /locus_tag="CNC00100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KLB2 "
FT   CDS_pept        join(34950..35155,35246..35344,35402..35465,35543..35633,
FT                   35683..35843,35898..35967,36212..36329,36385..36466,
FT                   36525..36527)
FT                   /codon_start=1
FT                   /gene_family="HOG000160635" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804373"
FT                   /locus_tag="CNC00110"
FT                   /product="Fatty acid elongase, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42062.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG055438"
FT                   /db_xref="HOGENOM:HBG331215"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniParc:UPI000042DE1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB1"
FT                   /transl_table=1
FT                   /translation="MFPFDAWTPGPGPVYTAITSVWDALDLPHPALGYRTWIPGESPLS
FT                   TQKAVVAAVGTYLLIIFGGREMMKNRQPFKLKIPFQIHNVYLTLGSGLLLALMLEEIIP
FT                   LFLKHGFFWSICNTSAFTPRLVTYYMINYYFKYVELIDTVFLVLKKKPLAFLHVFHHAA
FT                   TAVLCYTQLNGETSVQWVVITLNLTVHVIMYYYYYATAGGAKIWWKKYLTTLQITQFII
FT                   DLFIVFFATYSHFAFKYGVPAVGDCAGSEGAALFGCGLLGSYLVLFIAFYKATYKKGVA
FT                   KGKGKATEIRGSSKSK"
FT   CDS_pept        join(complement(38384..38648),complement(38130..38339),
FT                   complement(37321..38090))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18941839"
FT                   /locus_tag="CNC00120"
FT                   /product="Manganese ion homeostasis-related protein,
FT                   putative"
FT                   /protein_id="AAW42066.1"
FT                   /db_xref="HOGENOM:HBG180575"
FT                   /db_xref="HOGENOM:HBG443801"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniParc:UPI000042EC08"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLB0"
FT                   /transl_table=1
FT                   /translation="MPISFSRLAIALGIASIILLPFAYASSGDRNPTFQHCLRGCAATY
FT                   CDPSQPPIAFYLRLFGWTCAENCAYHCSHSFTDKIGPGSRYHQFYGKWAFYRLGPFQEP
FT                   FSIIMSLGNLLVNLQGVSAVRRRIRSENKLRKWLVSLGFVQVNTWIWSAVFHARDKPWT
FT                   ERLDYFSATLTIAFTLLYSIIRILHFQTPLYTSRFLLPACVAVALLVLSHFKYILSFPL
FT                   GQFPYGYHTMFNLCLGLIHNLLWVLWSFSFRFPYPTLRFGRFLSLSFPYPYPPHNPYKN
FT                   PSPKESSTPAVLVGLTTLAMSLELWDFAPLFRVIDAHSLWHTATIPLTMGWWHFLMADA
FT                   LELEGSLMGQGGMGVGLLEEPIGRRRGGGPLERDADMPMTPTFQELDSGRVKLTSSSPS
FT                   PGTRMRISPKSSEFK"
FT   CDS_pept        join(38990..39229,39276..39781,39824..39881,39934..40180,
FT                   40230..40316,40369..40574,40632..40689,40773..40883,
FT                   40999..41108)
FT                   /codon_start=1
FT                   /gene_family="HOG000135977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092864"
FT                   /locus_tag="CNC00130"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42068.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG435785"
FT                   /db_xref="HOGENOM:HBG738612"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000042E383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA9"
FT                   /transl_table=1
FT                   /translation="MPSIRESRAPIEPDDVWEHSNSDPEGNHDFNNVLHIDYIEGEALE
FT                   NMSENAMLLGETSAPMEYDHRLRRGRGWVTISGFSLPKPLLYLLAVPPLLILVNLVAST
FT                   YNSARPHAHYRHPTLTNGTHPFHPTILLLSLDGFRSSYLSTHAHLLPNLLFLSSSKWGL
FT                   RAESMQPVFPTLTFPNHWSLMTGLYPSSHGIVANDFWDPLFDEKENKGAQFVYTEESKS
FT                   WDSRWWWGEPIWEVVEKVGRKAAVIMWPGPPVTRAGASPSYFVPYRNLPPSSKLSQIFA
FT                   YLDHPLPTRPEFIASYFPEIDQSAHRHGPDAPQVEEKLRMMDEMVGGLLRGLEERNLTG
FT                   VVDLLIVSDHGMTGTSNERIIYLDDILGEDGIEAIEHKDGWPSVGLRFSPTSNHSLYLS
FT                   RLLSAAEASNGTFAVYTPDTMPQRWHFTGGRRIAPIYVVPDIGWAVTDRHEHEVLFQGD
FT                   YQPRGNHGYDNKYADMQAIFFAHGPFARTLKDMGKGFISHDPPVLHSFKNLEIFSLVTR
FT                   LLSLRDVEPGHNGTIGFWEGLLD"
FT   CDS_pept        join(complement(47263..47334),complement(47142..47197),
FT                   complement(46662..47092),complement(46530..46600),
FT                   complement(46207..46473),complement(45754..46141),
FT                   complement(45448..45692))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636072"
FT                   /locus_tag="CNC00140"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42070.1"
FT                   /db_xref="HOGENOM:HBG175936"
FT                   /db_xref="InterPro:IPR019038"
FT                   /db_xref="UniParc:UPI000042D4C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA8"
FT                   /transl_table=1
FT                   /translation="MITPEEQKQVTRKLTHWIESESKIVTYRTVSREIGCHVNVAKNIL
FT                   LRHFEANPSLAATYLLTGPLLSNSVLTQTTIQSGTTSKDGKSLRDLGDGMVKIVDMDQN
FT                   SDAGDSDVEGLESQSQGQSKAQRIGLMGTDDEDERMDGVGNDRGAQVGDGGIGGGKRLG
FT                   ELGFKRERVKRWGVVLATAEALEEKKTLFDESELNIHIYALSPAPVKDPAQFLIASLEL
FT                   HDNANMYNSSIYGSITGHAFKPSAKPNPLAPAKPPIKEAAAPSIFARGPKEKMVKEQTK
FT                   KEVKKQGSTKDVKDEPLQSRSSTSATTAPAKNKAQPLNKSNSKKRVINSDTEEDEPGPA
FT                   KAKASTPTSKGGSSKTALEPTSSMVAREDKAALEAMAGMDVDFSDNEEPLAARPKAKEE
FT                   ARPLRKSATGRKVRRVKKTKREKDDKGYFVSKDYWTDESYSGESEPEQVETQPRAQPAS
FT                   KRGGSKPPMKARESASSVGSGSGAGAGGNMKKSAGKPTGGQSTLMGFFKKK"
FT   CDS_pept        join(complement(52720..52752),complement(52610..52625),
FT                   complement(52262..52393),complement(52012..52208),
FT                   complement(51545..51955),complement(51206..51489),
FT                   complement(51005..51153),complement(50835..50947))
FT                   /codon_start=1
FT                   /gene_family="HOG000072174" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15804374"
FT                   /locus_tag="CNC00160"
FT                   /product="Phosphopyruvate hydratase, putative "
FT                   /function="magnesium ion binding"
FT                   /function="phosphopyruvate hydratase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cell surface"
FT                   /cellular_component="phosphopyruvate hydratase complex "
FT                   /protein_id="AAW42072.1"
FT                   /db_xref="GO:0000015"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004634"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0009986"
FT                   /db_xref="HOGENOM:HBG410079"
FT                   /db_xref="HOGENOM:HBG726599"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniParc:UPI00004B43B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA7"
FT                   /transl_table=1
FT                   /translation="MSVVTKVHARQIFDSRGNPTVEVDLYTEKGLFRAEVPSGASTGAH
FT                   EAVELRDKGSDYMGKGVLKAVENVNKVIAPALIDSKLPVTSQKEIDDLLIKLDGTENKG
FT                   KLGANAILGVSMAVSEAAAADKGVPLYGYLAQLAGVSEPYVLPVPAFNVINGGSHAGNA
FT                   LAFQEFMLLPTGASSFTEAMKMGSETYHTLKKVITKKYGIDAANVGDEGGFAPNVSGAE
FT                   ESLDLLTEAIKQAGYTGKVQIGLDVASSEFFKEGKYDLDFKNPNSDSSKWLSGKELADL
FT                   YHGYCEKYDICSIEDPFHEDDFDAWAAYNQTAKIQIVGDDLLVTNPRRIKMAIEKKACN
FT                   ALLLKINQIGTISESIQAVQLAQSNGWGVMTSHRSGETESTYIADLAVALRTGEIKTGA
FT                   PCRSERMAKYNQLLRIEEQLEGKSIFAGGKGLSKGTTAPELHSSK"
FT   CDS_pept        join(complement(55308..55443),complement(55146..55250),
FT                   complement(55091..55099),complement(54772..55037),
FT                   complement(54592..54708),complement(54538..54542),
FT                   complement(54357..54481),complement(54134..54264),
FT                   complement(53948..54044),complement(53564..53886))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092865"
FT                   /locus_tag="CNC00170"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42074.1"
FT                   /db_xref="HOGENOM:HBG175951"
FT                   /db_xref="UniParc:UPI000042D597"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA6"
FT                   /transl_table=1
FT                   /translation="MRFTAPRPNNFALALLPAALTLLLLLYLWTVSHRPPVPEKAKIEN
FT                   PHRWGFPEWYGKGPTPYDPESGLSVEKQKSVLLFIDLPYDSLSIPKALSTLQILRNDPS
FT                   IRLSVISPFSSTWDHQSTPQENLESAGCENVDRLWRIGEYSGEVEGCEGVVWISEGMDR
FT                   RARVDGRANVILAQQPFDILRDEVSYDRLKESLGEDWELGLLSYIPPAADPSIFYPEET
FT                   PSYKSVTYFPLSSTPERKHPRMPWTGKWSKYTPSRKPPPPTKAGQDPLSPDSAYIKHWR
FT                   KEDKRRAKAMRKAGICLFEGWQDGQLDERMVEAMMAGCVVATVPPQTDYDMLKPLILPL
FT                   SPPSSSASPLSLPVKQISTLLASPRASQRLTYKALHAFLAARHHFTVQTRFERVWNVVK
FT                   GWEEGKRGYDFDEGLMGFRWDCGTVMDGDAGRPAWCKD"
FT   CDS_pept        join(complement(57102..57215),complement(56850..57022),
FT                   complement(56393..56783),complement(55801..56340),
FT                   complement(55695..55751))
FT                   /codon_start=1
FT                   /gene_family="HOG000176477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804375"
FT                   /locus_tag="CNC00180"
FT                   /product="Histone lysine N-methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAW42077.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG600017"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000042E79A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA5"
FT                   /transl_table=1
FT                   /translation="MDTPGAGPSRQSSSAPAANNKLDPNVKPGTVLLTSDLLSSFQPAK
FT                   RFKDAVLEPTSTPSGPKTHSVTTLTFDDTGDRLISAGDDNQFILWDARKGKKIKSFYSK
FT                   KYGIDHVRSTHKTGTILHASTQGGDHAVRYHSTHDNAYLAYFKGHTARVRSIDMSPADD
FT                   SFVTAGDDGTVRLWDLRANACKGLVNDVGGSAIAAMDNTGVVFAVACSDTQTIMMYATK
FT                   TADVHPFIHQGLIDIALEDISTPPPKPIFTSLHFSNNGQYLLVGTSSDVHYVLDAIYLT
FT                   PLRRLVGHVGLERDAQGNKGVEPRRGISGEELCWTADSNWVISGSANGEVVAWDLRPEP
FT                   GQSQLTRSDVAGGNWHTANPPDWTTLRIPDLKPKVVLHGDGAGSGPTRAVKFNPRYNLM
FT                   AVGGYDLTLWMPIKDEEARLAAEGW"
FT   CDS_pept        join(complement(58943..58985),complement(58863..58875),
FT                   complement(58697..58782),complement(58560..58642),
FT                   complement(58470..58496),complement(58285..58390),
FT                   complement(58204..58214),complement(58089..58142))
FT                   /codon_start=1
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636073"
FT                   /locus_tag="CNC00190"
FT                   /product="Hydrolase, putative"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW42079.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG123543"
FT                   /db_xref="HOGENOM:HBG743217"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniParc:UPI000042F031"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA4"
FT                   /transl_table=1
FT                   /translation="MASLASCIFCKIIKGEIPSMKLLETESVFAFMDVGPIARGHCLVI
FT                   PKQHAATFTELPDEAMVDILPTCKKLAAATGAENYNILQNNGRPAHQVVDHVHFHVIPK
FT                   PAEAGDKEGLVIGWPTQKDLSKDEISKIFEQMKSRL"
FT   CDS_pept        join(59405..59632,59693..59895,59975..60046,60091..60418)
FT                   /codon_start=1
FT                   /gene_family="HOG000230406" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804376"
FT                   /locus_tag="CNC00200"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAW42081.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG175962"
FT                   /db_xref="HOGENOM:HBG483709"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000042DED8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA3"
FT                   /transl_table=1
FT                   /translation="MSHSPNLTSHDPNAYRTHASFVFSAANSAPVLGLLDPKPGEKIID
FT                   LGCGTGEITIAIKEVVGQQGTVIGVDANQSMLDSAASSGPSTIRWIQADIQAAQSFSKA
FT                   HPEYEAAFDAVFTSATLHWCKDSPEGVVQLIRWLLKPGGRCGVRAALHHAIRAKGIDPV
FT                   PLDPCIHKKLQLKGLQVLQSGGLIPSNVHLVPRPTPLPTTLEGWLVTFARNSFLSSFSD
FT                   DEAKAIMKEVVGICRVDNYWSDENPGTGVKGSGEGGESGWEVLYVRLRGVGKKP"
FT   CDS_pept        join(complement(61637..62293),complement(61288..61581),
FT                   complement(60930..61229),complement(60868..60873),
FT                   complement(60480..60812))
FT                   /codon_start=1
FT                   /gene_family="HOG000219757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092866"
FT                   /locus_tag="CNC00210"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42083.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG092975"
FT                   /db_xref="HOGENOM:HBG454130"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000042C10C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA2"
FT                   /transl_table=1
FT                   /translation="MPYYAPRPAFRNGLRSATSLLPWNTPAKVHFNSLRISFYSSALMP
FT                   YSSEKNYPSFVSRPFTFSHRLSSDCSTQVGGGGDSVGMSRLPSPLFAPIPLRHFRSKGL
FT                   RNFLPRKRLFSSTPTTASLLPPSPAASDAEMMSDSEESEAVRQGKRISKELMTTSSAGG
FT                   GRYVRIVDVSPRDGLQNLKGKPVPTEVKRELVERLLEAGVRNIEVGSFVRSDWVPQMAD
FT                   TPQLLPLLPPFTGKTLSPPSPVSRSESPFSGRPSSPSIGPLIGEHLPPHAEDVHYPVLV
FT                   PNMRGLDNLIKLQEEWSSKGLPALTDEIAVFVSATEAFSQANNHAPISKVLDSLPSVIN
FT                   KAKSHRFRVRGYVSCVITCPYSGPTDPNQAVDVAERLLQMGCYEVSMGDTTGEGDPDSW
FT                   KILWDRMKDRGLDMDKIAAHCHDTFSLALSSILSLVPYGLKTIDSSLAGLGGCPYSPGA
FT                   TGNVPTEDVVYALHKMGYETSIDLDRLVESGNWLAKTLGVRNESRVGRAIWARRQRREE
FT                   IEGKGAETEDGM"
FT   CDS_pept        join(complement(65152..65189),complement(65072..65094),
FT                   complement(64669..64913),complement(64470..64604),
FT                   complement(63970..64418),complement(63781..63913),
FT                   complement(63643..63731),complement(63127..63587),
FT                   complement(62758..63062))
FT                   /codon_start=1
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804377"
FT                   /locus_tag="CNC00220"
FT                   /product="CTP synthase, putative"
FT                   /function="CTP synthase activity"
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="AAW42085.1"
FT                   /db_xref="GO:0003883"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="HOGENOM:HBG523338"
FT                   /db_xref="HOGENOM:HBG597806"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000042EC07"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA1"
FT                   /transl_table=1
FT                   /translation="MVKYILVCGGVISGIGKGVIASSTGLILKTAGLKVTSIKIDPYMN
FT                   IDAGTMAPTEHGEVYVLNDGGETDLDLGNYERYLDVSLNKDNNVTTGKVYQHVIDRERR
FT                   GDYLGKTVQIVPHLTNAIQDWVERVSKVPVDETGEEPDVCIIELGGTVGDIESMPFIEA
FT                   MRQFQFRVGHENFALVYVSLIPVVGGEQKTKPTQAGVRDLRGLGLLPDLIACRCTEKLL
FT                   TATMEKVSMFCHVSPRQVLGVHNVSSTYHVPLLLQEQGMLKFLWERLSLSSINMRPELK
FT                   ARGEKIMEKWQVLTTGLERCFETVEIVLVGKYITLEDSYMSVVKSLEHAAMRCGRKLIL
FT                   HWVDSSDLELTMQTENPIKFHNAWQAVCSARGIIVPGGFGLRGTEGMIAAAKWAREQNI
FT                   PYLGICLGFQVAVIEWARHVCGLEKANSAELVPDSPHPVICFMPEISKTHMGGTMRLGL
FT                   RPTIFEPNTEKSKLRRLYGSRNIAWERHRHRYEVEPKYVEQLEAPGGMRFIGKDERGER
FT                   MQMLELDDHPYFVGLQAHPEFCSRPLNPSPPFVGLIAAACGLDVLEEQLANNEKNYVDP
FT                   HPESDKVIPESEAATQAGKGKSQSVEGVRVKHEDVVDALGKKLDEVAEI"
FT   CDS_pept        join(complement(66669..66704),complement(66568..66595),
FT                   complement(66422..66462),complement(66251..66363),
FT                   complement(66042..66164),complement(65944..65977))
FT                   /codon_start=1
FT                   /gene_family="HOG000214661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804378"
FT                   /locus_tag="CNC00230"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42087.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG381817"
FT                   /db_xref="HOGENOM:HBG599090"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniParc:UPI00004B43B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KLA0"
FT                   /transl_table=1
FT                   /translation="MAAVLLFTMVFFIIMFSDLECDYINPIDLCNKLNQFVLPEMIAHA
FT                   FLTLCFLLSGQWLAFLLNAPLVAYNVNKIMSKNHMYDATEIFRTLSGHKKESFIKLGFY
FT                   LISFFYYLYRMILALISESD"
FT   CDS_pept        join(67161..67324,67391..67659,67728..67936)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18941840"
FT                   /gene_name="NOP16"
FT                   /locus_tag="CNC00240"
FT                   /product="Nucleolar protein 16 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAW42089.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG175985"
FT                   /db_xref="HOGENOM:HBG396451"
FT                   /db_xref="InterPro:IPR019002"
FT                   /db_xref="UniParc:UPI00004301D2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL99"
FT                   /transl_table=1
FT                   /translation="MANPRQRNKAKSSRTQKPSLNAKRRMHQKLRKAPPLKGPEVLQEK
FT                   WDKKKTVFQNYAALGLLPSIPVSKGASTSRSQRVKLPEVPAEAEAQNVKVGFGRIIRDE
FT                   EGNVIDIIIDEDEEKQEEEQIEVDEEKELEPVEAKTEVVKRLEELAASAAPVKRHSSMS
FT                   ERTWLQQLVDKYGDDTERMARDRKLNVWQKTEGEIKRMIKKAGGVQMLRK"
FT   CDS_pept        join(complement(73938..74322),complement(71893..73884),
FT                   complement(71313..71836),complement(70228..71265),
FT                   complement(69167..70172),complement(68534..69039),
FT                   complement(68334..68465))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092867"
FT                   /locus_tag="CNC00250"
FT                   /product="Putative uncharacterized protein "
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /function="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="AAW42091.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0008835"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG175991"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000042CBEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL98"
FT                   /transl_table=1
FT                   /translation="MPNISESIDSVMEGVKGLVNMAEGYLAPASDEGEASVPPPRPQSQ
FT                   PLHIPSTHRNTTSKFALPQQSQLVQTIDVPSGWIHLQAAYLDGDGGQRQVRPFGLRNLT
FT                   EEEVEVEVESDLKQLLFWASDDEKSIPSSASSTSSLSTNAGLPSLQITIPASSTVTLFI
FT                   AFQPTVSLPPFPLNPLPPTGTIDDGGYTPRVKPILSRTNSFELSPVGLSVSDSTESGQS
FT                   LQSVAGNIRETHVAKRPEPIHRAFSVHGSVSIQAITATSHQSIALPFFATVCRSVFTAG
FT                   PIEPVSGLVTGSQQSSGDLVVDFGSENVMGKKYHRDILLVNRSEIELVWTTHVVSAPHK
FT                   DSVWFELRDLDSENVFGVDHSSQPVPLPALSSRHLRLSLRSKAPVNDFEFSFLLSNSNQ
FT                   AGNIVTCKAIGSILPTTADDSLKILSGPTLDFGEITDKVWARQTISVRNVGDRTLDVRF
FT                   GKSEGVEVVFRLAGVAGEDVDEDLPIERSMGISSAKEKGLGLSRTSTREVAYPADHPHV
FT                   HSTSLEQGKDEGGNENTEKWKEREMSQSGGSRPLSRITSRTSSSHQGPYHLEGFESESE
FT                   DVEAPFFGGGGGGGGTGSGGQDGQLSLLGSHPRVMASPTIPAPTEQQVIPNQIEEITMR
FT                   PGTEYRISVLHRPASLGPSAAPEIAGTLRKSSFKIYLDSIPSSLRSSHATHTSTRRTIS
FT                   ATVSSCTSLIRLVSGNVVDFGQVTVGASKSTTIKIENLSELSTKVEIAAMSKVLSVNKS
FT                   VIVIPPKEVVEEKMEFFPRRINEKYEKQIFIRNLLNRANDQLVEIKSRNVDVYNLTLHS
FT                   HLYRILTPSGSNFLDFGSVVINSPTVRIINIENLSRAPLVLDLSASQPEDIELFVKAED
FT                   SSAAKALASGKYAEEAQSSSHGGERPGGTGELKERFMEELNEKSSNGGSIKSKKGREKN
FT                   GGRAKEENGEEIGGKKGSIAASVATALKKGSRGKPVQLYGNSVVFKDRSLLEPHEYLDL
FT                   ASGPPVAAHRSSPHSKRTQLLESIELEDKSKLSGQHPKVPKLDFAAGAKATGAVGKEGK
FT                   KRRQAQEHSHHHTQHHSHPSQARTAPGTGQHTPKTPDKTKPHLGSFALINRLLPQVTDG
FT                   GLKSPALTAKRIEPPLDNPPAAPTDPSKMTPDQLLLAIEQHDAKKSSMTHTTLEEEEAF
FT                   VRRTIALRKELQNLIANNRLIPAQTLRVAPGASRSLIVIMTPNSSIRPHISTRAKRADS
FT                   RIFIKLLEFDKSLLNSARSGPGITPGPGSRKQLGGDQDMEVLEGVELPIRDLIIRSSCV
FT                   RSVLEVQQSSINFGACDKGEVKSKTIVIHNKSDCIGLFRLRTSGSIASGDLKLGLGRYG
FT                   VISAFGRKQFDNFSFTPSLVGNYQENITIENVLDSWNDQPLAVKATVRKVPTFKVDPLS
FT                   LDFGVVEKSTRKPETKGFVITNVSKHERTFVISVQDLVPNSFAEIHLIQDEKDAGTALS
FT                   RVEEEELEALLQKLKIARRKGKAEKIAKYETRLLELGVPKPQLNAGAEGEVGKDGQEEE
FT                   SSASVAGKVIAEIASSVLTTLKDTKADLPKECITKLNLTLAPKQKSNILVDLIPRNPSS
FT                   SADDGQKDESSIDVSASITIHDRKNTDETVSVNVMASRMAKPVRSRTMDTSNSSGQEDM
FT                   DGHVTPSATSISPTAFCVGSTLFLPSSSSYYPPLKSHFDAFPQSVVGEPKGLILADGWS
FT                   RQIPGNTHAEANALTNFKTKYADILSDDDGDDEGQREGEGFIEGRGYEQREGSSGVEDK
FT                   VEGEESGSTVSSKEVIQLPPIDMVLKDAICFATMEPCSYRTSGGPSCALELVRAGVKAV
FT                   YLGVEEPPDFVECEGVRILQDGGVRVVRVVGLEEDCLKAARRGRT"
FT   CDS_pept        join(75579..75752,75809..75903,75990..76107,76158..76250,
FT                   76308..77390,77436..78092,78147..78269,78327..79085)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092868"
FT                   /locus_tag="CNC00260"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW42093.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG175999"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000042F788"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL97"
FT                   /transl_table=1
FT                   /translation="MPRKALPPVAVAPVDALRPPPPPSPIVQTLRKDWRWAAISQFIAT
FT                   FSDAFGLLDWDIEVLEKDFDGDETALIPTLVAKLLFALTYNRQINSENAFEQLRKQYLK
FT                   RAPETTLLGTVEEPVEWAALGLSQKVGILHQLCEWQMDDPARFRGLLKTEDDAVSWRIE
FT                   PVGWDKSGNIYWLFDDNRLWIQRTPPLPPAPPKKSSLKAKRALKRARNNINNTSKSNSK
FT                   FKAKPAPKPKPKTKPSTSTPRPKGPPVKREPTPPPEEISGSRRRAPVAFYGNPTPTALA
FT                   LKRGAVFPPASGGTPTNGRATRSSARISGVNGNSTDQSTAIGATPSKTAKKTQLPLGTR
FT                   VSRRLRNVDDEWQQVPDEWLDGAKEDHADTEDASDGEKEEEGDDDESELSDLTDEEEHA
FT                   AEVEAVKARESQENGQPKKNRRKAVKEEVEEKVEEVADADSPLSELPEPDPEPIVEQDD
FT                   EEDEYNPDEDVEQDDAMDVDETEPKQEEEEDDAEEDGEEEEDIIKAAIKEANNLPEGFI
FT                   EWETVCVTLYDWRTFPEQFAKSKHPDEKALYKLLHDQVGPTIIEQLTEKEKERLKQEAF
FT                   LNRKRSSRIATKELEKEEAVRREQAQREMEERMERTRKEEMRKAKEEAEALAREKARED
FT                   RLKEREERAQAREEAALRKAEEEQKAKEKEERRREKRKRRREGEIVSDDSEDESSQAPS
FT                   RRSRTMTPSHMGETTNQKSKVGAGKAVAGNRWELGCEVCGMHGWNIDGDKDLVSCDECG
FT                   KWQHVECLDRLDRSQGRVRRNWSKVDFTCKECQQRAANKRLRIESLTHANSRPIPVIPS
FT                   PLAPRPTPPHPYPHPRPHSAHQQQQSPPYPILPGSAPGPQPLLNPSRPPPPPLQAGQYY
FT                   LPYPPESRSPAQPAGYAVYYPPGDPRHDTTAPQPHHQHQPHQERRISGQGNNRRASAEG
FT                   YAPSPTGVTPGYASPHVQAHAYPTAPQYSSLAPSPSSGAAYPPTAYSHPQIQTQAPRPI
FT                   QVHQAHLMPSHLPTTARYPHQPQMQAGAVGHVPPDPRLQDTRQQ"
FT   CDS_pept        join(complement(81393..81641),complement(81294..81334),
FT                   complement(80568..81240),complement(79556..80521))
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804379"
FT                   /locus_tag="CNC00270"
FT                   /product="Multiple drug resistance protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42095.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042EC06"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL96"
FT                   /transl_table=1
FT                   /translation="MSIVSDVTQVDGRTRSKFTADDKPLSSYTLKKYPWRPYVTPFEEI
FT                   IGKKYPGSGTNEDPYIVDWLSNDKEDPQSWPGTYKWFTIFIVSSMTLAVALSSSAYSGG
FT                   IESLIKELGASRELLIAGISLFVVGFAFGPLFWAPLSEVFGRRYIYIASYALLTLWSGA
FT                   AAGAPNVGALLVFRFLAGFFGSSPLANAGGTISDVLDANQRGLGMAFFSAAPFLGPSLG
FT                   PITGGFLGLTSGWRWVEGFLTIFCGVLFIIGIVFCGETYAPVILRARAKRLSQVTGDVY
FT                   RFRADAKKPLNVTSMFRMSLIRPWKFLFLEPIVTILSLYTALIYGILYLFFAAYPIIFQ
FT                   SGHGWNTGVGGLAFLGVLVGTVLSVLLSIFISNPQYIKVAKKKGGRADPEDRLPPAMWG
FT                   GVLIVIGLAGTAATDGPDIHWIAPIIFGVPFGCGIIVVFLSILGYLVDSYTIYAASVLA
FT                   ANSVLRSLFGAAFPLFTVQMFDKMGVHWGVALPGFLSLACIPATWVFYKYGAAIRAKCK
FT                   YSADAERQMAMIMAARMAQSKQEDEEARAEGKEVIYPVGSRPESEVQDVQPAEQEGGLG
FT                   KVVSRAGEYTGPHSNGGAPLARVPTHLHHEWTIYEALADRDENDLQDDERIKLQDMHTK
FT                   FDNKLRK"
FT   CDS_pept        join(complement(86740..86961),complement(86535..86689),
FT                   complement(85930..86488),complement(84908..85882))
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788711"
FT                   /locus_tag="CNC00290"
FT                   /product="Multiple drug resistance protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42098.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042CB37"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL95"
FT                   /transl_table=1
FT                   /translation="MYTTSDSTQASDGKPLSSYTLRRYPWRPYVVPFDDIVGKKYPGSG
FT                   TNEDPYIVDWLPNDKEDPQQWPGTYKWFTIFIASMMTLAVALSSSAYSGGVISIMEDFG
FT                   SSRELLIAGISLFVLGFAFGPLLWAPLSELYGRRWIYIISYALLTLWSGAAAGAPNVGA
FT                   LLVFRFFAGFFGSSPLANAGGTISDVLDANQRGLGMALFAAAPFLGPALGPITGGFLGL
FT                   TSGWRWIEGFLTILSGVLFLVGIGFASETYAPTILRRRAKRLSRVTGDVYRFRADAKKP
FT                   LDAMALFKASLIRPWKFLFLEPIVTILSIYVALLYGILYLFFAAYPIIFQEGRGWNTGV
FT                   GGLAFLGVLVGTIISVAVSILVVNPQYVKVANKKGGRAAPEDRLPPALWGGILIVIGLA
FT                   GTAATDGPNVHWIAPIIFGAPFGCGIIIVFLSIMGYLVDSYTIYAASVLAANSVLRSLF
FT                   GAAFPLFTTQMFDKLGLHWGVALPGFLSLACVPFTWIFYKYGAAIRAKCKYSADAERQM
FT                   EMIMAARMAQSKQEDEEARAEGKEVIYRAASRPEGDESQDVQPSEQTGGLGRSQSKRSQ
FT                   HSASAGQSGNGAPLDRVSTHLHHEWTVYEALANRDENDLDDDERIRLEGLRRTFGDRSE
FT                   K"
FT   CDS_pept        join(complement(91759..92107),complement(91538..91709),
FT                   complement(91423..91489),complement(91068..91370),
FT                   complement(90502..91016),complement(90169..90450),
FT                   complement(89791..89862),complement(89672..89739),
FT                   complement(89387..89616),complement(89170..89330),
FT                   complement(88631..89114),complement(88519..88577),
FT                   complement(88353..88449))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092869"
FT                   /locus_tag="CNC00300"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42100.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067694"
FT                   /db_xref="HOGENOM:HBG176014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="UniParc:UPI00004B43B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL94"
FT                   /transl_table=1
FT                   /translation="MDPYSVDYTRHSQYQQYNPVRIAPGLEASSSRTASTSDIYGRGNS
FT                   AYSSSWTGASPVDERPARKLDRPWEHENDIKGLSQPQASAQQPPQQQQSLQPSVFPSSG
FT                   PTAKRGSRACMACRRGKNRCEWDPAGKETSCRRCLMNGTQCVFEKPAEKNGTRARTNSS
FT                   AVADHPNEAENRITSLEKMVETLSSGQTQMQTTLQQILTLLPQTQSLLTPTGHPSFLSH
FT                   NTPSTGVPPSTIFASVSPPQTFHDGAGMSSVRDHAQSDRPRSPQNTASGRGISNSTMNR
FT                   VKSVKEFPPLPGFAPPNHRFGTYGIIPLPSAPPSPSRSRHSSRSSSSSRSRDEYSSALP
FT                   HETLTAPIQALQALANAADQAAALVDKDDEGEKGKSTSQEVRSDGSDEDSRRGEGEAKG
FT                   GAERQWKLNGEDDEDRGRSRKRKRVTIDGQNIHLRVRKKTRPDPTPRNPFPDVVTKGLV
FT                   SEKEARELWDIFFSGCHYFVPLWDKSYDTFETYIERTPFSTNGLLAVAAKIRAGNGPVD
FT                   ETFHRCLEEAQGIARSTLFGPIVRKEAVMAMLILSLWSQNGWLPCGVSLGTGKPILLRD
FT                   DSSVRKARELLDHPMASDTDVRLIAGVELVNIRITILEHLTPLHGSTDAPTISFVKSKL
FT                   AELQAWHQEWYCIHKRRYDDESVVVKLLETERVYAELWTVCMALRGCSWDKLSHEQKEL
FT                   AFHAKDCAWRCLEIFLRSDNFRKHLKYATHDQLVSVAFAAVFLLKVAILYPTSLSIPLL
FT                   VSQVSELAHCLSAECFAERYALTLRLMLSNFRRTTGAMSTIPGTPRTAASAAAGAVHGL
FT                   SGLSMTALNVNGQLNDVEGSFQNFLSLPQMENHNMEVGGEGENASNGMGATGFTGTEGD
FT                   GGLWGMMGLEGFDWPTELSPSSLPVWLQDGNATDLGLPVDGSDSLFLPVELANMFMPSN
FT                   SQTSGLYQFTLPDSGDVGTEAW"
FT   CDS_pept        join(92733..92771,92831..93003,93065..93189,93251..93258)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804380"
FT                   /locus_tag="CNC00310"
FT                   /product="Hmp1 protein, putative"
FT                   /protein_id="AAW42102.1"
FT                   /db_xref="HOGENOM:HBG176021"
FT                   /db_xref="HOGENOM:HBG736867"
FT                   /db_xref="UniParc:UPI000042DA64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL93"
FT                   /transl_table=1
FT                   /translation="MSNPNEPSKTNGQLNSLIGTGKTLVGNAIETAYSTVGGSTESSSW
FT                   TTAGQKQHDKGEAEISAAKTQGYVEGVGDRLEGKKDSVVGAITGDKTQQASGNVQHDKG
FT                   ETQMDINKSS"
FT   CDS_pept        complement(93645..95117)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804381"
FT                   /locus_tag="CNC00320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42533.1"
FT                   /db_xref="HOGENOM:HBG067693"
FT                   /db_xref="HOGENOM:HBG176026"
FT                   /db_xref="UniParc:UPI00004B43BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL92"
FT                   /transl_table=1
FT                   /translation="MPGAAGLSQSHHRSVSLPFSSLGKRRLPFEYRSESEDAEVKRVRH
FT                   SGRGEPSTSASVTGRVSNETSGQPRAPSSRKAPSSFPPDFFAPPPAAGSSSTSASRPVS
FT                   ILPRTPSPSRQGVIPDNSQTPRLPLEWRAPEFGSRTGTPLRTPFINERTPEFATTPEPP
FT                   IMSMSPSLEGTALGSRLTPGRTLLSLHGSTPDRSDEDIQAEASTSTPTSGQAPSRTGEG
FT                   ISLSAVTELERIDEGEELAPSPPVQHMSPAGQLRFPVVKPHPGLGVGVTGSPSSGSPKL
FT                   VRRSISQPNQSTTPSLLGQHSLLAPPALISRGSRAGSERPAVPSRAFTQSPPPRPRSAS
FT                   AMYRSSYGRSVSASSSRHASPLPSTIIPTEVAPQVRSASADYMRIAMFGLEGASLDSID
FT                   YADDPLQTDTLPDVTEDPAAEEREAGPSAGTGTSAGVTAERRRWRKVDEVVTPGHRTLL
FT                   GTERYNDTRFGDIPVGMWAQPKIDFGTPGGPF"
FT   CDS_pept        join(complement(99904..99926),complement(99690..99843),
FT                   complement(99562..99635),complement(99334..99505))
FT                   /codon_start=1
FT                   /gene_family="HOG000216641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804382"
FT                   /locus_tag="CNC00330"
FT                   /product="Bud site selection-related protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42104.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG065685"
FT                   /db_xref="HOGENOM:HBG345213"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000042CBE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL91"
FT                   /transl_table=1
FT                   /translation="MGRLRRSRTHHARRDVHRAARTRARVKDLDQIETDLRPQNRNRLE
FT                   KQPIDEDKPGLGQHYCVECSKYCETAVALQSHLKSKVHKRRLKELKEGAYTVDESERAA
FT                   GLGTDNKQRGVEDVIKRFDGINSSAAGPSIVAQPQA"
FT   CDS_pept        join(100632..100675,100740..100982,101043..101483,
FT                   101552..101819)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804383"
FT                   /locus_tag="CNC00340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42106.1"
FT                   /db_xref="HOGENOM:HBG176035"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniParc:UPI000042F34E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL90"
FT                   /transl_table=1
FT                   /translation="MCVTFFTLSQPGYKLILAFNRDEFLDRPTLPAHWHDFNSPSPLTP
FT                   TLYKFNNFTDPCSRENKESDDGGRVLSGLDRGKAEGGTWLGISKDLKVALLTNIARIRP
FT                   APGVQPLSPPPSRGKLLREFLSPSPLTSSQLETQSYISSHFPTAGDYEGFNLLLFSLSP
FT                   ERNIGYLTNRPSPSSLDLTSSLCGGEDGQRRCVGLSNSPLDEKWPKVQQGEKNMEKSLR
FT                   EWEEKREGEDRLVERMFRVLSPSRPITCDDDLTLSTTIPPIKLGEDLFLNTDPQNTRAR
FT                   WKGTRTATVIIVKDSGETTYVERDIWMIDEDGEPKKGEDERRFKFVGEEK"
FT   CDS_pept        join(complement(102856..102883),complement(102231..102582),
FT                   complement(102105..102174),complement(102034..102048))
FT                   /codon_start=1
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19788712"
FT                   /locus_tag="CNC00350"
FT                   /product="Ribosomal protein, putative "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42108.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="HOGENOM:HBG532383"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI000042C1CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL89"
FT                   /transl_table=1
FT                   /translation="MAPSKTAGKAAAKPQDVKAKAAKKAALKGTQSTSVRKVRTSVTFH
FT                   RPSTLRLPRAPKYPRKSVHHLPRMDQFRTIQHPLNTESAMKKIEEHNTLVFIVDIKANK
FT                   RNIKDAVKKLYDVEAAKVNTLIRPDGRKKAYVRLTADFDALEVANKIGFI"
FT   CDS_pept        join(104928..104930,105132..105153,105490..105807,
FT                   105858..106000,106051..106576,106633..107279)
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15804384"
FT                   /locus_tag="CNC00360"
FT                   /product="Protein phosphatase type 2C, putative "
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAW42111.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000042F714"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL88"
FT                   /transl_table=1
FT                   /translation="MGQTLSEPMTEKHTTDVVRGKQFWVGLSDMQGWRISMEDAHSVHL
FT                   YLPPSSDDSKPHSPASDVPAQPEGSTVTNHNEPEVANAMFGVFDGHGGQTVAKFAGTTL
FT                   HSRLSALDAYKSGDYITALTQAFIKTDEDLRADPSFLNDPSGCTAVVGLITTDGRIIVA
FT                   NSGDSRSVLGYQGQAKALSNDHKPTNEEETARITAAGGFVEFGRVNGNLALSRAMGDFE
FT                   FKQNFSLAPEKQIVTVVPEIITHELDGEEEFLVLACDGIWDCLTSQQVIDFTRRAIANG
FT                   DPLGKICENMMVKCLAKDSSTGGIGCDNMTVVIVALLNGRTPEEWQAWVKERVEQKVGH
FT                   DTPESIPDVFPQNSGPSNSGFAGSGFRVAGGAGGLANIASILGASGITFRPAYDSDDDD
FT                   DGIQLMGDGPVSPDKLSSPGLIDNEAVEGGTKPKDVTGQLEKEEEETMFGGEGKKGSVR
FT                   LLDEDGDSSMDSDDSDSTTTGNDPAPQPIPSSSHQATHSPIPPNFSSIGSPTVPTPQEL
FT                   QGLQASNRSEPQGDAYSDAVKVEGLMDKSESPLNL"
FT   CDS_pept        join(complement(110120..110389),complement(109964..110065),
FT                   complement(109898..109913),complement(109753..109844),
FT                   complement(109612..109676),complement(109498..109553),
FT                   complement(109323..109438),complement(108932..109251),
FT                   complement(108624..108878),complement(108442..108538),
FT                   complement(108351..108372),complement(108119..108282))
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804385"
FT                   /locus_tag="CNC00370"
FT                   /product="Polyamine transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42113.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG332061"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042C5F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL87"
FT                   /transl_table=1
FT                   /translation="MTEKNERQTAKPQDVEHFDESQHHNMAFEDFGLTKEQNQLLIDNY
FT                   AYMWKKDDSGNLLIRSAKGDPTNPRSWPNWKRYAIVGLASLLNNLVCLCVSGYSTGIAQ
FT                   MEEEMGFSSEVGTVGLSLYVLGFAIGPMLLAPLSEYWGRRPVYLVSWTIFTIFQIPLAL
FT                   AQNVATILVCRFIQGLAGSTPLANTGGVVHDVFAVKEAGYAVAIYALSSADGPPLGNVI
FT                   SGFLAQNAGFRWLFWAYLIIFGFFLIVIFFCLPETRSTIILSRKSSKLREATDLPFYGE
FT                   HELAKKAPGHLWKVTIFRPFKFLFTERITYLCAGINGFVYGMIFLSNEAFPLVFGPGNN
FT                   GHGWTHSGVVNLTFGAYVVGSFLGFCLTPLQEAWYRKASKAKGRGDPEARWWSALWATP
FT                   FMPLGLMVAAWTSYPDLPWIAPIIGFTMFGFGYIILAAILNYVVDGYAHYSASALGGVV
FT                   FVRNIIGAVFPLFSSQMFKGMGNQWALFLLSMVSFLMIPIPVYLYYRGKVVRDRSPYCA
FT                   MHYNDEE"
FT   CDS_pept        join(111914..112028,112094..112231,112659..112877,
FT                   112963..113151,113280..113506)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804386"
FT                   /locus_tag="CNC00380"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42021.1"
FT                   /db_xref="HOGENOM:HBG067692"
FT                   /db_xref="HOGENOM:HBG176058"
FT                   /db_xref="UniParc:UPI00004B43BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL86"
FT                   /transl_table=1
FT                   /translation="MDGALDVLDLERRVLIEVAETVEKEMWEVDFWIGKKVEVRISEEK
FT                   AKKMDEWYNKWLKARAAGKYKHLKPEWKWIGDAKEAQKVRQAANVTPPPSFSGENYLDT
FT                   TYTMEEGPYLIATTHAGIVLGLSHEVAVKKGILEKKDVFGNVDDSYVQPAAKRWLSEYC
FT                   KNSFTNWGEEAPGEGAMRFWSGIMCATKDTLPLVGQVPSEQVPEGKNEGLYIAAGYHGH
FT                   GMARIALTTKYVVKLATTGEWDEGMPESFKISQNRLERGRTAPPYITAVDKIGGATSKI
FT                   LNAVGIGGVQSVCR"
FT   CDS_pept        join(complement(115191..115251),complement(114664..114755),
FT                   complement(114365..114408),complement(114104..114195),
FT                   complement(113990..114006))
FT                   /codon_start=1
FT                   /gene_family="HOG000207495" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804387"
FT                   /locus_tag="CNC00390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42022.1"
FT                   /db_xref="HOGENOM:HBG073579"
FT                   /db_xref="HOGENOM:HBG436396"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI000042F40C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL85"
FT                   /transl_table=1
FT                   /translation="MSERGSNPPEEKPKAEEPAADPNTLNIKITNTNNEEVFFKIKRTT
FT                   KLNKLKSAYADRVGTDVASIRLLFDGHRILDHQTANDLDLEDGDAIEVQLEQVGGY"
FT   CDS_pept        join(116053..116124,116182..116195,116260..116593,
FT                   116680..116952)
FT                   /codon_start=1
FT                   /gene_family="HOG000032567" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18941841"
FT                   /locus_tag="CNC00400"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="ATP binding"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAW42023.1"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG051536"
FT                   /db_xref="HOGENOM:HBG335815"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="UniParc:UPI000042C10B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL84"
FT                   /transl_table=1
FT                   /translation="MSSKPQQELAVPTHLPDPVLIIVMGPASCGKSTVGQDVADHFHIP
FT                   FIDGDSLHPKSNIAKMSSGTPLTDEDRLPWLALIRSTAEKMCKEQSDEIAGKTRSEEDG
FT                   GLGRAGVVIACSALKKWYRDILRGVVKADPPPAEDLNDALPDDAQVPATASLKTYFVYC
FT                   YGTPELLKQRIASRKGHFFGQQMLDSQLAVLEDPSEEEGVTVANIDGTKEEVGERAVNG
FT                   MKKLLGIN"
FT   CDS_pept        join(118050..118076,118273..118299,118370..118401,
FT                   118485..118515,118567..118667,118745..118933,
FT                   119003..119138,119209..119398,119474..119630,
FT                   119693..119875,119948..120275)
FT                   /codon_start=1
FT                   /gene_family="HOG000209193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804388"
FT                   /locus_tag="CNC00410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42024.1"
FT                   /db_xref="HOGENOM:HBG176078"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniParc:UPI000042EB2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL83"
FT                   /transl_table=1
FT                   /translation="MSCPSDNSTAVDDEFWSSDGIHWDAHRIGWAVAGGCAILTVLITL
FT                   FTLTMHATRYKHPPAQRQVMRVLLMPPVYAVVSFFSYRYYKSYEYYILAETAYEAITLS
FT                   AFLMLLMELVSMGTIDLQIKSVLAEKDKMKFPFPFGFWRFRASKPYFWHALSFSVMQYV
FT                   VLRPLISIIGIICEYYGVLCPEEYSIHFAEVYLDAVDFVSISVALYGLIVFYVLCKDEL
FT                   KGKKPLNKFLAIKLIVFFTFYQSFLFSILQSHGVIKGTAMWTATNVSDGLSALCTCVEM
FT                   VFFSVYMGWAYNWTDYTDPEKNPYQRDTNFRTYLQAIWDTINLSDFCSEIYLACKFFVD
FT                   YARGKPGTRSGATKLQKTFMPHTIPEESQEMGMIASYNAGGGYDNEYEQDKHKLQNNTK
FT                   GGTIFSSSKPSGLLEDNDSGDDTYAPIRSPEGTAYSRVREGHGRDESAFEPWPQERPTG
FT                   QEAHRHQF"
FT   CDS_pept        join(121623..121771,121861..121921,121987..122430,
FT                   122481..122653,122700..123306)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804389"
FT                   /locus_tag="CNC00420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42025.1"
FT                   /db_xref="HOGENOM:HBG176086"
FT                   /db_xref="UniParc:UPI000042FE4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL82"
FT                   /transl_table=1
FT                   /translation="MPPPGVFTFDQSSDESPELLPRDALPETEHIPEVSMVEESTVTGV
FT                   TFTPELWMQRRQWALQTLRKEGVRSVLDLGCGPGALLETLVMPASTICEPPIREKPSET
FT                   RHAEDEEEDFDHEDELFIGRLAGIDANPEVMNPALSVLSPHSETSTFPPPRPRWEPITT
FT                   ELWLGGLEKYNARLEGYEAITALEVIEHLDPNVLSRFGVVTLGTYRPRIMLISTPNFDF
FT                   NAKFPQANGDCFAKKGFVDPTGRTDRVFRHSDHKIEMTGAEFRNWAETAAADWGYDVEV
FT                   SGVGSSSIPSFYPSDDITKPPRPIYASQTAIFRIATGMPLRSPRSVRTMQLPFTPSSKE
FT                   SSHPHKLAGRFTLPATAPGIGQRSSPEEVRVKVREFFTGSSVNEVSLEELWGVLDIAGA
FT                   CGGSKRWLVGSLGGYGDCPALDANDEDELEFEVKKVKGVGLSVQWREWTPRAEEKPRSW
FT                   GTPVQNESEHTSPAAAQGW"
FT   CDS_pept        join(124260..125028,125085..125266,125323..125366,
FT                   125427..125454)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788713"
FT                   /locus_tag="CNC00430"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42026.1"
FT                   /db_xref="HOGENOM:HBG176090"
FT                   /db_xref="UniParc:UPI000042CBE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL81"
FT                   /transl_table=1
FT                   /translation="MPPSLVLFTTSQTPLAVRYPHPRKPILTVPPLLHRSLHNALDRDQ
FT                   PSAAFVVNAGDAGGVAQGTLYIPNLEELAKPSPLPVANGHAAPELVHDNIELTVKVHLI
FT                   VSPTSTSPASARAEWVSEALQVFRKAKRLPLPDNLLIGFKGIDYRGIKTATGAEASVTP
FT                   NTEIVPAELEEEVLKVWERVFAERGKLVKENGKLGSLYAPQGLLKKLTEREGEGRVKVN
FT                   ALDTPDCHHLPKDYTGYARKNGVELWAGGGGEGSDPLPSTHLQNVLQEFLPAIRKIIPE
FT                   QQAKEFNKLDNPIPLRQDGLKFEDVETGVQVRWVLSYTVLSTTRNVVEDKGYIVAADLV
FT                   "
FT   CDS_pept        join(complement(126538..126605),complement(126450..126478),
FT                   complement(125733..126142))
FT                   /codon_start=1
FT                   /gene_family="HOG000034252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804390"
FT                   /locus_tag="CNC00440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42027.1"
FT                   /db_xref="HOGENOM:HBG176096"
FT                   /db_xref="HOGENOM:HBG684073"
FT                   /db_xref="UniParc:UPI000042FE4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL80"
FT                   /transl_table=1
FT                   /translation="MTTSAYSDLIGRAEKLVKAHMAKYDPSHDWAHDKYAKPGSPTLPD
FT                   LLFPILQLQIPDETIDRILSIIPAVSYTAETALLAAGKWTWQKDCLELHAVQDADRLDA
FT                   IGAVGILRCAAYSGATKRVLVEDEDTGGKSAEAHFEEKLLKVKDRMKTAFGKEEAERRH
FT                   QTVGI"
FT   CDS_pept        join(complement(129072..129079),complement(128144..128909))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804391"
FT                   /locus_tag="CNC00450"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW42028.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG176103"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="UniParc:UPI00004B43BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL79"
FT                   /transl_table=1
FT                   /translation="MAIRPESQAIIFCKSKDQPETISQILKRAGQRATWYNSEAGDRDQ
FT                   VRKFFGPGHAQGESQIDFLCSTSGLGAGVNMPNIDVVYFLGDPWDLFEVIQGGGRGGRL
FT                   GHLFKVCVFSGSFNTAVFYTPNGNRLLKEWMQHNVCRRLTIGSYMDGTEATCLTLNAGQ
FT                   CDLCVQSVPFKRGHQPTYSPLPRDPPLTSRLIQNSWFLLLDQAHPLFHQTVSAPCHEQD
FT                   HLVAKNQVVIWENFIIRFNAQVVIPVTVVPTCPRD"
FT   CDS_pept        join(130507..130602,130736..130860,130965..131079,
FT                   131150..131266,131333..131437,131490..131589,
FT                   131641..132191,132244..132339)
FT                   /codon_start=1
FT                   /gene_family="HOG000234736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18092870"
FT                   /gene_name="DDI1"
FT                   /locus_tag="CNC00460"
FT                   /product="DNA damage-inducible protein 1 "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="protein transport"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42029.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG373792"
FT                   /db_xref="HOGENOM:HBG737457"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000042F713"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL78"
FT                   /transl_table=1
FT                   /translation="MRLTIIAPDSVHEHEVSPSLLIQDIINIVEATADLPPAVIVLTSD
FT                   AGTPLTDPTRTLESYGLNGETATIFLTPTGPPVASSSSIPFPDADADIERMRLQALGNP
FT                   SLMNDLRERDPETFAAIQGGTQSFKKALQLAQSRQRDAEFEKQRQIEALNADPYDIEAQ
FT                   KKIEEAIRMEAVLENMQHAMEYSPESFGNVTMLYINVEVNGHPVKAFVDSGAQTTIISP
FT                   ECAEQCGIMRLLDTRFAGMAEGVGTARILGRIHSAQIKLGSLYLPCAFSVLEGRSVDLL
FT                   FGLDMLKRHQCCIDLSTNTLRINNTEVPFLSEHELPDKARRRGEAQVAGEMGDAAGQGV
FT                   KAGVASPKIGKKTFPGEGHALGAGSSTGPGTATGSASATGARTGGTASVPSPSNRWKED
FT                   DIQTLVNLGAPRAQAIQLLEASGGNVDVAASMLFG"
FT   CDS_pept        join(complement(133709..133779),complement(133336..133531),
FT                   complement(132622..133134))
FT                   /codon_start=1
FT                   /gene_family="HOG000182512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092871"
FT                   /locus_tag="CNC00470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42030.1"
FT                   /db_xref="HOGENOM:HBG345278"
FT                   /db_xref="HOGENOM:HBG716164"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniParc:UPI000042D0B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL77"
FT                   /transl_table=1
FT                   /translation="MFGQKQYDQALFNDLLSRVEISKHDLNALVLDYLLIEGFSDAAVE
FT                   FARETGLPADVDHAQVAERMEIRQAVEDGRVEEAVRRVNELDPEILDGNASLLFHLHLL
FT                   RLIELIRTEDLDTALAFATEELAPRGAQNPEFLADLEKTMALLAFPDLAKFADDSPAAD
FT                   KPTLAPETLTLFEEPAFEPIIALMKRSQRVKVAKELNAAILENQGYGMETKLSGLVRLM
FT                   AWGEEKLVEGSDIVIPEEEQRKGRTWADAVLSGEVDC"
FT   CDS_pept        join(134208..134633,134681..134753,134804..134910,
FT                   134960..135046,135095..135334,135391..135451,
FT                   135501..135911,135965..136254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804392"
FT                   /locus_tag="CNC00480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42031.1"
FT                   /db_xref="HOGENOM:HBG176122"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000042FF1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL76"
FT                   /transl_table=1
FT                   /translation="MSGGYDFSHLFPANTLAFSPGTTFLAVAHQNRIIVRSTSTLQVVR
FT                   TWECTLPSESTIFRSKEPCVASSATEATSEAFIIDTLQWSGDSTYLLVHSKEAKMAWVY
FT                   GVAQEGEAAHVGGMGVEGLSKVEWGKGNREVLAWTEIDSRLYIYSLSSGETRLIQNVKP
FT                   TADGYTYSPDSRYLAVTEKHLGKDYIGVYDILDGYNLLRHFPLLTVDVQGVSWSPCGKY
FT                   IAAWDLPLSYSLHIHSAIGPHLTHLNPSSPAFSLAPNETPGLGLRTLAWAPGGRWIAVG
FT                   GWDGKVRIVESDGWRCVCVITCGTRANKTAAVWREPNDWLRDTRGRGIVQFDRQPHPVT
FT                   FPALRPDITKPYPRMGISQLTFDREATLLLIRLDSQPNVVHIYSFLPTPTSEQPTIAHI
FT                   VSSIFSREIKKAKWSPVKSKLSVVTRGGGVYFWDRESGWIEEESGGSFECDREIDVATG
FT                   GMMEGVGIPTRAEFSALDIHWSPDGRSLAIRDRYHFCLLYDEDTGNLDDDEQEGERSAL
FT                   MWNEQGEGLTDVLEEEGHISLSEGLPSREQFIWEKKRYATVKAAVYS"
FT   CDS_pept        join(complement(139827..139971),complement(139648..139771),
FT                   complement(139570..139593),complement(138321..139512),
FT                   complement(138096..138268),complement(137848..138036),
FT                   complement(137727..137792),complement(137506..137680),
FT                   complement(137321..137365),complement(137123..137268),
FT                   complement(136777..136937),complement(136566..136690))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804393"
FT                   /locus_tag="CNC00490"
FT                   /product="Potassium ion transporter, putative "
FT                   /function="cation transmembrane transporter activity "
FT                   /protein_id="AAW42032.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="HOGENOM:HBG067690"
FT                   /db_xref="HOGENOM:HBG176128"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniParc:UPI00004B43BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL75"
FT                   /transl_table=1
FT                   /translation="MKRPRFRVRKAFRKPKMPTVAEARDTWQKLKCHFNFFRIHLLVFT
FT                   FIPIIAACIFYAANGSASGNANSGLTGRQKVTFIDSLFLCFSAMTTTGLCTVNLSALHP
FT                   FQQVILFFLFIVGDYSFVSLIMVLVRKHYFRTHCEQLLINDLFRRIPTISYDTGAQGGL
FT                   NYSSKSFKSTIKKLRGKNIAISGPIDGHKMDNFAEDGLVTAGDQEQHMMTDSPVDMTFE
FT                   ERGRRERAEASEIPADNQTPGPRVPSTLGKSTAALLNPANAAPPPATSSAQAEDHRSPF
FT                   VDPLFQARQRLRTQTRAKSISAAQHGRSTSDHRPTPPHVTSDVPNHMGGGAIPPKRKNN
FT                   VHIKDYSHHDQSQHPHLHTAAQIVTHHTIDPTRGLPIPFGHKNTGYGGFPSLLHIFHHF
FT                   LPERAKQRLYRPVRRVGIVMHPTYAHEFENGHAGHEESWSEAIRGSVAKWMPEGLQGLV
FT                   IGRNSRFWTEELDDEELEQIGGVEYRALKLLSSIVSSYIFLYQMIPFAILSIYFAKVDY
FT                   WNSALLETAGEQAGTVNKTWFSLFLSASAYTGCGMVLTDEGLVPFQTCYLMIYVLIVAL
FT                   LVGNHALPIMLRFIIWIGTKITRKGVKHESLHFLLDHPRRCFLYLFPSHQTWYLLFILL
FT                   AFTVVELFSFLVLNIGLPVVDSLGGWERFSDGLLQSLSVRASGFGIITISDMAPSVLFL
FT                   YILLPCLSDLQMCTKSGRSDCTNMMIPIRQVKMNRNLKVTVEKSSGGFDLPVCLCKGNV
FT                   SDIGLTHSWFTIFRIIFECTSGYGTIGLTLGTPNNNYAFSGEFGTASKLVMIVIMLRGR
FT                   HRQFCFLESIPASSNPPKAYNQRYLTPIHLPVHRMKMIDRDR"
FT   CDS_pept        join(complement(145276..145684),complement(144489..145217),
FT                   complement(144344..144440),complement(144164..144289),
FT                   complement(143997..144107),complement(143821..143947))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804394"
FT                   /locus_tag="CNC00500"
FT                   /product="3'-5' exonuclease, putative "
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42033.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG176136"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000042FE4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL74"
FT                   /transl_table=1
FT                   /translation="MLSNLGLFAAERCPDTNCTRPRCFFSHDPTISGPSQSQVPIGIRE
FT                   PANRKPPTAVKRKVGESSGAPIVREMKKQNVTRNPKPVAPSSTTPVRSAPAPTKTVVSG
FT                   GANSSSTDYSRPPMLPYGIKLSPQPRTDRQKALGTLHTQFVKLYSQILHFSPSLAHDSS
FT                   LAQEAEISSSSTSLRAYKTAIHHAAVAISRRPPPTSIPHPSIGTVKESRVAMEKAEKEK
FT                   ASKLTRNRVERYCMKKEDFEKWGYPDPSGEGLTGRGVETKPDGEGETHDCDRCKVSFIV
FT                   SSKNLERRFGECRYHYGRTAPERVEGRRKWIYSCCGKERGEQGCEEGVHVFKDGEDDKE
FT                   LAKRVAYKTVRMCLEEAKASGKNVVGEGYGVVAMDCEMIFTTAGLSLGRVTVVDENGYT
FT                   LLDELVRQKVPILDINTRFSGISPGQLDNAIMDLDGVRAAVCMFIGPETIIVGHGLEND
FT                   LRALRLLHDQVIDTAIVFPHDKGAPYRRALRDIVKEKLGYFIQDRTSDKGHNSVEDAKA
FT                   TLDVLKWKVREDNED"
FT   CDS_pept        join(145876..146067,146118..146369,146419..146581,
FT                   146636..146762,146817..147063,147138..147243,1
FT                   47307..147569)
FT                   /codon_start=1
FT                   /gene_family="HOG000265463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804395"
FT                   /locus_tag="CNC00510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42034.1"
FT                   /db_xref="HOGENOM:HBG398835"
FT                   /db_xref="HOGENOM:HBG635246"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="UniParc:UPI00004301D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL73"
FT                   /transl_table=1
FT                   /translation="MFISRPVAPSLRLFAKNSLQSITQNSPVRSTALFRCQSNSAVSSS
FT                   SKPAAKPNELAKVIRDSIKSTGPISASRYMQFCLSHPVHGYYSKGDVFGQKGDFITSPE
FT                   ISQIFGELVAIWFLTRWMEVDSPTRVRIIELGPGRGTLMDDVLRTLFNFPGIAASINSV
FT                   HLVENSEAMREVQSQTLTPRIKGKDVKLNWYTSIEEIPETKDEFTLFVAHEFFDAMPIN
FT                   VFEKTDMGWREVLIDRDPSYTPNLPTSSTPSGLRFTLSPSPTTLSTILPSTSPRFAKLP
FT                   SGSRIEVSQDSYKIMHRLGQVVNQGLGGCGLVVDYGADKAFASSFRAFRKHEIVDVFED
FT                   PGNCDLTANVDFAYLRESLTGTATPLGPISQAQFLISLGLQPRLRKLLDTAPPERREAI
FT                   EKGAKRLIDVLGMGSQYQVMGVVSGEPEMKEGIYPFPVKKETVESKVLRP"
FT   CDS_pept        join(complement(149108..149146),complement(148996..149052),
FT                   complement(148815..148938),complement(148235..148761),
FT                   complement(147625..148164))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804396"
FT                   /locus_tag="CNC00520"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="dynactin complex"
FT                   /protein_id="AAW42035.1"
FT                   /db_xref="GO:0005869"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG176144"
FT                   /db_xref="InterPro:IPR006996"
FT                   /db_xref="UniParc:UPI000042E799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL72"
FT                   /transl_table=1
FT                   /translation="MQMATKYRGLPDIDTAPDIFETTDEPEIVLKPSDVRSGDEDSVLK
FT                   PVSEDIDAGGLPSRRKAERVFARGTRKPELSTLSFRPRLPPLSRYASSSSDTDEEPPLP
FT                   RETPAARLRRLKAELAEIEAEVGSSSPSKTQSISHEGSGAGKRRSVLPPRQPVDVVSEL
FT                   ANVRERLERVEIDGLDVGQVVAVGMGPSSEWRERLDKLVTAENRSGKGKVAQSTAVGQQ
FT                   DSSLSDIDKRLAALEQVVGPTTDGLDQTLSPLVPTLNKHDHLLTLLTQPRHLDAISRRV
FT                   KLLLVDLDRAAAASRRTGAGGAAIPQQSSEKAVTNLSLTQGEYTQLQSLFSVLPRLDPL
FT                   LPILTPLLARLRSLSALHSEASEIAVSLRELQSRDKKNAEEINELDEVVKSVQTGLGDA
FT                   IAAIKKNWEGLEKRMMGLEQRLKDMERQI"
FT   CDS_pept        join(complement(153028..153402),complement(152389..152910),
FT                   complement(151938..152330))
FT                   /codon_start=1
FT                   /gene_family="HOG000138222" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804397"
FT                   /locus_tag="CNC00540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42036.1"
FT                   /db_xref="HOGENOM:HBG067689"
FT                   /db_xref="HOGENOM:HBG174795"
FT                   /db_xref="InterPro:IPR006912"
FT                   /db_xref="UniParc:UPI00004B43BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL71"
FT                   /transl_table=1
FT                   /translation="MPRRSAKYKATARARELYRMATILNHKQLKTSLSIPYHALRTSRY
FT                   LNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVSSLMVQ
FT                   ESRRTPFYSLQLRSIDWDIADGTSAIWTTRVIKAILSLERNNVYWPDENERKAIDRHFE
FT                   EEEDIPDGCVGIIDGFHVPFAYKPARHDAVDSLSYKGRYGFNILGICDHLKRIRYFQYG
FT                   YPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVHSEMISQGEYLLADSAFPAGDW
FT                   CVPLFKRRRGQNDLDAPEAKFNKKCSSARVKIEHAYGILKNRWQSLRNLRVKIRNVRDE
FT                   GVATCWIRACVVLHNLLIDTGDWYNQLDGDADEPDDYIDIERMQERMERVLERHREEEE
FT                   DEARDARDASNLTRKRVMERMQEIERRDLL"
FT   CDS_pept        join(154350..154649,154749..155387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092872"
FT                   /locus_tag="CNC00550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42037.1"
FT                   /db_xref="HOGENOM:HBG176157"
FT                   /db_xref="InterPro:IPR019129"
FT                   /db_xref="UniParc:UPI00004302B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL70"
FT                   /transl_table=1
FT                   /translation="MSWKPSPAGIFASGPPMSSSSNPVINRIKPNASGLSAFQREALVS
FT                   SYGPSSSAQPKVRTEWDVLKENHRFIRDDEDAKDVSWEERLARAYESKLFKEFALSKKL
FT                   ALRWRTAPEVVNGIGEETCASLRCKYHEPLRAPSPVSDHAVGFISPHSRAESTDRNYGW
FT                   EYLGHDEKERRRRKEKKTKTTPELKTFELPFVYMEAGERKEALVKVRVCPRCTAKLLWK
FT                   PGQDDVEEDLMGQMRSGERENEKEKEDEKRSRKDRDRRTEDRGKSAEDKERRRKRKVQE
FT                   CERGRSRSQSPKRHSRHHFEEKGKSHRHRWD"
FT   CDS_pept        join(complement(157597..157612),complement(157467..157548),
FT                   complement(157334..157415),complement(157148..157270),
FT                   complement(156113..157084),complement(155537..155839))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804398"
FT                   /locus_tag="CNC00560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42038.1"
FT                   /db_xref="HOGENOM:HBG067688"
FT                   /db_xref="HOGENOM:HBG176166"
FT                   /db_xref="UniParc:UPI00004B43BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL69"
FT                   /transl_table=1
FT                   /translation="MTSLELPLARLSISNPRLAPAGASPKSLNWDSYSNCIIKTNVTSD
FT                   PASLRLQIVHDTSTLIVRDLPASDLINASITRRITHIGQQAAFRYDWPLNAGVGAKTQE
FT                   CFQVIFQNATDLTSLLDHLKPFFNIQTSTTKPITVTASQPTQVQAKENSSTKKRSPSKS
FT                   GQKKQVANPAPIRASPKGRLAGDTRAVNKPRPTSQPSLASNPRAPKVNTLGSSPTAKSL
FT                   GTDGTVPSTLSSDGPRAVTKDIGRQSPLPVHGPLAFSMNDPTMAGLKRKLLAGFDPGTT
FT                   ASVTMHPSQTARITGSPSHSEPQTHEATPSRSVTHKSDPESTTNESAPFNSHFPPIVPV
FT                   QKPAPTFQPTSVDLITFSSPIMSSNSLPPPPGPARIVLGGSSDIEIGSECDWPVMLTEE
FT                   KQREETLKRLVEEDLDVEMNPDDGSAYGKVSHILGQVSIAQHNNPYPTPSESYASLPLF
FT                   TPRGESVYSQEYTERGCHSYSSQDRSNYKRPAYSLEYHDNQTIWKRMRVGEEEIYLYDD
FT                   LEEEDRMC"
FT   CDS_pept        join(159177..159192,159239..159639,159686..159937,
FT                   159984..160583,160639..161364,161426..161572,1
FT                   61638..161745)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804399"
FT                   /locus_tag="CNC00570"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /protein_id="AAW42039.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG176173"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00004302AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL68"
FT                   /transl_table=1
FT                   /translation="MYNGQPPFPGNGLPPFPPQMVPNGTMPAGFPPFAPPFPPPFPGMR
FT                   PPSGPGIPSPATPGMMPSPAPMSGMQTPGMAFRPPPMGYAPRPAHPGLGSTPHGLPQPP
FT                   HMPPSTPKPDVKTTKVFVGGIAPGITDETLESLLNACGPLHELKRVIGASGKPQAFGFA
FT                   MFENPEVVLRCIRCLNGVELPDMTPEGRRDRKPAKKLIVKADEKTQAFLEEFESTLGRS
FT                   DSDEEADASSRKSIQHIIALLTDPNAQHPDGPSAGNNGGQSPVQVVVPAHLQDLQEGDL
FT                   PEEQRVAVLGQIAVFRENAAKREREKKLMEEEKERYKAMQSQGGGQRQAPSGYGYGNRG
FT                   LAKQQQQAERQWGSQSASPVPWKGAGPSRYGPGERDPQAYDKPVSFVKAETTEGKAESG
FT                   RTDEEEEELRRRKIQMDKDIALRDAERRVEARERTRLDALSREMNYRQTQKDLVARSRA
FT                   RQEELYARYDDDEYIERSERERDRRDRPDRERDVRELFYVDRPQWRARRQKFRQNEYQA
FT                   DLRDRQHEEDERQALERESEEFLKKQMAELAALEQSQRAQGLLTEDAAPIKLAINPSAL
FT                   PPPPPKEEKKHVVAPRPGVQFEGEDDDEESGRKKKGTFVRLDEEEEGDGLNEAEKRARR
FT                   NARLLDVKKGVPNDRRSIWKFPVEWAAVGETLIQNKIKPFVHEKIRNFLGELDEDLADF
FT                   VLEHLRDRKGADDLVDGLEPILAEDAEPFVLQLWRQLIFESLAFREGIDTGSMMI"
FT   CDS_pept        join(complement(163019..163298),complement(162870..162969),
FT                   complement(162731..162821),complement(162245..162661))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788714"
FT                   /locus_tag="CNC00580"
FT                   /product="N-acetylglucosaminylphosphatidylinositol
FT                   deacetylase, putative"
FT                   /protein_id="AAW42535.1"
FT                   /db_xref="HOGENOM:HBG191816"
FT                   /db_xref="HOGENOM:HBG627717"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI000042CBE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL67"
FT                   /transl_table=1
FT                   /translation="MPPAQGPGQPRPLAFPFVFAVIFPLFRLLFSLTPITQPQDFNLLT
FT                   PKSIDTLGDKPSALIVTAHPDDEVMFFSPTILGLIGAGWDVKGLCLSTGNSEGLGQKRK
FT                   EEFIKSYEALGIPAENLEITDHPDLPDGLTTKWNTTLVSTIIQDSLFSHPVDIIVTFDP
FT                   KGITSHPNHVTLPSSLALIPAERRPRVLALQSPDILPKFTGPLYIIYLHIRTLFFSPQF
FT                   QRAFQFLFPSFNTFFGTENAKGTQTHVMINDLRGWAIGLKAMMAHNSQLVWYRYLYLAF
FT                   SRLMWVNELVEVTY"
FT   CDS_pept        join(163539..163570,163617..163746,163801..163996,
FT                   164077..164165,164227..164556)
FT                   /codon_start=1
FT                   /gene_family="HOG000230791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804400"
FT                   /locus_tag="CNC00590"
FT                   /product="Putative uncharacterized protein "
FT                   /EC_number="3.6.3.14"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="AAW42040.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG311291"
FT                   /db_xref="HOGENOM:HBG732046"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniParc:UPI000042FAD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL66"
FT                   /transl_table=1
FT                   /translation="MSGTGPREAIFPTRMNLTLTKGRLKGAQTGHSLLAKKRDALTTRF
FT                   RQILRKVDEAKRLMGRVLQLASFSLAEVTYAAGDIGYQVQESVRKANYTVQARQENVSG
FT                   VVLPAFEGVRSNDASGLSRGGQQIQKSRDTYIKAVGTLVELASLQTAFTILDEVIRATN
FT                   RRVNAIEHVVIPRLENTIKYINSELDEMDREEFFRLKKVQGKKKRDAANAEQTREGENK
FT                   AFEATGGELHRDEGIGGGVAGGADMLDEGKDEDVIF"
FT   CDS_pept        join(169138..170341,170395..171138,171187..171337,
FT                   171394..173298,173347..174904,174966..175056,
FT                   175113..175214,175271..175455)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636074"
FT                   /locus_tag="CNC00600"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="two-component response regulator activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAW42041.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG176196"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000042D0B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL65"
FT                   /transl_table=1
FT                   /translation="MKRQSLSFKNLIAVEPRMSPTQRRSSFFERQRQSSGSSTKTDHSS
FT                   VFGSGSGSGSGLMKKKNLVSKMEGWWNAVKSNFVPEHPPGRPGGHSNQGRVNHSPKRRG
FT                   SIPSITQLKSAYLAPEPAALRGSPNLPLRQVISHNELRQRPQGDNHYESASVLDSTPAD
FT                   IARLSRNSSSETAMPIPQHMLVPPPPPVRHASTVTEVTEEPTNPPSRQEPPIHTSLEAR
FT                   RRQPNLRLELEPHTLAQPSPHSSNSSGSQPRMVPLGMPLRLSESSLRSSVYGQSRGPGL
FT                   TPGAPRWDQTPWPVHTFSQHQVEDREDKPVAPGAELTVGSVRNHIRRRLNGAKEACDAS
FT                   LRRTINSITKFVEQERQDVGRQEEIPVDYFETLNLNDSAVVDGEDTGSEAAYENEGPSS
FT                   RAVSISWSRGPSRRPSVSLHAISPKARTSALATSPSRIVSRRRPSAVLPRTFGPTGRNV
FT                   SIPKDRTQSGASSRSTSRSHSPMPGRQLPLQVDSTDEDRHFLQALQDLIVQATEVVDSS
FT                   VHTLKSGPDSCATIIQRIQKIGAKWDEHPDWPGREWYVEILLAVANLGRVLDWWEAEKG
FT                   FWNFDAETENDQLLFVLKPREEQRFDQEFRATFSEPRYSPLSTAVSVAGDLPPALGLDA
FT                   TSPIVSSPQTAKSEEPGKGLSPKAQAIDDLKFLAEHAKSVNIVMELSLQGEIVEYVNDA
FT                   VLEVLGQVPEEVIDHPITDLLAPGDASVFSEATHQLIEDDNNTVQCRFRFEVHDLAQDE
FT                   DDERQPGPVYIELEGVGMLMRENNEPSHTMWVMKPVAATQVEAITAAVFPRDGHISTEG
FT                   ILCRICEREIVAWFFEKHNETCDALHRLEAEIAECDDCLHELRQTVVDLESEVDAAAPN
FT                   NPAQYQGVLFFTLPESVAASDAKAATQYLQGIEVRKVAREHLQDVLHILSTARQIETPY
FT                   VREEEADLPSNIQNYLSEESEDRLLKIMRWQRPQTNEFALNLLFTHVEEQLKRKHKAVA
FT                   RMQSTIRYSEKTRHEWEDKVNEMLAEQEDGSGTESESGSGGSEIDKSPSEVHAALSVEN
FT                   PESSPPGPRKIAPLARLPITQAHPHRQPSVLEELSAPTSIAPTPAAPQTITTDPAPPAL
FT                   TSASSLPTVPILAPKVRNAPFQFGSKVHSPDMPPPAPSRRVTPSKTGSTEPESMTSSPL
FT                   LMPYGADRHHRRRISGSQGMRDAPLSPRIPSAALRSSVAQTTIDDFKILKPISRGAFGS
FT                   VYLAKKVATGDYFAIKALKKSDMISKNQITNVKAERTILMNQASSPYVAKLFFSFQSKD
FT                   YLYLVMEYLNGGDCASLVKTLGGLSEDWARNYTAEVVLGLEYLHKRNIVHRDIKPDNLL
FT                   IDARGHLKLTDFGLSRIGLLNRQVGGPRPAYLRGISLRGSGQHRLSMTRTTSNSSLIDS
FT                   NMLSPEISSGQSLPNVSQSYFSQMRPSGPEDESSGSESAGIIPKHVRQMATKLSSELGT
FT                   PSVNGKEPPKFVGTPDYLAPESILGIGQDDAAVDWWALGVVLYEFLYGFPPFHAETPEK
FT                   VFDNVVSRRINWHEDEVGISPEARDLINRLLCSDPQMRLGANGAEEVKSHPYFASINWD
FT                   TIATSEASFVPDVADPESTDYFDSRGATVGFHDGGGVPQVSKQTATDPNAKANPGAASM
FT                   SPKASGEMEAIANDMAEQSDFGAFNYKNLPVLKQANDDVIRKLRTDSMAPLSQALECAP
FT                   SLSKGKQRRLSVQVQSKSTRRISDPNQAPYTPSPSTSTSSAVSTPSRSNMQPPSSSTSH
FT                   HPRRLSELGALDRVKSTDEADEPREAQSQTRLRGDSGSSIGSNSTELTKQRRHASLQLD
FT                   FATSEPFGGLAENKHFVGSNVHSRGLDVLVAEDNPISQKILETLLTRVGCRCICVDDGP
FT                   SALAAIMGSIRFDVIICDIHMPVVNGEQVARMIRSTNNHNQLTPIIAATSYEQYINEEG
FT                   TLFSGVLAKPVTKADLIRCLAKLGFVISAGASDVASVPTTAPAVQS"
FT   CDS_pept        join(complement(179204..180295),complement(179084..179157),
FT                   complement(177737..178967),complement(177484..177680),
FT                   complement(176642..177426),complement(176395..176591),
FT                   complement(176069..176332))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804401"
FT                   /locus_tag="CNC00620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42043.1"
FT                   /db_xref="HOGENOM:HBG176200"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniParc:UPI000042FB95"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL64"
FT                   /transl_table=1
FT                   /translation="MLSSSLTALPPTSEAPTLPSEPSPPRPAPKRTYGRAKHVSPPPDK
FT                   VEFSSITNTSEFGEPSSARDNTLVNRWTDLSSNWRSQLAEIDAPRDGAGLAEDPEELAR
FT                   EMARLRGELRGKNGSTSTLVTEEQDHTRKLTAKATGGLTVSVNGSSQASPFSMPPSSPP
FT                   KRHSSQASSALSEPQSLLQVSEASETTEEESYVLNRLLKGKSRSVIASDEEEEEEEETP
FT                   KRRARSESSQSASPPLFSSQEELTEQNPTEKDADSDKEKDDGEDQDIGALLAQQNEEVE
FT                   THGQREQERAKEGQFSQAREDPLAELNDLFSDDKDSDEHEKSNNKVDICDGFSLYGSAL
FT                   TAKIRVSTSGIRKQCIGKSMLQSANALSTSLNQMRNWRLWAIGSTSGKPSTAHVHVPST
FT                   QIKTSTISSSPTPNSILRPSRDYSKSRISQSSRVLGTSEPNEQEEEDENQDFGAFMEKE
FT                   EKKDTAAEKQAEKMRNLKEIKAKLAREAALRNKPKSKADDDDDLDIVQGSRDFLLEGRG
FT                   RAGGSVKPNTKTLDIIRAAASRRSTTPFEKGGPKPQSMSQEATETYVLHAAHTPNHASS
FT                   KFLNGGVRPAGQKKGRDGAISQAKLNAYILDKHRQQANMTKGKKEEQWGRGRILPERVT
FT                   QDVDELVTQAEQAGEEEDEDGDEDEDDGEYAPDDESEEQELVYSGEEEEDEKSEELPMK
FT                   DEPIADTSGDKGNQSQSEEEEEEDSALILKRKSKKPRASARVLESDDEDESVPPKAPTP
FT                   REPLAETAISNLAPLAADIDIDLAGFGEGGMSQLFDATQIDNAGDGEDAFAELRNRKPV
FT                   GLLPTQLELPPLQISESQALRDDQLVIAAIEDAAMERARELEEPAKRYLNTQGLFTQTK
FT                   PTTPDEDYDPSYALGGGSPTPLTQRDTQYANSMGQTFPRRNGDMVSSDQFSPTQKLTRL
FT                   KRRVSGSPRSPDRLRESSPEASADELEPTQVSEEQQNAFDVLRAGARLAANPLDIPIIE
FT                   AERKKKGKNKSAFLEAEAEESDEGDGGWMKTTGGEDENSGDEGDDRFLEELVDDAAVSA
FT                   EEKARQDELAAQMRKQIEDEDDARRLEEARKITEGEHRKRRKGQDFYDDDSDDEGVRLK
FT                   KLSRKERKRRELGRAEGLLDGEINVFEQEYHRDLDSDQSDVGEEEYHPSVLGGVERLSP
FT                   EPEPVERLSYGDRRVRLQKVAKMNAQRDMETMDQEMDAELGLGVKHHISGRSRATAIHL
FT                   GIDEDVIMKDSNFNIKRNVRYTKKMEQVPAEDDDLVSTYSASCSLSSVDLTGFL"
FT   CDS_pept        join(180708..180799,180859..180960,181018..181126,
FT                   181182..181667)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804402"
FT                   /locus_tag="CNC00630"
FT                   /product="Putative uncharacterized protein "
FT                   /function="GTP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42045.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG176205"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="UniParc:UPI00004B43C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL63"
FT                   /transl_table=1
FT                   /translation="MPRSNSNTEDLPKHQEDDTLRQKILVLGWRKAGKTSCIKTVFQQV
FT                   PAVEVPHFGVTQKIEQINYNSIVPLQIWDTPSNFEIDQLEVPLSTFSTIVYVLDMQQDD
FT                   SYHDSIRKFVHIMVRAYLSNPDIRFHMFIHKAEMLSEDYRGENYAEIQRTTAEEIEDFR
FT                   YGDLQAYAPNNLDLDDPSTIGMIINQLIPEVVYSMTSAHDVSLRAAWSKVIQGSMEMLS
FT                   AVEALLLDFSSVRSISFYPLSSIANLSYSTLAPITRSCST"
FT   CDS_pept        join(complement(183180..183640),complement(182515..183121))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804403"
FT                   /locus_tag="CNC00640"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42047.1"
FT                   /db_xref="HOGENOM:HBG176214"
FT                   /db_xref="UniParc:UPI000042CFF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL62"
FT                   /transl_table=1
FT                   /translation="MTIVPNLQEATTSDSDSERTLYDRPNRTSRTDRAESGHDSSEIFF
FT                   PYTAPFSSIVPALTSFTKQPQVTSFQPLKETKWQRPPFLPTLNSHPRLVYPIVVLTLLS
FT                   AGLITGLVVFVIHQNHILVGEESSPDNEGKDDGQELSPLILFIDAVFIIFIIGTISILL
FT                   LLIYRFSTKFRHPPLPSSTTRIANPLDFLPGWCRTTLPSLPTYGEAVIGASGTIDHQLE
FT                   MTLPVYEDNRNSRMLMRSQSRQNVEDRGGSSVSVVMTDDEGNERQVRSPTQEQRLTSYW
FT                   MSELVLPTAKRQSQIHIQSEPRSSSLLDVIVEDESVMINMEDIKERGRIGVEEGGVNGD
FT                   EGEVKEDEIEVWLEV"
FT   CDS_pept        join(184671..184741,184826..184931,185095..185242,
FT                   185332..185504,185573..185611)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804404"
FT                   /locus_tag="CNC00650"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42534.1"
FT                   /db_xref="HOGENOM:HBG061558"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="UniParc:UPI000042E798"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL61"
FT                   /transl_table=1
FT                   /translation="MASITPSTIPPSSQIGIPTTVPPAAQSWGPLAIDAAAHGAIAFCQ
FT                   IYYEAYDEPSRRAEEIPILYLPSSKIIWNGNPVSSEPAAFAEFLRSMPLSRHDLQTLDC
FT                   HPVASEEGSAPSLIINVTGSVLHGPAVLQSSNDKPQERDMPRKFHEMFMLKVIGQEEGM
FT                   QPRYAVHSSNFRFIG"
FT   CDS_pept        join(187014..187064,187117..187150,187209..187223,
FT                   187310..187378,187437..187839,187892..188187,
FT                   188276..188405,188487..188627,188707..188851,
FT                   188950..189063,189143..189157,189218..189240,
FT                   189303..189390,189447..189481,189557..189730,
FT                   189787..190059,190154..190331)
FT                   /codon_start=1
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788715"
FT                   /locus_tag="CNC00660"
FT                   /product="Long-chain-fatty-acid-CoA ligase, putative "
FT                   /function="ligase activity"
FT                   /protein_id="AAW42049.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG266050"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000042D99E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL60"
FT                   /transl_table=1
FT                   /translation="MPLEPLPPNVDLNRQNHEIPGTRKDGQSGVFTNSFYNRSILTAPG
FT                   EPHTLFQLFEDSVKKNPGHPLFVRRALHPSSTPLEPVWTDTLIPTSYATVQTRRNNFGS
FT                   ALLALEREGRLRDPTSADISPPEIKHPGVPFYGDENRRKGGARRGWAVGVWSGNREEWQ
FT                   IMDLACHAFGLVGVSLYETLGPDVAKYITNHCPLPIIVTSQNHLPSLLKIAPLCPSLRV
FT                   IVSMDPLPASERVLLNQWAASVNIEFFTMDELEAKGAQAPCKPGPEEGEEELDLKRICT
FT                   ISYTSGTTGDPKGVVLTTENVLSATISNGKGVNPGLINESWMFLSFLPLSHIYERFAEI
FT                   VVMYGCGTIGFTRGDPTKLLEDAQLIKPHFMVGVPRMWNRIHAAVKEQMNSGGLKGALL
FT                   TKAVNTKLAKWRETGEVTHPIYDALVFRKIRALLGGRLVFIGSGAAPLRKDVHEMLKVV
FT                   LSCEVVQGFGMTETVGTCSVGIPWDVGGPGTCGRLQPCNDVKLVDVPDMGYTARDLPNP
FT                   RGEVCLKGLNISPGYLHNPKATKESIDEDGWFHTGDIGEIDSAGRLKIVDRLKNVVKLS
FT                   QGEYVALEKLEGLYALDPLFASFLVHGDSTRSSLIAIAILDPQQTSNLVSKVLGKNVPS
FT                   ENLRGLEEAAKSKEIRKAVFKILGKTARQNKLNGFEMIKGLYLTLKPFPEDIVTPTFKV
FT                   KRNLAAKIYAKEIEEAYERGEEEAVEALREARL"
FT   CDS_pept        join(complement(194060..194122),complement(193914..193949),
FT                   complement(193750..193839),complement(193517..193680),
FT                   complement(193045..193468),complement(192558..192990),
FT                   complement(192355..192509),complement(192069..192305),
FT                   complement(191006..192013))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804405"
FT                   /locus_tag="CNC00670"
FT                   /product="Nucleus protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42051.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG176226"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000042DA63"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL59"
FT                   /transl_table=1
FT                   /translation="MSNDESKTNQQQAPLKRRRITRACDRCHRGGIRCAASSNPSVCAP
FT                   CADFGSECTYNRPMKRRGPPPSKARESYGSASGIALTRWTLPLPSDNWTYREIASHAHI
FT                   ESLVEAFYAIVYPIYPMFHWPTFTANIRRRVYTTYPAFHALTMSVCAITSARLRDGAVP
FT                   SPNSSTPTSDPQPPTSETFYQAAVASYPRDITTASDFDYKRAKPLLATLAIQYGQIPAV
FT                   HAHIGDYMTLCAIDGFHNESRWPNDLNEIEVQERRRLFWLAYQLDVYAATTWGGIIRHR
FT                   ESQSTVLYPAEVYSDEEITPTGIVKSVNPAHPVSFWRGWNFVVDLYRILEHAVTRLRAR
FT                   NHTFDAGNQIAALFSEGRVGSGTELKPGDLLVLVERLYRALPPELRATSEMTGDVEKDR
FT                   YGFQAANILVTMQTMKMVVAGMAEWSVEQRCSIAGELLDAFATVPRAYIQAISTPLLHH
FT                   LAGVGHLLASIIHSPLSPAAYLHVRTVLLSMADLLSSLESHLTSTGGIAPKLREHVERI
FT                   DRYMTSATESNGKLATFASPIHDVQTRQHLATPHHAKDTTPTTTFSLRNVSAVPGTASS
FT                   VTGTGSLGMSTGTNSSNVRTTSRPSTSANADVYNPSPLGNVNAKFQFKPNSTSSSSSLP
FT                   LPHLPRPPASQIQNTILPSSSSSVPPPMHLPFGGIGAGVSDTGAGESLQRREPPVITPS
FT                   SSHSSHSTPSQFSPKFVNTSLVSHPVPPPSIGQPQGNLAGLPLPLQPSHSQNQSQSRTQ
FT                   HNQPQQPIENPFHLTISNFPPETQEPAYQLPDDLFVDWPFLFNEFGFQGDAFDFLSSGI
FT                   GGAGGGPGGESASTGVFDGVQAGAGGSTAPVGNFNGVNMTGIGGGRIPPALEGANLQ"
FT   CDS_pept        join(complement(196660..197490),complement(196353..196598),
FT                   complement(195984..196295),complement(195007..195924))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636075"
FT                   /locus_tag="CNC00680"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42053.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG176233"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI000042FB94"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL58"
FT                   /transl_table=1
FT                   /translation="MSDATLFLRKNKDKQRRRNVSGASRIASTSNSSLASRPGASKGQP
FT                   VAGPSSSGAPSSAAPSPSSVSIKPEPDSSNNPNITEIKIFSTGSNSALRYNLMRLNSVK
FT                   DVDPTQITAPVLMNRKKPGPKDPPTFALDENGKIVGRYVYDEEGKPILDEEGQPVVERK
FT                   EVVDMSLVGQAPGGGRKKRVKRGTKEVFHQDIEIMRLRREEALPWVLESGNPQDKPAQP
FT                   EQWVGRMLEQGQLSTVLLSNDGTRDGFEMMPLGRSYKFEPARPFKPLDSDAANKLFELQ
FT                   AKNKIHDRWAFRPADNQSGEASSASTPIQVKAEPNELEQRASRMETRIKMHKGVTVDRK
FT                   AKVERYEDDYQREGHRVERGMEGGVDEELDFDEAEEFQDDDDNNTFYRDAQEEEEAREL
FT                   EERLKKEFRVANANVGDRPQIDAEDDEDDLFGDKSLDDEGKKLRKIMRRRMRENGEDYD
FT                   IDDDSDSDSDDESTTSTQNKEKEKEKDKEKEKAKEKDSSRNPSQPPSRPSSRPPTARTS
FT                   SPSGSNPRYPSPKKGKASTAPPPVSGASLIAQRATSRGASPRPSTHGGHVAGRASSPLG
FT                   RVPSPAEGRGPGVTGQSQPASRATSPAVRESSPASGGAAATGGASPASGGPSTRDVSPA
FT                   PPAGRPSPRKENAAVSTSSSSAKRKSSPSVSTPSADAPPRPKKHKKTGSLTPAPAPEDI
FT                   PPFSGMITKQDVLGWFQRNKKKAVPMNEAIGAFRKRIVDAGPNRDANQKLFLGWIRMVA
FT                   DQENGNLSLKPEFRQ"
FT   CDS_pept        join(197780..197823,198003..198120,198190..198293,
FT                   198351..198485,198546..198649,198842..198933)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804406"
FT                   /locus_tag="CNC00690"
FT                   /product="Chaperone regulator, putative "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAW42057.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG355465"
FT                   /db_xref="HOGENOM:HBG736819"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00004B43C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL57"
FT                   /transl_table=1
FT                   /translation="MPSRRAPMTLPKSSSPYDILDLPLSATETDVKKQYRKKSLLIHPD
FT                   KFKHEKGLEAFDFLKKAHDHLADPAKRKDIDMIMTHARTQVLKSILGDGYSTSVTDDDP
FT                   RLTNLSPPFEQQIRAKGREILVEDELARRRKQKLAYSNEGAEKARAEAEVAARKRKVEE
FT                   QAKWEERRDDRIKDWRDFSQKKEKKRKKNNLHVLG"
FT   CDS_pept        join(complement(200428..200430),complement(200367..200372),
FT                   complement(200260..200273),complement(200126..200199),
FT                   complement(199915..199993),complement(199757..199856))
FT                   /codon_start=1
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636076"
FT                   /locus_tag="CNC00700"
FT                   /product="PRCDNA38, putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42059.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG028539"
FT                   /db_xref="HOGENOM:HBG460460"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniParc:UPI000042FF18"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL56"
FT                   /transl_table=1
FT                   /translation="MGKGTPSFGKRHSKSHTLCRRCGNRSFHKQKLTCAQCGYPAAKLR
FT                   SFNWGLKAKRRKTTGTGRMAHLKNVNRRFKNGFREGGAAAKKAKAE"
FT   CDS_pept        join(complement(201924..202396),complement(201585..201873))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804407"
FT                   /locus_tag="CNC00710"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42061.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058366"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000042C10A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL55"
FT                   /transl_table=1
FT                   /translation="MSLQLPESSLPPLKSFSLTHILYDPAHPLSIPLTLLSLSPIFLFV
FT                   SYFTLLIFTRRISIALLASGQLANEVLSWVLKRIFKGERPYIGHGEVGAGYGMPSSHSQ
FT                   AAGFLVAWGIGYVLTHADRNEQVRSVRAEMVRKWRTRVYVFGLLLWSVGVSYSRFHLHY
FT                   HSPAQIVAGYLAGLAFGALYFTITEYYPLRHPFSSLARLRIAVEYIWGGIGGVGGWELG
FT                   DAGGGWGEGWAFVGEEQPAEEKREDKKKKKK"
FT   CDS_pept        join(205926..206457,206740..207000,207047..207161,
FT                   207211..207668,207720..207961,208016..208558,
FT                   208607..208863,208919..209192,209247..209370,2
FT                   09425..209504)
FT                   /codon_start=1
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804408"
FT                   /locus_tag="CNC00720"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42647.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058312"
FT                   /db_xref="HOGENOM:HBG590918"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI00004302AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL54"
FT                   /transl_table=1
FT                   /translation="MPHTTNVSLSPRPTTPSGSLPRTDRSRRPLPPDTAASGINDLPRR
FT                   EFFSEGSDGEDYDDEEDEEEEDDVFAFNRPATAAQPNGASSSGYGTAPTSGRPTTAGIS
FT                   WTQTTAEERGPAHVGTSTGPGTLSYDGPTPLRDQPQSVNSNNKDAVPTPTGVIDVGGHL
FT                   PDTTYDVNNPPPFSEDGVYSEDGNFGRRRRRSRGSIGMTELTGDMTVPDGMTTWGDGMG
FT                   GLAKGGSDGEVQSAMDVDFDEEDSPYPEVRASVSNIDDPDMPAMTIRAWVLGIFLTILA
FT                   SGCNTYFHFRTPAPYISPLIVQVVAYPLGKFAAWILPIDTYKLPLWLGGREFSFNPGPF
FT                   NIKEHTVIVMMANVAIGPAYALYATVSSELYYNHPMGFGFSIMFLFATQMTGFTLAGIC
FT                   RRFVVWPASMIWPGNLVVATNLNTFHAEEDGFTGGMSRFKFLIVCMAGSFAWYFFPGFV
FT                   FTALSYFSWVCWIAPRNNVVNQLFGVSTGLGMGLLTFDWTQITWIGNPLTTPWWAEVNV
FT                   GIGFVIFYWILTPILYYTNVWHTAFLPISVIQAADRFGSTYDVFNILTPEITLNKTAYA
FT                   EYSPIYLSASYCVTYMVAFALSTALLVHTALYHGPRIYRAILNIKTEADDIHYKLMKMY
FT                   PEVPDWWFLALFAVVFVFAVVSIEVYHTELPVWGYLISVLLPFIYIIPTAFIYAMTSQQ
FT                   ITINLLAELIPGYIFQGQPLPGMIFKVFSVQTIVEALSFVQDQKLGHYMKVPPRATFVA
FT                   QLSATTVACFVQSGTKELLFHVVKDICTATQKSLLICSSTKVFFTSSIIWGLIGPNRLF
FT                   SKGAFYYPQLFALVFGAVLPIPLWFWVRRNPRSIFRNLNFPVMFNGALSIPPASGVNYA
FT                   SWLSTGFIFQFWLRRKRFAWWSKYNYVLSAALDVGTALSAVALFLFIDLPGASLSWWGN
FT                   NVYKQTVDWDGVGATYYKPPPEGFGPDTWKV"
FT   CDS_pept        join(complement(211061..211184),complement(210844..210857))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581862"
FT                   /locus_tag="CNC00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42063.1"
FT                   /db_xref="HOGENOM:HBG176268"
FT                   /db_xref="UniParc:UPI00004B43C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL52"
FT                   /transl_table=1
FT                   /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGAYPW
FT                   "
FT   CDS_pept        join(complement(211061..211184),complement(210861..210874))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581862"
FT                   /locus_tag="CNC00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42065.1"
FT                   /db_xref="HOGENOM:HBG176268"
FT                   /db_xref="UniParc:UPI00004B43C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL52"
FT                   /transl_table=1
FT                   /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGASPI
FT                   "
FT   CDS_pept        complement(211050..211184)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581862"
FT                   /locus_tag="CNC00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42064.1"
FT                   /db_xref="HOGENOM:HBG176268"
FT                   /db_xref="UniParc:UPI00004B43C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL52"
FT                   /transl_table=1
FT                   /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGGKY"
FT   CDS_pept        join(213221..214915,214972..215652,215714..216136)
FT                   /codon_start=1
FT                   /gene_family="HOG000137332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788716"
FT                   /locus_tag="CNC00740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW42067.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG066373"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR018289"
FT                   /db_xref="UniParc:UPI000042CB10"
FT                   /db_xref="UniProtKB/TrEMBL:Q55ZF3"
FT                   /transl_table=1
FT                   /translation="MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFDE
FT                   GNLHAMEGSDSSEVSNIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDECK
FT                   GAVQAYAASQGFAAVIRRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGDSFKDVRIR
FT                   TIQTVKNGCPFAAVAWEMAEAEVKEHGGDKCWTWKVVNASHNHPPVANIGIALLRRASR
FT                   TPEAKELINTLIDSRTPFPSIISTMSQRFPTVMLTSEDLHRLAFRRRADLRAGSSASAA
FT                   CIRQLVSNDELHRPFVNTRDELIGLVYTKRTARALIHRFPEVLFFDCTYKTNLYRMPML
FT                   HIVGSTSTGMTYTAGVILMLRETTNWYTQALNSFFELVGKPDVKVVITDRDPALINALM
FT                   SVLPKAYRFSCFWHLQENVKSNIRPCFVDEENIVMAVSNFCKAWVRYCVHAKSDEQLEE
FT                   GYRKMEELYPGQKYARAISYIRGLDEIKERFVHAYINKQLHFGQTGNSRLEGQHATLKK
FT                   SIDTKYGDLLLVIGSLSTYFDQQWLKILKRIELERTRCATHIPSTFVRLKGSISRAAMK
FT                   LLAEQLTLAKRYLGDYDEGVDDFEESHPCSGSFTKSHGLPCAHRLISFVRERRHLEKDH
FT                   IHPHWRLGSAASLKRYLDHINRLVGTPDTSVIRLDDVFDFGEDQELILDPPILSTKRGR
FT                   KAPNPPVLQEDRMSAPSGRYLTQSERIMGAGLTQRKKGRCKHCQSSTHYTKDCARVQAS
FT                   RRVDKNQEAENAGEDRRVLVPDSDDEEGNEEDLVEVPNEPNLRPKKHSRSQYPAPSQIY
FT                   PSHAVQMQHLPPEPSVPQLPPSSQFYPPLSQYYPPAPQHYPTSKYHVPPTQYIPYNQVL
FT                   FHNHSEAPTPYHYPSVSGYNNLQSPQIYQYNLENNVGKDASIRSQEDSIIMQRGRDRHS
FT                   WE"
FT   CDS_pept        join(217669..217792,217852..218681)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804410"
FT                   /locus_tag="CNC00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42069.1"
FT                   /db_xref="HOGENOM:HBG176274"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR001153"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000042C6DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL49"
FT                   /transl_table=1
FT                   /translation="MFAKAAVIALASASIVVAAPVNCARAKPTTYDEGYLESYDAYHTR
FT                   YLALSCSTQHNTTFFDDCCHPLLATETLADNRASYCTPNSTAIASVNATIAEATASATA
FT                   SADIEAESQYNNASSYAAEATASVTAEATASVTAEATASVTASAVNNLADVAQQTAASS
FT                   YEEQPTASSSSSYGRASASSSSSDEESATSTSSSSASDSSSTSSSEVYTGGYATFYSQG
FT                   GVAGECGTVHSDDDYVIAIDSNGWWQDYESNDSSPYCGKSITLTNTNNGKSVTAVVADV
FT                   CPTCETANSLDLSIGAFNQIATEEDGMVPITWYFTD"
FT   CDS_pept        join(complement(222155..222584),complement(221806..222094),
FT                   complement(221594..221746),complement(221412..221524),
FT                   complement(221207..221334),complement(220961..221150),
FT                   complement(220715..220871),complement(220576..220632),
FT                   complement(220444..220510),complement(220283..220378),
FT                   complement(219945..220205),complement(219791..219878),
FT                   complement(219495..219679))
FT                   /codon_start=1
FT                   /gene_family="HOG000161343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804411"
FT                   /locus_tag="CNC00780"
FT                   /product="Histone deacetylase clr3, putative "
FT                   /protein_id="AAW42071.1"
FT                   /db_xref="HOGENOM:HBG058578"
FT                   /db_xref="HOGENOM:HBG738492"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="UniParc:UPI000042FE4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL48"
FT                   /transl_table=1
FT                   /translation="MHSPSPLCAPPSLRPAPAHRRMAHTAAMHTGPPPAAPTNVGNSPS
FT                   HTTMAMPGAAARIARTGYIYDPLMMLHCMEGYMPTAENVMDNGDGHPEDPMRIKRIFTR
FT                   LAEQGLIRRMKRLDFEEVKFEQVLLVHGEEMWDKVQATELLSDQQIQDMKEYYDQLSLY
FT                   VCRETAHCARLSAGGVIQACRSVCKNEVRNAFAIVRPPGHHAEPNEHMGFCFFNNVAVA
FT                   TREMQREGLAKKVLILDWDVHHGNGTQRAFWHDGDVLYMSLHRHEGGTFYPNSDFGSLN
FT                   MVGDGEGVGKSVNIPWPGPGFGDADYIYAFQRIIMPIAYEFDPDLVIISAGFDAADGDM
FT                   LGQCRVTPAAYGHMTHMLSSLAGGKLVVALEGGYNLRAISDSALAVARVLLGEIPPELG
FT                   IMRASEAATEVVYQVALEQSKYWKCIDVKACEPPEVTELENGTSPVYTIPDLLKIHRAH
FT                   HMFTKHQLYQIPLASQELEAAFGGQIICNENMYEVGEKGVLVVFVHDFGNLRVETDGAR
FT                   STNIHLANSYLLDTSDAVVSWVKTKGYNIIDVNILKQLPTEYPEGPKMVVKQANDMESK
FT                   LMKYIWDNYIELSECEKVVFIGHGTGCQAIMDLVNARDVELKVKAVVQVAGLHSLVRPN
FT                   PSNKEKLSWFKQCNQIYVPAEHVVLEDEKVKRRLGDAVFTSQKAKVVDVLNDVLPRIKA
FT                   FVESKVEDGLAPRAHSGLDGLYGLGGAGAGGELVVVNGHVHVG"
FT   CDS_pept        join(222743..222898,222961..223359,223428..223706,
FT                   223776..224222,224283..224756)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804412"
FT                   /locus_tag="CNC00790"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW42073.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG176275"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000042E2AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL47"
FT                   /transl_table=1
FT                   /translation="MAKHSAHKGKAPVTDKNNKRKRDAQDSSQGDAPVALFAAVKDTEL
FT                   DDIFAKSNAFSAPAPVASTSKAHLQTTSAPAAKKGKKSPSPEMEEDVRVDDQDESESSE
FT                   EDEDGEDNEAELSEIDEELPDDDDEDVSDAESDSEAAKAKETKKTKKSKLGKYVPAEES
FT                   VQDKNRRTAFIGNLPIDAAKSKSTLKQLRAHIMSFVPSAKIESLRFRSVAFATPTAALP
FT                   TEDPEKDANQRAKREKERAAAWKAKQNADGEDAELDKAKVFIDAKGKRKVAFIKKDFHS
FT                   EIDSCNAYVVFAYPHPDRAANVAPILDPFEAAAKFIASANSSTFSGRTIRVDSVRLPSS
FT                   VGLAGASTSLSKRDAWLPSNTDPKKSLFVGGLDYAAKEEDVRVFFEELVKAERGANKEG
FT                   SGKWVTGVRIVRDKETQLGKGFGYVHFADRESVEEILAMDAKQIKFAKRTLRVQPCKTI
FT                   PTANTLQNTIKKIAAGSGGASKDKTKKAYVRPGVIPKGDPALGDKLKNLSKEERKTIKS
FT                   SDADRQARRLAKKKAKMSLEKDKAKGAVKLTLTKSEREKTSASKKPKAKKGKKRAPSAV
FT                   AKMKGSRE"
FT   CDS_pept        join(224941..225315,225374..226820,226892..227187)
FT                   /codon_start=1
FT                   /gene_family="HOG000214585" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788717"
FT                   /locus_tag="CNC00800"
FT                   /product="Biotin-[acetyl-CoA-carboxylase] ligase, putative "
FT                   /function="biotin-[acetyl-CoA-carboxylase] ligase activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="AAW42076.1"
FT                   /db_xref="GO:0004077"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG176276"
FT                   /db_xref="HOGENOM:HBG734872"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="UniParc:UPI000042E2AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL45"
FT                   /transl_table=1
FT                   /translation="MPGPTPSAHQVLVYSGPGVSPLSLSHTLLTLRLLLLPHYTVQPAA
FT                   PDLLALQPWEPSCALLVVPGGRDLPYVDELTHKRPVTNRIREYVQQGGRFLGICAGAYF
FT                   ASAEVRFDVGGGMEVAGKRDLAFFPGPSRGPVFQGFQYASESGSRAVVLNLESSKLETL
FT                   NHIYYNGGGQFILPSPPPPNVQILARFQETCSDPSGQQQQQLVAAVFTQNGKGCTVLSS
FT                   VHPEYPLSDPPASNAIAKLDVRPSQVEVEMSDKARLSWVEELLIKLGLTPPERLTAANR
FT                   AKSSADSEHEDEDPALLLHPTHPSPIFFLSHPNLPQLPEAAVNKPELKGKMEQRDGWDV
FT                   LRDANDEIRFGTTEATSPERAASEDGITQWLAQARRTQPVFPPSVEDLSIQSDSTPQPP
FT                   SPPDLHALTKTILLPSPSVEYSSRWTPLFNFSTYWDELDQARKRSGRRSGVMRQGSDGQ
FT                   GERCSLGDCVLYGETVTSTQTMLDGNPLLLTNLPTPLVFLASFQLSGRGRGSNMWLSPP
FT                   GCLQFSLLLDLPASLSSKMVFIQYIMALAVCEAIDEDGRLGVRIKWPNDIYAEVEGVGG
FT                   TEIGSGKKGKAKLGGILVNTSFVGGKWRIVVGCGINILNALPTSSVSQLHALLAAKLSS
FT                   TSSNKPLPPAPTMEGTFARIMSSFDAKWEQFIEEKGFKGFMDEYHGRWLHSSVFFFFFI
FT                   PIDCSVSMISY"
FT   CDS_pept        join(224941..225315,225374..226820,226892..227126,
FT                   227207..227519)
FT                   /codon_start=1
FT                   /gene_family="HOG000214585" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804413"
FT                   /locus_tag="CNC00800"
FT                   /product="Biotin-[acetyl-CoA-carboxylase] ligase, putative "
FT                   /function="biotin-[acetyl-CoA-carboxylase] ligase activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="AAW42075.1"
FT                   /db_xref="EMBL:EAL21610.1"
FT                   /db_xref="GO:0004077"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="HOGENOM:HBG176276"
FT                   /db_xref="HOGENOM:HBG734872"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="UniParc:UPI000042EF63"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL46"
FT                   /transl_table=1
FT                   /translation="MPGPTPSAHQVLVYSGPGVSPLSLSHTLLTLRLLLLPHYTVQPAA
FT                   PDLLALQPWEPSCALLVVPGGRDLPYVDELTHKRPVTNRIREYVQQGGRFLGICAGAYF
FT                   ASAEVRFDVGGGMEVAGKRDLAFFPGPSRGPVFQGFQYASESGSRAVVLNLESSKLETL
FT                   NHIYYNGGGQFILPSPPPPNVQILARFQETCSDPSGQQQQQLVAAVFTQNGKGCTVLSS
FT                   VHPEYPLSDPPASNAIAKLDVRPSQVEVEMSDKARLSWVEELLIKLGLTPPERLTAANR
FT                   AKSSADSEHEDEDPALLLHPTHPSPIFFLSHPNLPQLPEAAVNKPELKGKMEQRDGWDV
FT                   LRDANDEIRFGTTEATSPERAASEDGITQWLAQARRTQPVFPPSVEDLSIQSDSTPQPP
FT                   SPPDLHALTKTILLPSPSVEYSSRWTPLFNFSTYWDELDQARKRSGRRSGVMRQGSDGQ
FT                   GERCSLGDCVLYGETVTSTQTMLDGNPLLLTNLPTPLVFLASFQLSGRGRGSNMWLSPP
FT                   GCLQFSLLLDLPASLSSKMVFIQYIMALAVCEAIDEDGRLGVRIKWPNDIYAEVEGVGG
FT                   TEIGSGKKGKAKLGGILVNTSFVGGKWRIVVGCGINILNALPTSSVSQLHALLAAKLSS
FT                   TSSNKPLPPAPTMEGTFARIMSSFDAKWEQFIEEKGFKGFMDEYHGRWLHSGQDVLLTT
FT                   TEPHTRVRILSITPDHGLLRCIPISDKPKASTGLTPLYNRDIDAGEDDRGSWSSSPSVP
FT                   RSGAARAQTQNHSPFVDLQPDGNSFDLMSGLIKRKV"
FT   CDS_pept        join(complement(231120..231525),complement(230859..231068),
FT                   complement(230647..230771),complement(230388..230583),
FT                   complement(230241..230335),complement(229930..230193),
FT                   complement(229536..229864),complement(228911..229484),
FT                   complement(228792..228854),complement(228432..228740))
FT                   /codon_start=1
FT                   /gene_family="HOG000135999" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092873"
FT                   /locus_tag="CNC00810"
FT                   /product="Gamma-tubulin complex component 3 (Gcp-3),
FT                   putative"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="AAW42078.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="HOGENOM:HBG028682"
FT                   /db_xref="HOGENOM:HBG737165"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR015697"
FT                   /db_xref="UniParc:UPI000042EF62"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL44"
FT                   /transl_table=1
FT                   /translation="MIYAYTSSGAKEGGAEKALKFNAIWNKLERGVSLGATRDYRSNSS
FT                   LGCQKLLSSPNPHLELLAALSPINPNNASRSTVAGSSKSPKNMPPPTFPSTKPSSSRQP
FT                   LVDAVPNISLLGFDAKGKAKADIINQWRANRSQPPFPQHLLLRDTLYLLQGIDGRYVHF
FT                   AVSPPKEQNPYLTERGREGEGTGFPLGKEGPIIEEGYDDEVVVISQPTRTLLMQLSEMG
FT                   MLYRRVTNFVNSRQAGDSKGGMIEQSLCHFLHHELSEYHRLLAVLESQMNTASSSGEQP
FT                   DSGLTLLRLRLWTEDMKLKLKQMSTIVDEAKNTHGGALVSKLHSHTSNGDPLIRNFTTQ
FT                   ILEEVSKPFFLTLQRWIFSGELHDPFKEFFVQLNPENVSFREGQISPTGDVGFEMGMDA
FT                   DGGEEEAYKLWEKKYVFVKKMVPGFVGEDFAKKIFSTGRSLNFIRYSCHDSDWIETQAK
FT                   IANAGRGEFMGCKRGSMSDRVVALKYSDLAGLERSIDDAYSIASQRLLEIFFDKFRLLD
FT                   HLRALKSYLMLGAGDFTELLMEAMAPRLSKPAINLYRHHLTSDLESAIRGSNAQYDSPD
FT                   ILRRLDARILEYSHGETGWDCFALQYKVEAPLNAVLDHRAMGDYDRLFNHLWRLKRVEV
FT                   VLTQNWMRVTSGSKVYERVPGLNNDWHHCRIVQAEMVHFLRQLQAFCQLEVIECSWADL
FT                   IEFTTKREGDLDALITAHRKYLSRVVRKVLLLSAKRDKEEILLDLVRDALELILQFKDA
FT                   MDDLYAWSLGEATRLDRQRDASRGLYTPSTSSDDPTRSEEQLQSIRIRIRECSNSFQHR
FT                   VVSIVHMAGAHADLDVRFLAIRIAFNGHYSLRKKDKGSSRSTRA"
FT   CDS_pept        join(232488..232649,232701..232734,232793..233092,
FT                   233145..233315,233370..233683,233751..233908,2
FT                   33964..234135)
FT                   /codon_start=1
FT                   /gene_family="HOG000077593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804414"
FT                   /locus_tag="CNC00820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42080.1"
FT                   /db_xref="HOGENOM:HBG055988"
FT                   /db_xref="HOGENOM:HBG327113"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniParc:UPI000042E6CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL43"
FT                   /transl_table=1
FT                   /translation="MSTPKVVTYLRSLEAVRDRSRQVYNLGVDGKLDHWTFDEAKLADI
FT                   ADYCSKIIERDFGVDYASIPPHCRRGHFITPSNNRIATLLAKPSFPPKSEPLSRAGTLI
FT                   DLYLVSVLLDAGAGPDWTFTETDEEGNETWKGGRSEGLAVASYHMFINGLFSSSGNKFQ
FT                   VDANGLKKLTPELLAKHLQVSEDNPMTGLEGRCNLLIKLGDALAARPDLCATGRPGDLL
FT                   KYFEPKVKDSLPLSDFWSTLFDLLLPIWPSRVTLPSHPTYPLGDVWPCTSLSRSLDQAG
FT                   IDREEGDDFVPFHKLTQWLCYSLVDAIESEAGWKVDKGLGQTGLPEYRNGGLFIDLGAL
FT                   TIKPESLGGNAYPNGKDKPPVLEPSHPAVIEWRAVTVISLDRIHNLLCEKLQVGKDVLA
FT                   LAQVLEAATWKGGREIAKEKRAGGGPPIDIVSDGTIF"
FT   CDS_pept        join(complement(236293..236328),complement(236188..236242),
FT                   complement(236061..236115),complement(235911..236004),
FT                   complement(235708..235859),complement(235351..235655),
FT                   complement(234681..235300),complement(234272..234631))
FT                   /codon_start=1
FT                   /gene_family="HOG000226729" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18941842"
FT                   /locus_tag="CNC00830"
FT                   /product="T-complex protein 1, alpha subunit (Tcp-1-alpha),
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42082.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000042E6CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL42"
FT                   /transl_table=1
FT                   /translation="MASTMYQRDPRAGLFLGGTRTSGAEVRDANVMACQTVSNILKSSL
FT                   GPVGLDKMLVDNVGDVTITNDGATILSLLEVAHPAARVLVSLATQQDKEVGDGTTSVVL
FT                   LASELLRRANELVRNKIHPTTVITGYRLACKEACRYMAEQLSTKVDKLGKDSLINVAKT
FT                   SMSSKILGADDDFFAPLAVDAMLAVKTINAKGEKKYPVKAVNVLKAHGKSARESFMVKG
FT                   YALNCTVASHAMKTRITGAKIACLDMNLAKQRMHLGVHITIDDPDQLEAIRARESEITL
FT                   ERVRKILAAGANVVLTTKGIDDLVLKEFVEAGAMAVRRCRKEDLRRIAKATGATLISSL
FT                   ANLEGDETFEASSLGYAEEVVQERISDDELILVKGTKIVNSSSVILRGANDFMLDEMER
FT                   SLHDALSIVKRTLESGSVVPGGGAVETALSIYLENFATTLGSREQLAIAEFAAALLTIP
FT                   KTLSINAAKDSTDLVAKLRAYHNAAQNAPLNDPKRGLMYYGLDLINGEVIDNRQAGVLE
FT                   PTMSKIKSLKSALEAATSLLRIDDSIQVAPEQKEEVDPHGH"
FT   CDS_pept        join(236594..236894,236947..237107,237157..237600,
FT                   237655..237792)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636077"
FT                   /locus_tag="CNC00840"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42648.1"
FT                   /db_xref="HOGENOM:HBG176277"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI000042E2A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL41"
FT                   /transl_table=1
FT                   /translation="MNRPISTLRLVLSATQPRFAPSPAVLRPFVSSTRLYATHHETASP
FT                   HSQSQATSDLLKGLGNKTGTSSGTQDTVGPFPLGVGPNGRRKTWKSWSDLNIGGKLVRT
FT                   TQQTGNLTVILFGGALFVVLTFALTTELFAKNSPSVLYSHAIDMIRGSNALDAYLLPPL
FT                   KFTHSPHSSAPVRGSPPIAHTFIRNPTSGKDHLVISFWIHGRAKDEEETLSWIKQGWRS
FT                   AVAWGKEGMDMLVGEKPEDVVKEDVEKKERVVVKKEPGTLSRWFGGLNLRSTAGSRVPL
FT                   AKELPPAGTYTVGEARGEYVKDEAGEFQMLSLIVDIPSSKASYPGRAVIFQSPEAETEG
FT                   LLGKRIR"
FT   CDS_pept        join(243460..243712,243767..243828,243881..243938,
FT                   243989..244051,244101..244236,244511..244833,
FT                   244889..244965,245016..245083,245137..245365,
FT                   245418..245453,245501..245597,245656..245845,2
FT                   45900..245924)
FT                   /codon_start=1
FT                   /gene_family="HOG000178876" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18092874"
FT                   /locus_tag="CNC00850"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42084.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051012"
FT                   /db_xref="HOGENOM:HBG324086"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00004302AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL40"
FT                   /transl_table=1
FT                   /translation="MSAAVPVVVDTHAVTNPRPVDQPDSLIKDDIEDKGELSYSDINDS
FT                   VETLDAKWYEPPDSYESKHRWDPEAKWTTQEETRLRRTLDIRVAAFACLCFAALQLDRG
FT                   NITNALSDGMLADIGLTTAGYNTGMTIFYCCFLVAELPSQMISKKLGSDVWIPIQMMAW
FT                   SIVAICQVAIKGKSSFYATRALLGLLEGNYVATAAAELTIRLSWFWVSLTTTTIIGSLL
FT                   AAGILQMRGVHGLAGWRWLFAIEGALTFLIGFWAWWYLPASPTETKKWWRPNGWFTERE
FT                   ETIIVNKVLRDDPTKSSMHNREGLSPIDLWRSIADFDMWPLYVIGLIAFIVPSTVQAYF
FT                   TLTLRNLDFSTFQTNLLTIPSNVMFIFMNLGVSFLSKRLNERLIVTTVQPIWHLIFLIV
FT                   IIALPDDVNRWAKWVVTSLLMAYPYCHPILVSMNSMNAGSVRTRTVASSVYNMFVQAAS
FT                   LIASNIYQPSDAPYYHKGNRVLIALSVVSIVMCWSAKAWYIWRNKQRAKIWDSWTISQK
FT                   EEYLATTKDLGNKRLNFRFLH"
FT   CDS_pept        join(complement(247193..247301),complement(246508..247031))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18941843"
FT                   /locus_tag="CNC00860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42086.1"
FT                   /db_xref="HOGENOM:HBG176278"
FT                   /db_xref="UniParc:UPI000042C109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL39"
FT                   /transl_table=1
FT                   /translation="MIDLSLTILDNAGANPDYTDDGRKTNLHQHGEKNLECYRTLRIHD
FT                   EHDDKSHSHSYSVWCTDEREHYDLEKDPKQINNLLSPLNELGAFSPFNSTILNGEPALS
FT                   HHLQNLFNRLEALLLVLKRCTIGEACHNPYRELAPSSQATGGEIFKFSQILESRFDAFL
FT                   RTCPRFSLISVLWVSKKNWRNLIGRMSGSMVRMRVMRLGEGIVFQGF"
FT   CDS_pept        join(250472..251020,251078..251965,252014..252868)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788718"
FT                   /locus_tag="CNC00870"
FT                   /product="Mih1p, putative"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="M phase of mitotic cell cycle "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42088.1"
FT                   /db_xref="GO:0000087"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG176279"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000042C1CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL38"
FT                   /transl_table=1
FT                   /translation="MALFGSSPLVDAFPSPRFSEPPSPTKTETDLPIDVDQSFNSSLSL
FT                   SDSPYFSPTPSMAVGAKSAGSSSMLSAAPPSFSLKCKQPEAAPTQVKPPLQSKSTTETT
FT                   LGSGQLSRGRSFGMDITNNVLHQPDSNIRNNKGKMLPPAVPEARMLKANASVPMQWTSS
FT                   NEELGECSKNSSLFGVPRTESDPAISGSPLSSLSRDDSAMQVDSPQIRSNSRPGSLMAS
FT                   PALGGPASCSSSPDLGSFFCDSPAPSSQAPPAKRRSLVSGPPASPSSGSPSAKRTSLGL
FT                   GVSRPPLDKTASSSALLFGGGRANTVASRRGPSYKRPTLGPLAAPSCDASRTASTNSAF
FT                   PILYGPPKQTLGQSGTFPRAANAPMRRAYSVCDQNTANEMDDDDSEFENSPCVGAHAEY
FT                   ARRYGARMGPRIDGSPGFKSVRASIAASGEGVVSPLHKGKKTSPYGPGGLPGFGDNEID
FT                   GKILPCHKVKEDGLVRITPDTLDELLSGKYSHKIKRYHVLDCRFDYEYDGGHIAGAINV
FT                   KSMDALDKLLLSEADGIHADGECLPRPSRSGQLEDGQPVVLIFHCEFSAKRAPTFAKHL
FT                   RSRDRLLNNAIYPKIYYPEVYILEGGYCGFYQTRPERCDPKGYTPMDDPKHFERRDSDL
FT                   HDFRKFSRTRSFTYGEQQQPSSRALLPCPPLAFAAASAAAARRIGAQGGSTSGNNTIKE
FT                   EDDQDNSSSPHPGDSSAEMDTDASPCPRAVLSLGQPPIFGSAKTRVLGRVGFSRVASYA
FT                   GTTTIPAPRP"
FT   CDS_pept        join(complement(256493..256616),complement(256372..256443),
FT                   complement(256233..256319),complement(256064..256172),
FT                   complement(255945..256015),complement(255545..255894),
FT                   complement(255279..255346),complement(254907..255112),
FT                   complement(254203..254856),complement(253713..254149),
FT                   complement(253463..253660))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804415"
FT                   /locus_tag="CNC00880"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42090.1"
FT                   /db_xref="HOGENOM:HBG067683"
FT                   /db_xref="HOGENOM:HBG176280"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniParc:UPI00004B43C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL37"
FT                   /transl_table=1
FT                   /translation="MTSRNPTVNMSSSKPIKPMVINSNVRNTSHSTVLGAKRKVDDVLN
FT                   SSSEGEGKENGATQKKKALDATLGQPLFELRNRKLLFKQALPSRNLPRRRILNFQGYVL
FT                   DEVEGGRTINEIPEEHWALIAMAGNEMSSANEGSFVKQLKAALGLEPAEQKSLPNEVLT
FT                   VISRKLFTLSHYGFFPSQFPNSVKIPSSLQIRCWEVNEPEKWFPSEELEALRARRTERE
FT                   SLTEECFKLLQGMTDAQKIELVGGSKDQKDTPSKSASTAEKSALPKEIQIEADRLKKKQ
FT                   RDEKKAIWAEKKAVSSSNQALSDYQKTFRPLPPKKYVKTAKVNEWIRIENGINHAAGDI
FT                   SGGKVEQWINEGSPDVEGWSSQDFIKDHLKKHGHQMRHPRRNLPRGFKVAPIDGSVGEL
FT                   WAALQVAEEPREVLDQLRDRRRFPWKTLAFDQQPRPPYSGTFTKKSLVVGPRTPFAQDP
FT                   IFDYSYDSGDEWQDDDEGEDVDNFGGEKNLEEEEEDEDEEDEGEFDDWLDDSEDVEATQ
FT                   PDSMDVDDAPEPEKLSRNVKKLKEQPIKRIVKLVPNWKGPIWENRIGEKGTEGLESYRI
FT                   QLLNDTPVSLNPFTFESTDTPQQYKANYSTTVIGHNLNVRCLLSVETIVQKEQPGPITK
FT                   LSPVTAAAMSSPVPRSELPRRVRSAFPSSHIPELYRLIEGDNRYLKDMITFLREKFDGV
FT                   ATKVSIENELKESAVREGRSKDSVWRVYREAWIAAGLEPAVSAPSRPPTAPSTTAALSL
FT                   NPKSTVNQPTNLPSPLDQSLQTSPVQDGSAAEPTVVDS"
FT   CDS_pept        join(258601..258653,258709..260086)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18941844"
FT                   /locus_tag="CNC00890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42092.1"
FT                   /db_xref="HOGENOM:HBG176281"
FT                   /db_xref="UniParc:UPI000042D0B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL36"
FT                   /transl_table=1
FT                   /translation="MFEEDFERCFICQGPSKGLYCSSMCRQKDQGSFSPQVNPDQESVH
FT                   ITSQLPPALSPHVRPMNTISLSPRNSGQPRATSNGTSSGSSSVNSSPLHSPQTNPSDLD
FT                   SPQKGLFNLPPPAYPVTQFGAPPSAVPMKIPPLLPRASPIFGAIGTPGSQGSTVYPHGA
FT                   SIDTLRFGRRPGAVNSVTSPNALIPRCACGLPANHRTRARSKDRADVVDSGFSRLSLGP
FT                   SVVAREEPISRSLRIVSDSAIPPFTLSPKGTPQTITATLNHSGPFHTEQCSPVAPNNVL
FT                   SRSRSDPIPPSPKVGKRTLAPVPVVSTILPIRRQSSHEPERRTNVLEVSNIDSPRRGRS
FT                   RERQEHHGDAEDCPPAILNHPPEREAAPSRSRTRRDSRRRSGERSRSRPRERIRDLDMS
FT                   RDREHDGQRSPVSHEGPQILPSWSRPASVADHVVPLSMKGQSSGDKEKYARDEDERKRE
FT                   ELRRATNQFGQVFGVAAG"
FT   CDS_pept        join(260901..260986,261185..261584,261645..262082,
FT                   262133..262865,262918..263001,263057..263303,
FT                   263360..263460,263511..263560,263613..263684,
FT                   263735..263974,264026..264350,264400..264494,
FT                   264545..264810,264864..265236,265297..265389,
FT                   265442..265504,265559..265708,265791..265792,
FT                   265847..266003,266057..266107,266154..266492,
FT                   266543..266800,266860..267108)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804416"
FT                   /locus_tag="CNC00900"
FT                   /product="ATP-binding cassette (ABC) transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42094.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG067682"
FT                   /db_xref="HOGENOM:HBG176282"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00004B43C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL35"
FT                   /transl_table=1
FT                   /translation="MVVQDLAQSVFSSVSESLVEVAKNKNKNPQSYQPLLINDEELDVE
FT                   TEAVEVTPIPPSMPSGGLLADFKAHVRSMKEFGSVLFGLEILRTLCLCALLGLSIYATI
FT                   LAESPEEHQTVYEDGTVEDMAKQWGRKKNKKKKGKHSKSTVDDYSSLEWGEFGVSGFYL
FT                   YTLIFSLLLLTLRPATRLRRHIITHLDSLLLLAFAVYAYRDIWPLFTFNLDPADINTPV
FT                   TWARVAILTVSAVLIPLVRPRTYVPVDPENPSPPGEIHPEQTSPLLFYMFFEYMTGLVW
FT                   KAWKTPALPYEDLHPLADYDRAEYLYKQHMDKLDPVRRKEKGLKPRNLVLSLASVFKKE
FT                   IVMVSLMSALSAIFELSGSVGINQLLDYLEKDGKGHSLRPIVWIIFLFLGPTFGSLTMQ
FT                   FYIFTTTRSLVRSEALLTQLLFDHALRLRMKDQVDDDREKEVDSMTNGEGSAPLITVED
FT                   VEEVIDHAPGAPGEFHDRFDNETEEESTAQGNGKRKSAPQSTDATEVGSANGSNKDAAV
FT                   DRKAAADEEARKSKGQGLAGKINVLMAADIESVIEGRDLALIFVYTPVQFVLCVVLLYR
FT                   ILSWSSLIGMLTMFITLPLPGLLTKLNAQFQQKRMLATDSRIDTITESINALRIIKMFG
FT                   WEDRIKERVAAKREEELTLIWQRRLMNLFTTLLNTVLPVLTMTVTFAVYTTIQKQQLTA
FT                   AKVFTSMTVFELVKGQLGMCFYLINSVVTAWVSVRRLDKFLHESEMIDEYSEGKLATIK
FT                   PPEQLEAEQEGLIRIHNATFTWGSELYTSTEIPFRLSIEDTTFKKGKINLITGPTGSGK
FT                   SSFLKALIGELHFEQKQGAFYHLPREDGVSYAAQESWCTSDSVRDNILFGEPFEESRYW
FT                   KVISACGLEPDLKLFDDGDLTEVGEKGITLSGGQKARLTLARAIYSKTAVVLLDDIFSA
FT                   LDTLTSRWIIDNLLSGDLVKDRTILLITHHIHLAAPVADFIITLNEDGSVRSQGSIKEG
FT                   TLDASELQEAEEAEEQELKEAKQGEKKVEEKPTTKLIQAEEKSEGRISRKALFAFFRTF
FT                   GGPIFWFLYFGLLVGGQAMSSFETYWLGRWARAYDQAEDPRKVSVTFYLGLYFVFVLIG
FT                   LVQLAASAIIFYMGAVKASREVHKRLVNTIFGAYMRFLDSTPVGRIISRFTKDMKSVDG
FT                   SFTETFANVADVTVGLALKIIVVISLVPLFSLPAVFIGCLGGILGEMYIHGQLSVKREM
FT                   SNAKSPLFSHFSAAFNGIVSIRAYGAQQKVRKEAQRRADKYTRAATAFYNLNRWVTIRL
FT                   DMLGGLFAASLAAFLVYGPRLDASTSGFALSQAISFSSMILWWVRMVNEMEVQGNSVER
FT                   IQDYLVIPQEPAFEESKQPPAAWPTSGEIVLDHLSAKYSNDGPLVLDNLNLTIKSGEKV
FT                   GIVGRTGSGKSTLALALLRMLPTTGKVLIDGVDTGKINLHALRSNVTIIPQDPILLSGS
FT                   LRFNLDPFGEHDDYELNDALQQSGLGATRQPGGIGAATPQRLTLDTHISAGGGNLSQGQ
FT                   RQLVALARALVRNSKVLILDEATASVDFDTDTLIQKSIRDLPSSCTVLTVAHRLSTIMD
FT                   YDRVLVLGAGKVLEFDAPETLKKNSDSYFGKLCQAMEGKSSDER"
FT   CDS_pept        join(268223..268240,268615..268632,268688..268768,
FT                   268829..268923,268973..269191,269241..269379)
FT                   /codon_start=1
FT                   /gene_family="HOG000138319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804417"
FT                   /locus_tag="CNC00910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42097.1"
FT                   /db_xref="EMBL:EAL21598.1"
FT                   /db_xref="HOGENOM:HBG065804"
FT                   /db_xref="HOGENOM:HBG176283"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI000042EF61"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL34"
FT                   /transl_table=1
FT                   /translation="MNPHKMNKVDISQMNEQDQKAFKLYGKVPGKNLLTKMQKERKYFD
FT                   SGDYMMSKAGVPTASPPGTAHPTPEAVPHASPPSGPGGYLSSSPTGGSLPSPNIMEHGI
FT                   GGEKCAHNVGVGISPAATSEAIEMPGHGHHHGHQRRGSESRISPPNTWRESVNPSSFPI
FT                   HHPGIFGGSPVKASSLAKRVDEEGEQ"
FT   CDS_pept        join(268591..268632,268688..268768,268829..268923,
FT                   268973..269191,269241..269379)
FT                   /codon_start=1
FT                   /gene_family="HOG000138319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15804418"
FT                   /locus_tag="CNC00910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42096.1"
FT                   /db_xref="HOGENOM:HBG065804"
FT                   /db_xref="HOGENOM:HBG176283"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI000042CFF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL33"
FT                   /transl_table=1
FT                   /translation="MVVFPVIQNKVDISQMNEQDQKAFKLYGKVPGKNLLTKMQKERKY
FT                   FDSGDYMMSKAGVPTASPPGTAHPTPEAVPHASPPSGPGGYLSSSPTGGSLPSPNIMEH
FT                   GIGGEKCAHNVGVGISPAATSEAIEMPGHGHHHGHQRRGSESRISPPNTWRESVNPSSF
FT                   PIHHPGIFGGSPVKASSLAKRVDEEGEQ"
FT   CDS_pept        join(complement(271796..271831),complement(271695..271727),
FT                   complement(271500..271631),complement(271373..271446),
FT                   complement(271012..271323),complement(270538..270960),
FT                   complement(270327..270483),complement(270081..270269))
FT                   /codon_start=1
FT                   /gene_family="HOG000243799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18092875"
FT                   /locus_tag="CNC00920"
FT                   /product="Glutamate dehydrogenase (NADP+), putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity, acting on the CH-NH2
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42099.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016639"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG518222"
FT                   /db_xref="HOGENOM:HBG590661"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000042C5F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL32"
FT                   /transl_table=1
FT                   /translation="MSNYPSEPEFQQAVAEITQTLEPFLAKNPEYRRALDVVQVPERIV
FT                   QFRVTWERDDGTIAINRGYRVQFNSALGPYKGGLRLHPTVNLSILKFLGFEQIFKNALT
FT                   GLMMGGGKGGSDFDPKGKTDSEIRRFCYAFMQELSRHIGTDTDVPAGDIGTGGREIGFM
FT                   FGAYKKYRNENAGILTGKGADWGGSHIRPEATGYGLVYYVTEMLRDLDNTDWKGKRVLI
FT                   SGAGNVAQYAALKVIELGGTVLSLSDSTGALVATGDEGFTPEEIMNIADIKLQRKSLTA
FT                   FATGSKFQWHEGKRPWTLVSNADIALPSASQNELNDEEAKALIKAGVRYVAEGSNMGCT
FT                   LDAIKIFEESRTAAKNATDAGVCFYAPGKAANCGGVAVSGLEMAQNSQRLKWTHEEVDA
FT                   KLKAIMINCYQTCWETGKQYAEAGVVPSLVAGANIAGFVKVANAMREQGDWW"
FT   tRNA            272703..272784
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        join(complement(280137..280619),complement(279728..280085),
FT                   complement(278948..279676),complement(277247..278899),
FT                   complement(276865..277196),complement(276356..276815),
FT                   complement(276180..276308),complement(275669..276131),
FT                   complement(274922..275621))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18941845"
FT                   /gene_name="IML1"
FT                   /locus_tag="CNC00940"
FT                   /product="Vacuolar membrane-associated protein IML1 "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAW42101.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG176284"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022046"
FT                   /db_xref="UniParc:UPI000042FAD5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL31"
FT                   /transl_table=1
FT                   /translation="MEGGVLDLSLLNKDRDNVALLLYTYKPLLNNTGASANPAHPSLLP
FT                   SAAASPNAPSSQVIINYAALPWNVQPGDYLEIRQINRTQPKVPTASTRIQGMEGEKPQK
FT                   IKRPPALEDVKTGKGREGYVFRLGEDSPTANIHQIQVPDSVATAFGFQNRLEVEVRRIH
FT                   DKESSHADYIEFYFSQYLGRADMWRLGMSLEGTTLHVGEKVSLAGGAVRAEVNFIIRDE
FT                   KSKDGIAKPKRYSSGIVTAKTKTIFRSKSAQVYLFIQLCEETWQFDEDGERYVEKVVHG
FT                   YLPELFARWADKGTSHVVTIIFFARIFYRDDEVDYLRKHDMVDMLSQDYSGQWYKDFFK
FT                   VAVDLERRNDWMSSLPEIKRQLERSEREILLDYHLRLLKAKGAAEEEIKIVGKWCFAYQ
FT                   GNVLEAINLALNPFDEHYVDRDLSRTGLSITVVTPGTGHFAVDKNLLRLTTERMVDHGM
FT                   SVDFVCLTKMPLHSVPLFSYVSHRPKGPVQHEDGIGAKAKPVVPDLLYFDANLSQVKDI
FT                   ELADCYSLPSWVSTSFYAVTHDKPFREDRFVARCKMYDIQMLGILDHNLTTVTVPLLNV
FT                   DDTPMPRRPLTVDDRKAIRDSFDQSIFSGISDLVKTGSSPLDSAPASVTASYQSARLLA
FT                   EKAKERTSSMSLSKPRGSDIANSSRLSPIKATSESDNIDLGKKTTPRSPSPEPSSLSLR
FT                   RGSRRSLSPTKMTQLAHTSAVTNELNKDSPSLLKNSRPGSPITMARSISPVPPLPPTRE
FT                   QGDSPLSPVDSLPLSASVERSPSPSRRSVRSNMTDREHLGSGASTPKGTPAKSLRSQPS
FT                   KGFIPSWVLNSFKPLLSTSKPSFAVPAMENVARTDVATGDDNRPSSPSPSVGSLRGRPS
FT                   KGGPNPKPIITPSTPSPSRSQKPPFKPAKIIQTQPHTQAQGTQPLPIAAPPASRLPSQS
FT                   EEDAISRSFRNKGHGLSRSHEDSSLRAQSNALVQSSRHFTINPCKPSAETIDRVRDAGG
FT                   RRWRFVLPKLTQQHIVQWPSLIAPACLPLTTDFLPDQKQSDELYTTGTYTVQCYLEDDQ
FT                   FLIRSDAAETNLALAMMREMVSQRLSQNFQVIVQPHELTEPEKPRPMPIHLEKDADIGV
FT                   ELVSGGASEVLKKGQGAIWLSWANHIHRLLFHPTKPEIVVHWMTRKITHQTESVQWKGL
FT                   VWPSGMKGYQKASATFAYPDVSMKINYNHLDHLINGERIDFAPLRYWRTRFILIPSGRE
FT                   PVTFPGLMPKNENLGSNDLLWLGAQKVMETLNRYLLKRPEGTPQQRSLKIVATTFDPST
FT                   CVLDEELMMDLARQIHGDSSGDKKKKLEGMTLANVAELMCQPDNGLVIRTRWWESRQHV
FT                   SSFNGFELREWLQNTFEDVTGREKAQEWAAELTNKGLIEHVTKSHGFLDYWHLYYRLRE
FT                   PYNHMYSHLAKKEGKNKSWFSTSSKGSRAAPPSLTSSQASSSTVIAAAVADPSQATADL
FT                   NTSQSGKDPSAGEQDQSSLAKIYLKVHKGEPKQGGKKRKIMMTQKRVLDLDPSRKSDRA
FT                   EVAILHADVVHNARNAFHFELNWLGVTAALLEELRQKLSAQSERYGLRFVETPVEQIAD
FT                   IPKKCAYRTPIPIRLALAPPVIPDLHTRLVAVAHGTGQAENYFEYSILTKKFGFVLDVE
FT                   ATDRYPDNVEVVYSYRKAGVKYTYSQFCHKTGLALVQCVGGEAGFLWSDNRLVVSAPTR
FT                   KGVGNRVDEARALRKELEDFCSDAEQLSKFYEEVLPPPPTTGESTPEEGQEEFEAKDDE
FT                   EEQPAPQEKTEL"
FT   CDS_pept        join(281720..281983,282032..282913,282966..283310,
FT                   283366..283590,283644..283820,283874..286315)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788997"
FT                   /locus_tag="CNC00950"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42103.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176285"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000042CBE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL30"
FT                   /transl_table=1
FT                   /translation="MSFVSSETPNAIASSSTAHAGSANSRARHRLDNGLRYHSNHLSSD
FT                   CRPLPRSAPRKQRVASKSKKLRWRKGLVTEAFRKFGEHCARNQIRTLLIDCLVMTNLFY
FT                   PSLALYLPKRFPPPSPRAVQDAHWPPLDNDVTSPYRTNVDHPLSFSTLGRLFPSAPPLL
FT                   PRLTWAGWWGSGTREREDDGWTATRAIPGAKEIGEGQNDQVWVMRIGWADVEDVLDRHI
FT                   EDGERKWEERDHHLLKLVQNVAENWERQIPSNRQRCVRQLKSSTSVRGDGVDSEPPPCY
FT                   VLTPSPDAFDSAIPISMSGFVHFDHGVSASPDSVPLGRSPNPDNIYHTFAALFHVPQNS
FT                   TSAFEQRWQSAMSDVAKEVEGEVFVEAKGPRVGDQIGEWFISYASSPLSQQPNLTGPIS
FT                   SDRSKIFSSSPPPIIIVLYVILFTTLIVQLSNASKAHSRFGLAFTGVVQLCCSSVMSFS
FT                   ILALLGWNGWGVPHAESSLPTYVLPFVIVVVGAENMSTLTQAIFSIPFTHSVPVRIGLG
FT                   LSKVGTTIALTSLTDLGILSVVWLCVNLQPVREFCLFAAVVIVTDWFMLHTFFLTVLSI
FT                   DAQRLELADVLASNKVGMVSPVESTGEKDAQNENQGFLWRNMLRARTTKSGSLLLLLFT
FT                   VGLLYWLTERHRSPLNTTASLYGYTPTARSTSVSVPTPTASPFVSTPEAISVLSSAEKL
FT                   WRALNPEGWPFAHVIVPPASILVLPKFGHSMRPGDIRKLSLPASRLLIPRLKALFYIFK
FT                   VLVLPQAITAGALYALLLYLLKDADLLDAQRNRLGRMGDAHEDESDFRGSTKNASGLLN
FT                   CLRARMLPCSHEADVDVIASSSDGRIAISVAIDNSVCLWRFLDTPGSGTREPLPTGGLD
FT                   GGDAIVAAAVSEDGQHVAVCTNMAVVQIWEVPREGAVVPLQVRKPEQTFTAKILGIAFD
FT                   ETAPNVDDPFTANEPATEEARKATSIMIGYGDGSVMALTEMDAKVVIPAQDRGAYSSCR
FT                   VLFMREIGGSVSILIARQHDIDIWRKSTFGWVSSSLIADLPGEDRVTALSPLNAELPGV
FT                   FAVGRRSGNITIYDESHGQLELMPQGSSIEGVRKIQLVRPSSMKCLGCGLQSAEGYAII
FT                   SSTSSQVSIDRIAPRTSIPTFCRCTRRVSSADDVPALMHRSDSPQRSKPNSLIVPPVTF
FT                   RQRPTPGSSPHKSISLLSPVSNGEFPLSSHGSARRSSNFHREDDSLKIISSPHDRSALS
FT                   SIGGGSGLVSPSGDMEVTSLGGISAQGASDGGWAILDGDVLVGVRRGREGIDDAQWQVW
FT                   SVDMTAPWDMAGLVVDSIDLSELQRRTFEADCTIRGQASGGGSTNGVVSMRDRRTERLL
FT                   SLNGRASFPERVGSFAVPTYESLGYVEVVGLNILGTKGMIGGFGNRLGTISLERFEEKK
FT                   VIGRSSMDGQLGMGLGGLTPTRRQSLFPLTPPPPCDGSIGRF"
FT   CDS_pept        join(complement(287562..287739),complement(287288..287373),
FT                   complement(287136..287227),complement(286963..287077),
FT                   complement(286793..286910),complement(286660..286733))
FT                   /codon_start=1
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805472"
FT                   /gene_name="SNF7"
FT                   /gene_synonym="VPS32"
FT                   /locus_tag="CNC00960"
FT                   /product="Vacuolar-sorting protein SNF7 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAW42105.1"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG371348"
FT                   /db_xref="HOGENOM:HBG618740"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000042DED7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL29"
FT                   /transl_table=1
FT                   /translation="MSGWMSYFTGRKDTRESARDAIVGLRQQLLMLEKKEEFLQKKIEE
FT                   EMKKAKANATGNKRLAMAALRQKKAHENELDRIAGTRLTLETQVNAIESANLNAETMVA
FT                   MKKGADALKGIHSNLTAEGVDATMDKIREQMDLTNDISDAISNPVGMGIVLDEDDLKEE
FT                   LEALEQEQLDDRLAGADRVPSHLPASPVGQTTGRAAVEEDEDDEEAQLRKLQAELAM"
FT   CDS_pept        join(complement(289305..289428),complement(289062..289226),
FT                   complement(288882..289009),complement(288654..288826),
FT                   complement(288224..288599))
FT                   /codon_start=1
FT                   /gene_family="HOG000244407" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942088"
FT                   /locus_tag="CNC00970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42107.1"
FT                   /db_xref="HOGENOM:HBG055796"
FT                   /db_xref="HOGENOM:HBG324561"
FT                   /db_xref="UniParc:UPI000042F40A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL28"
FT                   /transl_table=1
FT                   /translation="MSIPLPDTSSVPSHALDALQEDALLPICKTCGTQYPSPRDDCPIC
FT                   EDPRQWVPASGQAWTSLADLGSKSKHSLLPDKEDVRISHIVTEPAFAIGQTPFLIETAG
FT                   GSYIWECSAFLSLGLIGHLSELKKPLKAMAISHPHFFSSSLTWSRALNIPLYICAADKE
FT                   WYSRIGDLKDSDDVRLWSRETELGPGVKLVQCGGHFPGSCVFYWDRLSEPPPSPSNLPT
FT                   KPTPVSGIIFTSDTLMVQPNQTHFTFAWSIPNMIPMRPKAVLRIKESLKGVEYSQATSS
FT                   WPERWIREDAKKALEESVVRYLGAEGWRFEGDSLFELVTQ"
FT   CDS_pept        join(290039..290156,290212..290244,290307..290315,
FT                   290387..290568)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805473"
FT                   /locus_tag="CNC00980"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42109.1"
FT                   /db_xref="HOGENOM:HBG176286"
FT                   /db_xref="UniParc:UPI000042F409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL27"
FT                   /transl_table=1
FT                   /translation="MSASNTDAYSAGTSGVDQKGNTYVAGSKADGSAGANAAQTAGDKV
FT                   KGGWNVFHGTGEGIRGNINSFVDNIGEQIAGRDPAAAPQRSTAGGERPAEVTSKGADEF
FT                   RTGVQQLRH"
FT   CDS_pept        join(complement(291995..292034),complement(291795..291837),
FT                   complement(291717..291736),complement(291526..291653),
FT                   complement(290940..291396),complement(290861..290886))
FT                   /codon_start=1
FT                   /gene_family="HOG000158315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805474"
FT                   /locus_tag="CNC00990"
FT                   /product="ATP synthase, putative"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAW42110.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG057729"
FT                   /db_xref="HOGENOM:HBG328743"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniParc:UPI00004301D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL26"
FT                   /transl_table=1
FT                   /translation="MASRFAIKSLRSAAIRPAIAPRAVVAQSARFLATQPTPDEKAASI
FT                   INSVPSSSLFTKTGGVILGTGLTAAAVSSELYVANEETVLLVGFLVIATVIGKSVSAPY
FT                   AEWANGQIEKVKSILNSAREEHTRAVTDRIDSVGQLKEVVPLTESLYAVAKETNKLEHE
FT                   NFILAQENAVKAELKSVLDSWVRYEQQQREAEQIALVKTVQANVEAELAKPAFKKQLLE
FT                   EALAQVEQIAKSKAI"
FT   CDS_pept        join(292247..292414,292462..292650,292697..292885,
FT                   292931..293824)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788998"
FT                   /locus_tag="CNC01000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42112.1"
FT                   /db_xref="HOGENOM:HBG176287"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniParc:UPI000042E2A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL25"
FT                   /transl_table=1
FT                   /translation="MSDSESAADLFGDEGRSRNNSPGYEKSPSPQLSHKSDDEEQDDEE
FT                   QDDEEQDVGDLFGDDAEEDEAQIGRRSTDTPASGSRSPHPLEYVEEDEEAVPQKQNVVT
FT                   LPIPQWPHMTATDGKVWQMKFPAYVNLDPKPFDPDLYRATQEEEPIDGAADPIAAKSMM
FT                   IGVKNTIRWRWVTGPDGEPVRQSNARMLRWSDGSVTLQLGDDFYDVAPSQGATLARPSD
FT                   PQPVRKRDDKPATNSSTTFLCVGAAAERVLVTERPIAGQLSLLPTSMTSKTYLELVKHV
FT                   GKQHTKHSKMKMLEETQDEEALQALLLKSAPNREAIKGAKSTVRRTSSKTGLGKGKKTR
FT                   KIGYSDSESDAGFSPDERRPRKKPERESVEYDDDDGFIVSDSDEDDYASKKKKAKGKNK
FT                   KRKGFTDDEESLDEMEEAERRIEERERERKRARKDKGGPSKKSREYVDTEDEEDEKKVD
FT                   DDDAEGEEEMDMDMDVESEED"
FT   CDS_pept        join(295034..295087,295142..295192,295251..295281,
FT                   295462..295499)
FT                   /codon_start=1
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805475"
FT                   /gene_name="PMP3"
FT                   /locus_tag="CNC01010"
FT                   /product="Plasma membrane proteolipid 3 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAW42114.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG440391"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI00004B43C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL24"
FT                   /transl_table=1
FT                   /translation="MAFTCSDIFKIILAIILPPLGVFLERGCGADLLINILLTILGYIP
FT                   GIIHALYIILKY"
FT   tRNA            296457..296538
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        join(296763..297078,297139..297220,297273..297327)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805476"
FT                   /locus_tag="CNC01030"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAW42115.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG175907"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000042C5F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL23"
FT                   /transl_table=1
FT                   /translation="MAALQLTNRSLNTPFFSLRSFLPTLRSSWSTPCEASSSSSTLSSS
FT                   LVAHAPSTSSPSLSSLFPSFSLESLLELIPPFLWASVPKKKVSHSRKNMRAANKGLKNK
FT                   TNLSLCPACGSIKLTHHVCPTCYSQISRRWKEEARNQLPSALHSHP"
FT   CDS_pept        join(complement(299989..300622),complement(298776..299939),
FT                   complement(297743..298728),complement(297616..297696),
FT                   complement(297465..297557))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805477"
FT                   /gene_name="EAF1"
FT                   /gene_synonym="VID21"
FT                   /locus_tag="CNC01040"
FT                   /product="Chromatin modification-related protein EAF1 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42657.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG175908"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000042F710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL22"
FT                   /transl_table=1
FT                   /translation="MRHVRAMERIEAKKAENRWSLRQPKKARGPGVPKSHWDYMLEEME
FT                   WMRTDFAEERRWKVVEAREFAYQVVEWHLASPEEKKALMVGGRGWGECRNVPIPGHAGK
FT                   RKEVTVEVEAEDEDVEMLVGQEGELDGEGEANKVLESIDEMRVNEKERENRPEDPRETV
FT                   NINQDIGEEVDAEGEADADGEPENGEADAEGEADADGGPVGDDVVGLSEIDAAQDDTRE
FT                   TSERPSYRRDTVLPNGLVIHKRFANAYEIAIARGPVLDTPLANATVDLDTLTKSSSAAT
FT                   PATVPAEPSVSPDEPASFDQLFPDLAMYSGPAPPENDKKYRRDEGGTYSHRMAHTSRIM
FT                   DIRPILVSTLQPAKNLIDGEWDLHDGPYYEEVKGAADIPPNVVAAFNTPFGGKASRPLE
FT                   HMRVPEVPKPAAHHLRAQLLWSPEEDKCLLKLVAMYPFNWDLIADSFNTEMILIPVEKR
FT                   NPYECWERWYYTFGEGKNKPRQDAPPSAPPPAPASATQPGTATATPVPQSAVTTPGVPP
FT                   SANLPSASGRPQQTGGNSVSSLPTPTGEALPDGAPPPPGMSKRDRMAAKPKYEGTKRSV
FT                   RHQAIYDAVKRMNRRREAARAKSHKDNAQRKVINVHESHSMSFPHVAASTPWELVEAKY
FT                   QRDVQIAQQRQQRAMQEQQRQLAIRQQQAMMSAQQQAQMRPPNMPNVPNMPNAQPIRMG
FT                   PNGQPMPTMAPSQQQLLNAVAAATAANRQNANGAVQGNPNVRPMPVVQGQSPQVQQQML
FT                   LQAQQMAAQQARVLQAQAQAQAQQGRAPSMGGNLQPPQLGVSSPFAQSRTPDLPAEGAG
FT                   PSGINPTPSPAMQAAAIGAQSSPQIATMGRAPSNNVPPHLRVPNAGTSSPQISSPMALP
FT                   QGIPNGAGMPVQGAQTQGIQIPAAMMNNATVQQLLATLAASGQQMTPEQLRGLMLRSAH
FT                   MQAQAQSQVGNPGTPQMGVQNIQGVQHFARSPSLQNAQSQPRSSPKPGPANGQGT"
FT   CDS_pept        join(301999..302284,302338..302469,302529..302658,
FT                   302718..302848,302899..302993)
FT                   /codon_start=1
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805478"
FT                   /locus_tag="CNC01050"
FT                   /product="Protein-S-isoprenylcysteine O-methyltransferase,
FT                   putative"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42117.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG299304"
FT                   /db_xref="HOGENOM:HBG737603"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI000042E6CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL21"
FT                   /transl_table=1
FT                   /translation="MSDQTSQSPVSLPRTDQYDPRGSIPNTVFAVALIASILGAVGGSS
FT                   LALASQTLFNAFAGTWARPQLGIYLGAMCIFHLMEFFTTAGWNPQKLSVDAFLLNNGRQ
FT                   YHFAHAIGLAEYFISSWLFPGKWNTFWGSFPWLTLVTLGMVAAQCIRSMAMIQAAQSFS
FT                   HIVKSKKHDDHLLVTHGLYSWSRHPSYAGFFYWAVATQLLLGNIVSTLGFMIVLNKFFS
FT                   ARIVDEEKWLVKFFGNDYVEYRKRVGTKLPFYFSK"
FT   CDS_pept        join(complement(304670..304732),complement(304256..304609),
FT                   complement(304090..304197),complement(303105..304040))
FT                   /codon_start=1
FT                   /gene_family="HOG000210038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805479"
FT                   /locus_tag="CNC01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42119.1"
FT                   /db_xref="HOGENOM:HBG025554"
FT                   /db_xref="HOGENOM:HBG749683"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000042D4C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL20"
FT                   /transl_table=1
FT                   /translation="MGRQRRKNRTHLKGPPKGETEENVPKSFVIKSGHVTKSISQLVRD
FT                   TRKVMEPNTASRLRERPNARLRDYLTIAPSLKVTHLLAFTLTDAANVHLRVARFPQGPT
FT                   MTFRVQKYSLMKDLFNSGLRNVGRSPAGEYRNPPLLVLNGFQQPQNGPALPQLRLMSTM
FT                   FQGIFPPIQVEKSALPTFRRVLLISYSHVTGCISFRHFTITVRPHGVSRRVRKLLSSTV
FT                   TSANPTSSKSRKTVDLSNTDDIADYLLRRTGSETSGASTAGYDSASETEASEAESDTNA
FT                   VELPEDYVGRGNKKGERKAVRLVETGPRMEWRLIKVVEGLVGSKKGEGETVFHEFVHKS
FT                   AKDANAQAQAHERKRKAKEARRAEQAANVARKKAERAKKKGKAVGDGEEDEDNDSEEEP
FT                   DIEGLSDIDPEEELERLRERKVGFQDEDDDEDFEYEDRGANADDEDDDDWGEDVGAGEG
FT                   DVTSDDEESSEDEEAKPPPKKRASGKRK"
FT   CDS_pept        join(305730..306187,306237..306826,306875..307012,
FT                   307065..308186,308235..308796,308851..309124)
FT                   /codon_start=1
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805480"
FT                   /locus_tag="CNC01070"
FT                   /product="Glycine dehydrogenase mitochondrial, putative "
FT                   /EC_number="1.4.4.2"
FT                   /function="glycine dehydrogenase (decarboxylating) activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glycine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42121.1"
FT                   /db_xref="GO:0004375"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000849"
FT                   /db_xref="HOGENOM:HBG286723"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniParc:UPI000042CBE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL19"
FT                   /transl_table=1
FT                   /translation="MSVSILRRAARLPLSRQHQPLFARPLSISSIVLRPTSTSPTRSST
FT                   TATQPHPRSPSESFHPAPTSVFTPLDTFLPRHLGPREADIQAMLEVLGHKTLDEFVATT
FT                   IPSEVRIDQLTNKEEKGKGLRALSELELRRRIEEIAAMNRPVKSYIGMGYHNAIVPPVI
FT                   QRNVFENPAWYTAYTPYSPEQSQGRLESLINFQTVAISLTGLPIANASLLDEGTAAAEA
FT                   MAMCLASVAKPKFNKGKKVFLVSPNVAPQTIEVLQTRASGFDIDLRIAESDANFLSEVE
FT                   SLGEAQLMGALVQYPDVNGEIGDWEEVATKVKATGAKMVVTTDLLALTMIKPPGEWGAD
FT                   IVCGNSQRFGVPAGYGGPHAAFFACTDDLKRKMPGRLVGLSKDSQGAPAYRLALQTREQ
FT                   HIRREKATSNVCTAQALLANMAAMYAVYHGPEGLRRIAGKVHSLTRVLSESLASLGFTT
FT                   VNKAFFDTLTIDVSSAGVTAADVHTASVKAGINFRKIDDKTIGITLDESVGPLDLTDII
FT                   NVFYAVKGQPAVEPEVLEALAQKLELSAESVTSPIATLARTTPFLTQPVFNKHHSETDM
FT                   LRYMMHLQEKDYSLVHGMIPLGSCTMKLNSTSSMVPLSWKEFGGLHPFAPTDQAKGYEV
FT                   IIKELENDLSLVTGYDATSVQPNSGASGEYAGLRVIQAYHESRGEGHRDVCLIPLSAHG
FT                   TNPASAAMVGYKVVPIKALNDGSLDLADLKEKAEKHKDKLAAFMVTYPSTFGVFEEGIE
FT                   EACQIVHDNGGQVYVDGANCNSLIGLTSLGRVGGDVSHTNLHKTFSIPHGGGGPGVGPI
FT                   SCKSHLAPFLPSHPIVPTGGSTPITAVSAAPYGSASINTISWAYIKMLGGEGLTTVSKI
FT                   ALLNANYIAERLKPYYNLRYSNKNGRVAHECLIDLAEFEKSAGLKVPDFSKRLQDYSFH
FT                   PPTAQWPISTCWLIEPTESESKEEIDRFIEALISIRKEIDEIVSGEQSKDDNVFKNAPH
FT                   PLSLLTADKWDRPYSREKAVFPVPGLKKSKFWPSVGRLDDAAGDLNLICECGSVEEYA"
FT   CDS_pept        join(complement(311344..311455),complement(309411..311293))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805481"
FT                   /locus_tag="CNC01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42123.1"
FT                   /db_xref="HOGENOM:HBG175909"
FT                   /db_xref="UniParc:UPI000042EC04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL18"
FT                   /transl_table=1
FT                   /translation="MDIAHVKASVKAWEKAFKAEHGREPTKEDIKNDTSDIAEQYALYR
FT                   KLSKSAASHGKPGESSKSSKQALSQQQQPQPRVTPRTIPTSAYPTTPTPPSRRSYTSLS
FT                   RPNGSQSMQNLTAGPSSNAESSANGKPSHTQSLKRKASHAKLSPPPSALESSSAARTLF
FT                   TTPKKKAYSGPIIDPNPVNPFNILNSPGKARSITNGGFNPNSGTGLSGVERMGSGAGAA
FT                   GSKEAVSPFIHASSPKKLKQVLEANSYHKTLVSGPVTTVGCKVSERITPRTKARKRLRG
FT                   EPVEDTPMKDRQVRRRRSHMAVSKSQSQSQLDSTRDVNFGKPLGSVFGDQNRDPMDEGQ
FT                   EDEEEGDEDEDEEGLGPSPVKPLGGKTFTSLFDDEDMPPRSIVSAKAKAPGGKMDGKGK
FT                   SGKGASQPGIMGFFGKLKKAKEKEKEKEKEKEKEADVSTTPSLALDKSADNTLNSDIPS
FT                   PTSFNPDIDLPELSAPSSAPHLGRKDKILSLSEDEDDEWDPEGGKVQQKVVIVPTRRQV
FT                   KRRTSIDGLSGLLDGVEKGMVDEGQDEEVEEEGDVIFENGNGDTDGQSPHIPLDLLAIT
FT                   SPHKQRSAELESLRVSAIFNPFARKRLLALKRGQEIHTTGEAAIGGEEGDVDGWEGLDN
FT                   VLEGEGKKDDDWESEDEGWKKIEEGLDDW"
FT   CDS_pept        join(311691..312049,312164..312818)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805482"
FT                   /locus_tag="CNC01090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42125.1"
FT                   /db_xref="HOGENOM:HBG175910"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniParc:UPI000042EF60"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL17"
FT                   /transl_table=1
FT                   /translation="MRPPALRTFRQLQLRQPNSFLRPLHSTPLLLAAENNDKKSKTKFV
FT                   TDRPVKVDRSPAFPPPANPFAPKPEPVHYSDLTLGILWKINKLLGYNGRRRTTARESGR
FT                   MLTGIIEAVKQDKVFWTFHTFFSVHLVYLLITLIRLRALPNQIPNPLSPIPQSALPGQP
FT                   GTTTPIQPPSLKDKFEDLVSPAHEYKYRQTLLTHFFNVVENEIRLMLGVEITRDSAVQT
FT                   RMKDYANWWREAQLGMDYAIGLTASEDPRERAVADAELASWVWRLIFGRRGEGVNGQGE
FT                   LVYPEGEAMKEGKELEMAEQVEAIVRFIRREMARLDKISDRDVIAGNVGMFGKVRE"
FT   CDS_pept        join(complement(313495..313654),complement(313330..313437),
FT                   complement(313251..313279),complement(313127..313189))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805483"
FT                   /locus_tag="CNC01100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42127.1"
FT                   /db_xref="HOGENOM:HBG175911"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniParc:UPI00004B43C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL16"
FT                   /transl_table=1
FT                   /translation="MMCVCRERRLSVRKFIFGYLSEKERELTDSGAVIALGLLGLGWGL
FT                   FILHATNSERLSSSVLRQATFQLRNSKEVIALLGENVRLVEEWWALGAPWISGTINLMQ
FT                   GRVDLSFRIRGSKGR"
FT   CDS_pept        join(314303..314336,314387..314422,314485..314600,
FT                   314664..314786,314835..314978,315032..315196,
FT                   315237..315416,315467..315481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636323"
FT                   /locus_tag="CNC01110"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42650.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG175912"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI000042C6DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL15"
FT                   /transl_table=1
FT                   /translation="MSAEDFELSPGQISDSVRHQLEIEEGNKNVQYQRFHTKQTQDYLA
FT                   HLRPKVKDVDQFWLIVLLSHQIVAPHVTSKLDQHALSFLEDIELKQDVNDFRPYELVFH
FT                   FKENPYFTNKTLSKKYTLKKGIKPAPADGSVTDELRKFNEEQDLEVNRATIDWKDGQNL
FT                   CERMPRQAQAQREGGEADDLEDGFEGDPGSFFWYFQEKADRFNFGEQFKDDILPEAFAY
FT                   FEGRGESGFGGESDDEDDSLDEEDDEDEDEIDLEEDEKPKKKRKVGAH"
FT   gap             316088..316200
FT                   /estimated_length="113"
FT   CDS_pept        join(316537..316731,316783..317735,317788..318109)
FT                   /codon_start=1
FT                   /gene_family="HOG000036730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805484"
FT                   /locus_tag="CNC01130"
FT                   /product="Ribosome biogenesis-related protein, putative "
FT                   /protein_id="AAW42651.1"
FT                   /db_xref="HOGENOM:HBG020798"
FT                   /db_xref="HOGENOM:HBG630213"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI00004B43C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL14"
FT                   /transl_table=1
FT                   /translation="MGKRTADAADLPVSKAAATGQATAREPAADDEMGEFEDRWEDEIE
FT                   SEEEVVEHDADGEADGKSCSEDAEPPAAPTQTYLPGTAIAEDEQLVPDNSVYLALHSLS
FT                   YAWPCLSFDVLRDSLGTDRATYPHTSWIVTGTQAGEVPGEGKAKDEVVIMRLGNLSKTQ
FT                   HDDDDDSDDGKDDDDDEADDEDATLDFLTIPHVGSVNRVRAAPAPVGGAVPDPYHVATF
FT                   SETGKVHIFDVRPYIDTLAGPSRPRQKLPVHTISNHGRAEGFAVEWGATGLLTGDIDRK
FT                   IYLTTLTPSGFTTSPNPYLSHTSSVEDLQWSPTEPTVFASASADRTVRVWDVRAKGRRS
FT                   VVSVEAHSEDVNVISWNKTVDYLLVSGGDEGGLKVWDLRMFKDTPSPVAQFQWHTAPIT
FT                   SVEWHPTDSSVFAASGSDDQLTLWDLSVEPDEDEAPIGPADGNITAVPPQLLFVHQGQK
FT                   DVKELHWHPQIPGMVISTASDSFNVFKTISC"
FT   CDS_pept        join(complement(319345..319986),complement(319185..319286),
FT                   complement(318966..319112),complement(318230..318907))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093109"
FT                   /gene_name="ATG15"
FT                   /locus_tag="CNC01140"
FT                   /product="Putative lipase ATG15 "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="autophagy"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="multivesicular body membrane "
FT                   /protein_id="AAW42129.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="GO:0032585"
FT                   /db_xref="HOGENOM:HBG175914"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI00004B43CA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KL13"
FT                   /transl_table=1
FT                   /translation="MYIPGPLRLSSYLLPFLSSPSPPAQSSPDTRTISFKPVHAHGHAF
FT                   VDNASTPTLLFLDQSPSASLYAHDYPIGAFGDDYVLPRLTSDVLEIRTRKKLIRRPKVR
FT                   PPRIISWAQSYRAQALHFNGINNNNDNSNKSISLPESWLAPDLANPSDEWSDVEVTVPD
FT                   LTDRQTVITLAKMSSNAYVTPGGAGWYTLNDWNASMPFGWEPDADGLRGHVFADEKNET
FT                   VIISIKGTSAGVLGSGGPTAKNDKFNDNLLFSCCCARVDFSWTPVCDCYAGGYKCGQTC
FT                   LEDALVSESVYATVGTNLYNNITYMYPNATIWLTGHSLGGAVSSLIGLSFGAPAVTYES
FT                   PGELLPASRLHLPLPPGMPANLSGITHVYHTADPIAMGVCNGPYSSCYAAGFAMESKCH
FT                   TGETILYDTVRVKGWSVDVRTHRIEEVIDKVLADPWPEEGEGKSGVWEKAVEGWYRAAD
FT                   RVRAALDESVVRDDVNVWWGWGRRGPKRQPGGEDPGWRKHGGVPKPVSEEDCVDCYKWE
FT                   FGEWN"
FT   CDS_pept        join(complement(322559..322815),complement(322355..322450),
FT                   complement(322058..322297),complement(321988..322009),
FT                   complement(321918..321927),complement(321799..321865),
FT                   complement(321666..321740),complement(321541..321606),
FT                   complement(321054..321496),complement(320903..321006),
FT                   complement(320769..320846),complement(320702..320712),
FT                   complement(320340..320640))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19788999"
FT                   /locus_tag="CNC01150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42131.1"
FT                   /db_xref="HOGENOM:HBG067677"
FT                   /db_xref="HOGENOM:HBG175915"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI00004B43CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL12"
FT                   /transl_table=1
FT                   /translation="MDPNSVVKPEIDTTSTSLGARQNTLIPPIDASIQGRYTKREDEAT
FT                   ANKNMQAGTEEEKEMAGRAAVIIQKHYRGHAARKHVRELRLQREARWNDLVKHSQEVTY
FT                   AKDQLDNKNDVVSRWHRAAHAASRLQTGDGLYSSPISTLPSGQVEECDPKKLTDKELRA
FT                   RKATFWGSLSLGVGKDRDEKKELPFHSKELETQHWLEMIDGKHRYGSNMKYYFRKWKEA
FT                   DTSDNFFRWLDKGEGKDLDLEEMPRERFEKERITYLSAEERLNYLVKVDKDGRLRWVHN
FT                   NEFVDTAAGRWKDAGDGTGIVPADPQSEEDENTPKPQPTIDPYATPHNHHIRKVSRTSS
FT                   LSSLSSDSYSPQSSELDENESTHYAGLDQKPEGWLERQRKRLTPGGVRRELLRKTVRRN
FT                   TWIYVSDMKLNLFVGIKQSGTFQHSSFLAGGKVTSAGIIVVKHGLIKSLNPLSGHYRSS
FT                   IDGFRSFIGQLEAKGVDLSHVKIAKSVLSLWGLSKYSKVTKAQNNLITHVQRTLHLSHE
FT                   PTEEEKSQALQENAEREEREHQERTKIVRDAEEEAKRSGEIKDDRDDVATEKDKEEMRE
FT                   FRREVLYGRRDRV"
FT   CDS_pept        complement(323255..324244)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789000"
FT                   /locus_tag="CNC01160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42116.1"
FT                   /db_xref="HOGENOM:HBG067676"
FT                   /db_xref="HOGENOM:HBG175916"
FT                   /db_xref="UniParc:UPI00004B43CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL11"
FT                   /transl_table=1
FT                   /translation="MRFTSPDTRPSLTPLGYRLLHLSELKLSSMDGSSYDEGVSLWKGV
FT                   LVREAVRSAWKSVQDGSVPEMNDWSARGAMGLDIYEEEVEEEEEQQEERWFEDMVTSFG
FT                   EEEYAVEAADGEHEWVESSVSIPEYDLDFNVDGMEAYTFPASSPSTPLLDDSHLEPSGT
FT                   VDIIEVDDDESDISDEDLASLAQSQHWHSPSTISMAATSPSTPILFGHPLSSPNSPTLS
FT                   PVPSPTLLAPTPMPLPAALTGSFVFPDPRSYYTDFEEYVDDFSLPPPLLRSMSSSTTES
FT                   DVDDGEVCKTPPLRTEELEYESSEEENVKEEELLMGLGLRIGHLNLRL"
FT   CDS_pept        join(complement(327862..327869),complement(327531..327788),
FT                   complement(326977..327473),complement(326794..326894))
FT                   /codon_start=1
FT                   /gene_family="HOG000068106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805485"
FT                   /locus_tag="CNC01170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42656.1"
FT                   /db_xref="HOGENOM:HBG074589"
FT                   /db_xref="HOGENOM:HBG646794"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniParc:UPI00004B43CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL10"
FT                   /transl_table=1
FT                   /translation="MPYSQKLKALLIDLNGTLHIGSESTPSAVKAIERLRSVRIPFIFC
FT                   SNSTKESSASLLDKLKKIGFDVKKEELMTSLSACRMIVEEKGLKHPLLLMSPSAKEEFS
FT                   TLPPSQGINHDAVILGLHPDSLSYEHLNKAFRVLKGEPLSSQEKNNSTGEHRPVLIAPH
FT                   ASMFMQDPGSSSFPPGLSLGIGPFVRALEEAASVKAEIVGKPTKGFFELALEKLKELSG
FT                   EDFERNEVAVVGDDVDNDLGEGARELGLKRILVKTGKYRTDVEKKIEHPPDTVYDTFAA
FT                   FVDDLL"
FT   CDS_pept        join(328328..328624,328681..328961,329027..329072,
FT                   329134..329382)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636324"
FT                   /locus_tag="CNC01180"
FT                   /product="Rossman fold oxidoreductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42118.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B43CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL09"
FT                   /transl_table=1
FT                   /translation="MSVAVIQGASGGLGQALTRYILRHTGLTVYALTHQASSQGVRESL
FT                   LSEVWDKGKHDSERLTVVSNVDVREEEGLRRGAEMIRSREGSGSVRVVVCLAGILKAEK
FT                   SLSAINLHDALSSFQINALGQLITYKHIVPLIPTKNELSILKAKWNSEEEGHDPAKGMV
FT                   NGDHSICCSLSARVGSIKDNEKGGWYSYRSSKAAVNQIIRTLDHELYNRSSSAIAYAYH
FT                   PGTVLTSFTSPIIGSPKPHLSQGLLTVDQAIDRLVNIMSQVKRGVQGSQNGVDWGGRCW
FT                   DWKGDVVEW"
FT   CDS_pept        join(329719..329880,330020..330073,330142..330159)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789001"
FT                   /locus_tag="CNC01190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42120.1"
FT                   /db_xref="HOGENOM:HBG067675"
FT                   /db_xref="HOGENOM:HBG175917"
FT                   /db_xref="UniParc:UPI00004B43CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL08"
FT                   /transl_table=1
FT                   /translation="MAPLDLGDVGNAIQGAGESAVNGAEGVVGTVTDKAAGAVATATDK
FT                   AKGAVASATNGASQAAGLLKWMEKIQDVTSSL"
FT   CDS_pept        join(complement(331409..331596),complement(331175..331353),
FT                   complement(331074..331123))
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789002"
FT                   /locus_tag="CNC01200"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAW42122.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000042F70E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL07"
FT                   /transl_table=1
FT                   /translation="MLGQLSRPVRLSVAPLRTILTQRAFHASPIARDHILDASNEVFEK
FT                   RALDADNSKPVLVDFYASWCQPCRVLTPLLKRVTGPESNYDLLTINVDEYPEVAAKYKV
FT                   SALPTVVAFKNGAVKNKFVGFRGQDDINKFLGML"
FT   CDS_pept        join(331970..331982,332031..332084,332135..332178,
FT                   332230..332539,332588..333121,333171..333606,
FT                   333660..334252,334309..334334)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805486"
FT                   /locus_tag="CNC01210"
FT                   /product="Putative uncharacterized protein "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42124.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG067674"
FT                   /db_xref="HOGENOM:HBG175918"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00004B43D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL06"
FT                   /transl_table=1
FT                   /translation="MPKTNKGGKGQKNKVYALPTAQKKKGLDVPKFQMKAKAASQAQLA
FT                   PTSLGALSSNDQDISNSSFDLGNVTFHDVIDTSLTKDSSSKAFMRELRKVIERSDVIIQ
FT                   VLDARDPEGTRSRWVEDEVRKRDMQGKKLLGVLNKIDLVPRANLEAWLKHLRHSFPTMP
FT                   FKSSTQSQKQHLSQNAVPLAQPSTVPGKQAVLQELPTTSASLGAPALLHLLKQYALSTP
FT                   HSSLTVGVVGYPNVGKSSLINSLKRSRACAVAAMPGKTRVVQEVALDKGVKILDCPGVV
FT                   LEDVGSHMEGEEGRRRQAEIMLRNCVKAELVQDPISPVEVILNKVEPAQLQKLYNIPAY
FT                   DDVRDFLIKMALIRGRLGKGGVPDLEASAVQVLRDWNSGKISYYTTPPKFHPSSAPAPA
FT                   PVVTPVLAPNEAAGDMEMGGDKVGDAKILTTLSEAFTIEGLFDNLGDDAAWEGEGVVKE
FT                   EGIAEDADLIAPEPVIPPALVPEQTAPRASLTKRPFMGSEDESDADSDASDSFRPRTTL
FT                   GPSPASFQSTSSNALHFPAQPQTAQANRLFTAEELAVLPSGLLDRKKVKSLAKKAKKRR
FT                   AAVERTEGELMAGFMDMEMDEPGAREETEVQMPAFEQKSKKDKRKEKKETQAKQRKEMT
FT                   KVVAEMEIDEDARKEAEFANFLANMNADGSDEEL"
FT   CDS_pept        join(335881..336075,336125..336963,337015..337368,
FT                   337422..338025)
FT                   /codon_start=1
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805487"
FT                   /locus_tag="CNC01220"
FT                   /product="Cystathionine gamma-synthase, putative "
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAW42126.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG262693"
FT                   /db_xref="HOGENOM:HBG634482"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00004B43D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL05"
FT                   /transl_table=1
FT                   /translation="MPTSTSNLPAPIPLGCSVPALTAHAISVSLPTWEDNIGYEEGHKR
FT                   VVDKMETGYPRFFIHRSIQKLAALCLSKFGQPNELCILLPAPRVAAAGRDFLAAQDPPI
FT                   PSRTVEFVICPSSKSLTDLSSAKSLGIDCIELQILLFDKDKWPYGKAFWQHTGDGVSSR
FT                   MAERALSFLGETPAGVQPRAPSPPTLERPASKAPSSRNRHYSKRTGSVPPTPTTPSESP
FT                   NSMPQSSTILEKPPVDPITDENLTSDLTTYLEERYGRNLPLFNAPLAKQALKRRIAGGL
FT                   LPSDEDYGKIEDVARGAGSGKKAVTEENVYLYPCGMSAIWHAHDISRIARKLQGEAEGI
FT                   SVCYGFPYTDTLKILNKWGPGCHFLGTGGSEDINALEKILVEAKENPNEPPILALFCEF
FT                   PSNPLLRSPDLVRIRELADKYSFFIIVDETIGNFINVEVVTFADIVVSSLTKIFSGDAN
FT                   VMGGSLILNPNGPHYDTLKAAQSSVYEDYYYPEDAVYMERNSRDYRARIKKVNDNAYDM
FT                   CDFLHKRSLDDESTPAEGKVLKKVYYPRYITPETYAQAQRHPTLGKGGYGGLFSLTFTS
FT                   LAASKAFYDAIGCAKGPSLGTSFTLASPYTILAHYLELDWAAGYGVEKGLVRISVGQED
FT                   QSVLKTWFETALAASEAAGRAEKEGRKE"
FT   CDS_pept        join(complement(342188..342193),complement(341971..342165),
FT                   complement(340948..341923),complement(340630..340892),
FT                   complement(340410..340577),complement(340160..340357),
FT                   complement(339937..340110),complement(339724..339885),
FT                   complement(339108..339670),complement(338723..339053),
FT                   complement(338147..338656))
FT                   /codon_start=1
FT                   /gene_family="HOG000172497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805488"
FT                   /locus_tag="CNC01230"
FT                   /product="DigA protein, putative"
FT                   /protein_id="AAW42128.1"
FT                   /db_xref="HOGENOM:HBG059805"
FT                   /db_xref="HOGENOM:HBG736112"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="UniParc:UPI00004B43D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL04"
FT                   /transl_table=1
FT                   /translation="MTFARSSSVLVVEHTSGPSAASYAVSGIYQGSNNVGYGGSGIQAV
FT                   GYEGFEEGDEEQPGEDAVMVRALETGFIPSARSQALSPLFSLSLVQYSPPSSVLCLTSV
FT                   NNVLFLAIAPLALVIIDLEKPEELVTIDLPKPTPEKGSQRTKESPVVSQLFADPTARHL
FT                   LISTSSGDTFYLPISPGNAAIQSRRPRPLRLRQSITAAGWSPISGVTVDANGEGTGQGK
FT                   GDAVTPPSTDVLLGTTNGQILSLLLPPQDDIFKSVSIGMSKPVERDLQTVYTLPDQQPV
FT                   AGIGFGFWPANGSSSDRHHKGGKKGAGKRAWVVITTKERLYEVQGNVSTTTAGGKTGGW
FT                   AEELFKPIRNSTPKFQELPGDIVNPSLVFYTPSTPAQSSSTLPAPSAIAWLTAPGLYTS
FT                   SLSSAPSNDILLRPSLIPYPIFDDSALHDFAPRPAPSSPSLPAIPIAVAVTQWHWLLLY
FT                   SDRVAGVSRENEKVVWEEKLPLSVDEKAIGMSADPVSRTFWIYTNKSILEILVRNEDRD
FT                   IWRAKLEKGEYTEALNFAKTLSQKDVILSKQGDYLFEQGRYIQSAQCYSQTNRSFEYVT
FT                   LRFIDADERDALRIYLSERLNRLDKKQRTQRMMLATWLIEIFLNKWNALEDLLAIDSAN
FT                   TDMDSLNIERQITEEDLKEFMNTYQNDLESKVVYELIQSHGRTDLYLFYATLIKDHGKV
FT                   IEHWITEEQWLKAIEALSRQNTIELYYRFASILMRHAPKETVDSWIRQPALSPRRLIPA
FT                   ILQQHRRSEPMSSNHAVRYLSHVIHHQSCTDTTIYNLLLTFYATDPDPDDGPLIRFLSS
FT                   CPDDPETERPYYDLDYALRTCKQHGRIQPCVLIYSKLGLYESSVDLALDKGDLELAKEN
FT                   ADKPEDDDVLRKKLWLKIAKYVVQEQKDIKSAMQFLGSTNLLKIEDILPFFPDFVVIDD
FT                   FKIEICSALEEYSARIDALKAEMDEAITSSESIKRDISNLAKRFVTVEQSDKCWKCGLE
FT                   LVSRQFYVFPCQHQFHGDCLISMAMEYLPSPSLRRILRLQNELVSRSGPSFGRHLLSSN
FT                   FTPSGSGSSTPGRGKEHPFRQAPASSNVATDLLLGGVTGRNKLIAAGDKLRELIIPDAL
FT                   AQAVSMVSVGVGVGGTGEAKKGGKREKPDDSRAEEFRNELDALVASNCPLCEGAVMSLD
FT                   KPFIALSEDTADWEV"
FT   CDS_pept        join(343157..343858,343917..344023,344072..345041)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805489"
FT                   /locus_tag="CNC01240"
FT                   /product="Putative uncharacterized protein "
FT                   /function="signal transducer activity"
FT                   /protein_id="AAW42130.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG067673"
FT                   /db_xref="HOGENOM:HBG175919"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00004B43D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL03"
FT                   /transl_table=1
FT                   /translation="MCTHSMLTSHTELALEQLRLCHILNGETCPPISFADFATFLTNKD
FT                   YTAENLVFVLWYRDYRSKWKQVDKAVKIRVPVPSTILGHRYDPFAYLHHGPMNFPTKVG
FT                   EQEVEESRSSSISAGAYSTDATALHPNDGSGKPLRSCFSRVNSHFAGSRFGTSSSTCSS
FT                   SPALHVLHRSHSPYLPDGTTFLPVDEQPLRDQALQAFATFFKNGGSKELSISDELREYV
FT                   RTCLEVSSAPESFLPVLEEIYHTLESQCLPRFLETAKGNINRPKQLLWYFAGVIGLLIG
FT                   LAIFLLLTFLLPPSPFGLRTYRLFSTIFVSFGTMQVYSAYRGFCSQVWRRSSRQIWPWE
FT                   LDALEDEHSKVGDMIGIPAIVGCGPKPEVKVLKEVVFPEEVRPLSNLGAIQDFNSTCKV
FT                   NIRENSINASQASLEKSGDYDLSSQTFGFRNALARQFAPICDTSSLEDKTGLISRPCCM
FT                   WLGILAAKGHKLPNPTQREISPFAFDSGGKEGETSLGNATITTPFPHSVPAQSLHPLTS
FT                   FMLISNPRSTKHEARVPPRRKAHTKIQVFGPERLVEDPRIKKVYRDIKRDILIAGGIVS
FT                   ALWIVVCLVVPCTASS"
FT   CDS_pept        complement(345980..347488)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805490"
FT                   /locus_tag="CNC01250"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42132.1"
FT                   /db_xref="HOGENOM:HBG067672"
FT                   /db_xref="HOGENOM:HBG175920"
FT                   /db_xref="UniParc:UPI00004B43D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL02"
FT                   /transl_table=1
FT                   /translation="MPPFARRQARQISQVRGENTPVTGTARLQSVVPQRRRIEIVLPAR
FT                   SRRTPINRQSRIAPSHPPSPANPSSSEPESTTSAIASSSPPSSASEISAPPVIERRRIE
FT                   AVLMDCAAQGIDVDSWNITMSPSHYYQTFCNTLSIATIGSQGSHIYSQVKDDGMYAKWV
FT                   LIGDAGCRLLIAPEYKRRLIRAIKQKRPIHPSTSSCKLTDAPFTMSCFELMEHLTSIGC
FT                   RAIRIQLYGQKLPLHPRFFPQAPEEPVHYLAETNQWDIGVTYRSNKIFLFAPTKGVSSG
FT                   MDVYPMLIPISKDFGSISVKMSARGKECRVKIYPRLVHVLKSIRGQLQKYNSKTMSGLM
FT                   KQMTAAQELLKEITSMDEEECGGFRIEVSLNTFTLEEARTLAVESQLLEPETWLLEGGP
FT                   AYVQPYKLCLKLVTKAELLTNANRLVRVAVEQRLLTGDGNRHSEEWEKKVVADVFAAIG
FT                   WNNGKRRLTKSTSTDAWWITGQGDTADDPRNEGDQILMDINRVE"
FT   CDS_pept        join(348863..348947,349015..349228,349280..349559,
FT                   349612..349851,349903..350218,350274..350362,
FT                   350410..350673,350748..350905,350960..351009,3
FT                   51058..351152)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805491"
FT                   /locus_tag="CNC01260"
FT                   /product="SNF1 family protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW42652.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG067671"
FT                   /db_xref="HOGENOM:HBG175921"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00004B43D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL01"
FT                   /transl_table=1
FT                   /translation="MEAAQTPRSVLTHIGGWKLGKTLGRGAYAHVRLATHKNGHQAACK
FT                   ILPALHKDPGLPVTWDETIDAVEAHKEVVLLKALCGAGVEGIAGLEGVVEEGGWTYVFL
FT                   TLYPCSISSISKPWASDAVVIFFRRLLHTVRNLHQLNVSHEDIKRSNVLADSQGSPVLV
FT                   DFGFSHFKANGGYVKSAGGTLDYSSPEKTADKHYDPKANDIWALGILLTKILCIQHPYA
FT                   HSYVDDTSTTVKRRILTGDAKFHWKTDHLVPGGVAELIMGMLERDPQQRWTITRILGHP
FT                   WLRTKYPDLRPFQLPSYELKLLHKPSQSVIEDLCFLAYLNGEFALCETSMRIEEHLEGK
FT                   EPCWEKRWAGMLGSWSQRAEMDWQDIPTAITPLPKSRSSFTRVNGPTKANAIGNSKGGI
FT                   LKEIHLLPNAQALTTLGSNGDIKKGLRPARSRFYNMKTKNGAQNLLVCSLRPGIHTQTT
FT                   LQEKFVPDDLMAATNNQSSKAKPGIVRVKKPKAKQKSKADFKIFISDTDNSGEENETVE
FT                   KRQNQQGPRKLDKTGAKNLIIGESPTLAALVTDSKEGFITSVPDEQMKGLFLSKPDPPR
FT                   ARCTQRRSPRLQEEKRIDLN"
FT   CDS_pept        join(complement(355993..356042),complement(355507..355938),
FT                   complement(351811..355450),complement(351509..351760))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805492"
FT                   /locus_tag="CNC01270"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42134.1"
FT                   /db_xref="HOGENOM:HBG067670"
FT                   /db_xref="HOGENOM:HBG175922"
FT                   /db_xref="UniParc:UPI00004B43D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KL00"
FT                   /transl_table=1
FT                   /translation="MCQVLWTLRFKTQSAKQAPWTKQLISWFIDTSRYLIPSEEEQATK
FT                   YLRAMYRTFSPETLPIDQSIGQPIVLPFSAPHASVNFNHEARIKILTRGIEDVLPPLLV
FT                   LTHDSLSTQDWETILPFLWAWYGTKASATREIGFLLEKCAEMAPAQLRSIVISDLTSTN
FT                   AEVRCQALHNISILFAWRNQILSQPIFTSRRGPLFHFPAKTLEFVPTEIGSSKWVSPQD
FT                   VQDTQLQKFGQTLPLELRQRLNELRWSDEDELKGNSDWEQTPVSSLPGLAFQSDGNLIN
FT                   GSSSGRPSSPVESLVRKGSNASAGSSSNKRRKAIFAPLFVNMTYDQMTILAGEVDGPIS
FT                   ATSLEVVRLLQRDDVVSFLRPFTERMKDQFLNAMERLDRVTNVLTPGFAYSAINAIVGY
FT                   LKSSLKANADVEYWDIALASVVRLVPSVSEISLRDIRKNKAEHVLLPASIHEEDGGFRI
FT                   HAPWRRGQRGVQTAQLLILNEILKVNPREVYLVKKMLHNLHIQSSINHLPFARAWLVLV
FT                   LTLFSFVNRNYNDRAELRHFLSNVGDILLLHGQSDLVIVAHAMRIFTLCSARFRRVFSS
FT                   MGFPTIMRPVYETYAASNAAIKDCIEYAAKSFYRIHEEVFVYQTCVVIADGGYDAEAVY
FT                   AFLSSLSHESTVLSGVTSGIRGSNDKEETDALVQMVSGPEITLAEIGKEAAERQAIKLA
FT                   SITLEDKLFPRENIVRLFVTAIASNPATTCAANFLRLLSALVPKMNDSVSKDLLSEGVE
FT                   ALGSVIIKGKTGDDAAKSVFHPGANDSEADWTRARREYVFLVQSFAKAGGHLGTSATRR
FT                   TLDMVLDLLRKQPESVGPSASSIVGELAKTRLASGRPTPFLREIAPIFRAFISVVDFSG
FT                   MLDSISALIRLSNYNLDEEITRIIVHDYVEPAVKLLASASKDSLAFIVPLRSSAVKLLS
FT                   VAVFLQGDALGALERHHASASLLASVVMPLCLLLEPPREVDRQDIYSSLWIRLLHYVLK
FT                   GSIEEGGDSRKSSNASLYHPRSIAASTVLVVQIVKIVLIRAPGSINRVKGLWTYVARRI
FT                   LQIVDCGNARFMDSQRSLSPRVVDWLMWSVFELIALHPSALHIEFQARVHQALAMIDKQ
FT                   ETYSSRPSSPALGPTLSASTYPQYYPGRARLSSNRPSSFIGHARSPSNVGHDHTQFGSP
FT                   DRSTTANLAVTPSRNRISSNNSSPNHSPSLLPSSLAQPHGVGPGVEVVHSRSPSQRKTT
FT                   GLSPAGAARPSFVALSARRASQPVFEAFSSAYPTKNRFASSANIRDLGNSSEKPGGAII
FT                   HLLGAPNQVLSATSSGFPTLSLTNSSVISPTGPKISTQSVEKALRDVYIKSEELTQMAS
FT                   KAVRTVMLVYGWRFDKEEEDVVRNWTVLDALHIVSKQTKVFVEEEFRDVFSPAADLYES
FT                   DDAYIDSEKQEGVYDFPDRMRASESLEETSIEKERQLMDEKENDVPIVSVSSPYD"
FT   CDS_pept        join(359205..359462,359512..359694,359747..360350,
FT                   360403..360548,360601..360751,360809..361155)
FT                   /codon_start=1
FT                   /gene_family="HOG000188754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093110"
FT                   /locus_tag="CNC01280"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAW42136.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG021848"
FT                   /db_xref="HOGENOM:HBG629274"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000042D593"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ9"
FT                   /transl_table=1
FT                   /translation="MSTASPPALSPPAAKRIKLDTEGVPLSSPLKSQQDASELPPATSA
FT                   PEALPAWTSTPPVDDFLSDEEELEDVKEEEDLTRRDMYLDTISRQSLDFDFEKLCSKSL
FT                   SNINVYACLVCGKYFQGRGKGSWAYRHAVGDNHRVWLNLDTEKFYVLPEGYPVSDPSLN
FT                   DILRVLHPRYNASDIKALSTLPAPSYTLSGQQYTPGFIGVNNIKKNDYCNVVIHLLLHV
FT                   PPLRNFLLNPDTPELQDDRRPTELVKRFATLARRLWNSHLFKSQISPHEFLQEVSKRSN
FT                   GKFKTTEQGDPVELLGWLVNTLHRDLGGSKKRNSSIIYSTFQGKVQIETQQVIVHKEYA
FT                   RPVFDIGRDIQTISSPFLFLALDLPITPLFTDMNEKKIIPQVPLSQILAKFDGKTTQEF
FT                   GPSLKRHHLTSLPPYLILHIKRFTKNNFVEERNPTIVNFPLRGVEMSDYVDPKPSDPMH
FT                   TQYDLLSNVFLDTTTASTSSSGTGPGISKRNPAPGEENQMSWKIHVRAGRAGGNANGSG
FT                   EAENKGEKWFELQDLNVTEVRKEMVFLGETVVQVWERKDLSEGKK"
FT   CDS_pept        join(361555..361693,361757..361789,361851..362130,
FT                   362186..362431,362486..362638,362704..362734)
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942089"
FT                   /locus_tag="CNC01290"
FT                   /product="Aldo-keto reductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42138.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00004301CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ8"
FT                   /transl_table=1
FT                   /translation="MSLSLDSTIKLASGNLIPRLGFGVYQARSKECEDAVKKAIDTGYR
FT                   HVDTAQAYHNEENVGRAIRNSGVPRPSVFLTSKYMPSHTVYSPTEVLDVVRKSLKKVDR
FT                   CGDDKPYIDLMLIHAPWGGEEGRKNNWEALTIAQKEGWVKDIGVSNFGIHHLKALPPPV
FT                   PAVNQIELHPFCQQRDIVKYCEEHGIAIEAYSPLVRANKKHYDNEVLVKVAKKYGKEVA
FT                   QVLLRWSLQKGYIPLPKSVTPSRIESNADLYDFKLDQEDMAEIDGLDKGSEGAISWNPV
FT                   NHDGEIDQDALR"
FT   CDS_pept        join(complement(366554..366635),complement(365950..366501),
FT                   complement(365000..365898),complement(364701..364947),
FT                   complement(364374..364644),complement(364104..364321),
FT                   complement(363534..364051),complement(362908..363486))
FT                   /codon_start=1
FT                   /gene_family="HOG000208919" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789003"
FT                   /locus_tag="CNC01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42140.1"
FT                   /db_xref="HOGENOM:HBG067667"
FT                   /db_xref="HOGENOM:HBG175923"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="UniParc:UPI00004B43D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ7"
FT                   /transl_table=1
FT                   /translation="MIPSPRRAASTPAVQTWPDLDDDDGWQDMPVVRSDSNPFGLDEED
FT                   QKKYHYRTSISLDDDPAGPSGTGNATGKHLELEADTLATDSWREKVEQDESDYTRIRLD
FT                   EDEESEEVHMRTKYLFNEDKAMTPLSQMQTTKELLTEGQRIAYVALCHLIMKRMLRDMG
FT                   RGWEGYKAKNKLGVKGKGKAEVPVVESGHIWMLKLMARLYQHMELTKDEQRMIESLAEH
FT                   GVDPSDLVPALMTTHTVNNPDFDPKEKERVDLEEALRKEAEADDEAEREAKAEEERHVV
FT                   VEDQGASDTETEPPPPYEVEERSISFAASPMGKKASSSSLELLSKSINPFGFDDDDVPK
FT                   PLLGTKSPLSEGSFPNDSSTIISPQANVNPFGSDDENEGSLAVSEIRAPGAQSKAQTLS
FT                   SFEKDEGDIGGAHSSPFSEPSNSPLDAAFASTADRPTPCRPQSLQTEDASQSTSDATEK
FT                   PSVDTKLTPKDEPVTLFDAADPQAPALLPALPGVSTSLSTTDEHVTLDIRWTVLCDLFL
FT                   VLIADSVFDARSRAFLVRVAAALGFDWLDVVRFENRVTEALEIQEGMEKKGQHEIIEGR
FT                   RKAARNKRYAMMGLAAVGGGLVIGLSAGLMAPFIGAGLGTAFATVGITGTTGFLAGAGG
FT                   AAVITTGGVLTGANIAGKGMARRTREVRIFELKPLHNDKRVNCYITMGGFMASKVDDVR
FT                   LPFSVLDPVVGDVFSVLWEPEMMAEMGNALKILTSEILTQVGQQVLQATVMTALMSALQ
FT                   WPLILTKLGYLIDNPWSNALDRARAAGLVLADVIIQRHAGVRPISLIGFSLGARAIFYA
FT                   LIELARQKAYGLVQEVFIFGTTVTASRDTWLDVRSVVAGRFVNGYATNDWMLGYLFRAT
FT                   SGGLNTVAGLRPVETVWGLENVDVTEIITGHMSYRSCMPQLLAKVGFPVTADYFDEPDD
FT                   PEIDMNVQERTVVDEAEEEAKRNHKKVLGIFPVKKNRSSGSGHNTPTTEKHSGASTPNP
FT                   SVSQAAAGEYELEDDDLPPREEVDIGQMASEKDTSTPVEEEKELEIKAVKQREEEEQKE
FT                   REAIQAIPKTAGFDFQAISRELGKDIDVDKLKEPEPRYFPPALMEIRAPLERSGSAPPP
FT                   TSFVPPPAEKNVWV"
FT   CDS_pept        join(complement(369540..369569),complement(369236..369297),
FT                   complement(369115..369178),complement(369056..369061),
FT                   complement(368850..368997),complement(368227..368796),
FT                   complement(367838..368172),complement(367761..367783),
FT                   complement(367578..367711),complement(367481..367524),
FT                   complement(367355..367428),complement(367163..367295))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805493"
FT                   /locus_tag="CNC01310"
FT                   /product="Expressed protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAW42655.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG175924"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI000042C1CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ6"
FT                   /transl_table=1
FT                   /translation="MPPKDPTFSDDEASSGRGDSAQPEDIHGRGSSSSARKAQNRIAQR
FT                   EFRLRKQQYIRDLEAKVQMLEGDKEERVELMTLLVRNLMKENKDLRHMLRLTASFIGEG
FT                   LGSCLPRLGLSADQLDAILNRADTDTVYEAFINLKASRELEMSNPGIKLGEPRRRAGNL
FT                   PPKRKRTEDEGGTPIGPAETPEDGASSAGKEKGKTSQNSDISNSKRIKSVFDQPIPSDE
FT                   YTYLFPDLDSMLMASESFDDPSISRFDINGQMGQSRVPNELPRVDYGQQQRLMSSNTGN
FT                   VRFPSYNGSTALAGDPLAANLAVSNSSSANYPPSNPSMPSCVTPVRPVAPLVNEGNQST
FT                   RRSSTSNEPSTQSDSIRRLAAEHRGAFDGPGMTSQEIEERRKAEDSLIKSIEEGDTPDR
FT                   KLEAMQLITYHLNNFRMNHEYHLPPSLRPTVVQRTVPHEHAIDGICFPSLRDRMILLRG
FT                   RYDLVEVFHSLLAEFTLHGDDVLDHRSYEVSEKFIHDYSILVDDSIVAISNKWRALRGE
FT                   PPIQWPLKDQGQNQLILSGATSQ"
FT   CDS_pept        join(complement(370768..370954),complement(370583..370716),
FT                   complement(370450..370507),complement(370215..370399),
FT                   complement(369907..370161))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789004"
FT                   /locus_tag="CNC01320"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42654.1"
FT                   /db_xref="HOGENOM:HBG175925"
FT                   /db_xref="UniParc:UPI000042CFF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ5"
FT                   /transl_table=1
FT                   /translation="MSLIPSSSPSSVPFFVPHLGPSSKHGVYPTPGGKGKGKELFGGGK
FT                   GFDPEEEVDDREWDMRVARAMIHLQETLPHFFNAEMTAATMLPPDIYSQNMLLKLPAPL
FT                   PLKISSLSGYSMAFSLTRNGMQALHTDLRSEMERMTFSPSPQDMGQESKRAAVLLARKG
FT                   IPSHRMKQIRVLVSVYGTLRLPPHKEAKWHTSSLYTFSPTSGLIVSHEVETIRPLPGEG
FT                   VAEWMMSRLLGWTSKNAGHEGAIPCPRTVALPPEHRVARFREEREEKRED"
FT   CDS_pept        join(371673..372118,372174..372287,372351..372377,
FT                   372430..372487,372542..372598,372657..372793,
FT                   372854..373071,373137..373259,373313..373416,
FT                   373465..373518,373570..373670,373723..373777,
FT                   373844..373969,374023..374073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789005"
FT                   /locus_tag="CNC01330"
FT                   /product="Polyamine transport-related protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42142.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG067666"
FT                   /db_xref="HOGENOM:HBG175926"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B43D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ4"
FT                   /transl_table=1
FT                   /translation="MEKVGGTRNIVSEKGQSSMDHDYDTESYPIVNCGKPLPFQHNKRR
FT                   RSSTGVVETSTPAPPPEIELSSTSLSSREARQVITSFPTSPANPINWATRKKWTITAIL
FT                   ALTGFISTAGSSIGVPGLHAVMSEFGETNEKIGVLIAGAYVLGLGTGPFVFAPVSELYG
FT                   RQIAYISSQIFYVLFTLGTGFTQSMTALIILRFFCGCFASPPPSLGVATCADMFLPHER
FT                   GKPISLYALGPIGGPIIGNMIGYWLLFGGWRWAYYFMTIVAFFNFVLMVFFLRETYAPA
FT                   IQKIMDYQITHPLSPSTSRRRHHLPKLTWMMAMVSKEDAKAVYGRAFSRPPRLLFTNPV
FT                   AFAFSLYYAYVYGIIYLFLVALPLLYGKPPFSQPALFSYEWPLATMGLPYISMGLGFVS
FT                   AVAIASQCQDRIYKHFSKINGDNGQPEYRLVLTQIGMCIMPIGLFIFGWTANAEVHWMG
FT                   PFVGQAVMGIGLMLAFNTIQNFFVDAFYPYSAAAVAGATAARSVVACIMPLFTTTMFVK
FT                   LGWGWGGTLIACIAIVGIPAPMIMFFFGQRLRERYAFQG"
FT   CDS_pept        join(complement(376115..376261),complement(375893..376057),
FT                   complement(375721..375832),complement(375570..375664),
FT                   complement(375005..375520),complement(374866..374943),
FT                   complement(374479..374811),complement(374293..374418))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093111"
FT                   /locus_tag="CNC01340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42144.1"
FT                   /db_xref="HOGENOM:HBG067665"
FT                   /db_xref="HOGENOM:HBG175927"
FT                   /db_xref="UniParc:UPI00004B43D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ3"
FT                   /transl_table=1
FT                   /translation="MSMIQKTPPRLPASFLVEESSETPGPSRARINNLQHQVSELVRKN
FT                   QTLERKLTAVKSASENDLKEKAAKLNEMQVSLHNTQRELERSKKDLERCVLEGSEMKEE
FT                   LQLHSMVQQQKALLAVAQEQMLVVELETRLLDAEKARILRDHKITLFQAKEEELVREIE
FT                   ERDIRIEDLEAMLERSNASLEQERNAIRKASSSQLTSSKDLTKAQMELEFARAEINTLE
FT                   DKVTSLETKVRGLKDREKEARSELESWLREEGSASKHQKEKKESQIQLRAMKSELEKKK
FT                   EEIEELKEELEEAVRSGKEKEKILKKRLRDANEEKERLLGIEEELHGLRAGISKTSPGN
FT                   RKIRKESPVKEGSGDEVTTKKKAKKAETAVSPSKLSSKARAKTKASVDSSSELDDSAPA
FT                   PIKKSKAARKSPIKSKPKSIAVEVSDAENEVDSLKTRSSKNEVVEHKPMEKEEQAASAN
FT                   EKKKKKRILGTQPPPTFNWDPVMNSGDGVIPAYLSPLKPDSVRATGTIPRAGFPSLPSS
FT                   RLNRFG"
FT   CDS_pept        join(378429..378442,378502..378559,378612..378810,
FT                   378878..378969,379027..379185)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942090"
FT                   /locus_tag="CNC01350"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42146.1"
FT                   /db_xref="HOGENOM:HBG175928"
FT                   /db_xref="UniParc:UPI000042C1C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ2"
FT                   /transl_table=1
FT                   /translation="MAGSWFRSLKPFLMGLLLVTAYSSFILDIIMIIKVRHYSNTYPPA
FT                   VVALLVCSLLEALYCLCLLVKSGRGAAFRASAVAGALAFFACFSFACVVATTVLRHHRQ
FT                   YCNPDLEDNSDLCGVLRGTMGLGWMLFGLNLIWLCLMPVLVSGQGTWSHYYNDLPYEER
FT                   DIEEEKAPVH"
FT   CDS_pept        join(complement(380553..380740),complement(380423..380504),
FT                   complement(380100..380370),complement(379998..380043),
FT                   complement(379743..379951),complement(379325..379689))
FT                   /codon_start=1
FT                   /gene_family="HOG000209150" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789006"
FT                   /locus_tag="CNC01360"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42653.1"
FT                   /db_xref="HOGENOM:HBG067664"
FT                   /db_xref="HOGENOM:HBG175929"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI00004B43DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ1"
FT                   /transl_table=1
FT                   /translation="MIMAEVSSSASATHTKQYKPYFSPANVERLSAKQRGKLSVSREER
FT                   ARQQACGFIDAVGVRCGFPRRTIATAQTLYMRFHLFFPYKDFSYIEVALATLYVSSKLH
FT                   DTLKKPRDIILASFPIRFPHLLRKGTIDPSVAQAHGLDSERARILSIERLVLESMAFKF
FT                   SANDGLRPVIKIGKKLGLNKDFCKICWKVAVDSYRTPAPLSYPPHIIALGSIYTAALLT
FT                   MESLSLETAEIMDQTRTPRGIVELLGNTGSWEEDYVAGVTHVDEVVHALLDLYHTVLSN
FT                   PENQALQAPSPVSPKEPLGSTAATSALSSSGTTAFPLSAFWTPQTLTKLKISLRERRGG
FT                   LTAMPGWATEDTGETDEVAEGMGKNDVTIRFLWDEDLMACARECSH"
FT   CDS_pept        join(381105..381181,381232..381404,381457..381512,
FT                   381566..381720,381769..382639)
FT                   /codon_start=1
FT                   /gene_family="HOG000135968" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805494"
FT                   /locus_tag="CNC01370"
FT                   /product="Pseudouridylate synthase 4, putative "
FT                   /EC_number="4.2.1.70"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /function="pseudouridylate synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="AAW42149.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004730"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG175930"
FT                   /db_xref="HOGENOM:HBG738844"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00004B43DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKZ0"
FT                   /transl_table=1
FT                   /translation="MPKALPTPTLPLNGLFPIAKPSGKSSMRVIDRITPLLLDSKLFDD
FT                   PVKRAQPQMKGKRKKNLTQFGLKIGQGGTLDPLADGVLVLGVNRGTKHLNQFLECSKEY
FT                   ESIGLIGATTTSMDADDPVLSTAPWEHITREDVEKVLDRFRGEIMQVPPIFSALKMDGK
FT                   PLYEYARESKPLPRPIPARKCQVSIELIDFTPASVTPGDGGHDYHWPEKRLTSEEKETF
FT                   RRLTEIVHNAQTGPVETAKTSGNKDQVEEEKLRVVEPLVPDLDAPEYPEISPNNGLRPP
FT                   TFTVRMTVSSGTYVRSIVNDIGLALGCGAHVVKLTRTRQGEFSLYGDEKALSTASASAP
FT                   AEGEEASVNEDRREAPGPSGGSIPWTVWERALAERDEMIKREKLEKEEAIMAGMSAEEI
FT                   HQVYNPEAIKQRRWEGGWKEWEVEVLKRFKPVPVPINGGHGFRI"
FT   CDS_pept        join(383920..384023,384086..384632,384685..384820,
FT                   384886..384975,385041..385230,385302..385566)
FT                   /codon_start=1
FT                   /gene_family="HOG000138318" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093112"
FT                   /locus_tag="CNC01380"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42152.1"
FT                   /db_xref="HOGENOM:HBG067662"
FT                   /db_xref="HOGENOM:HBG175931"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00004B43DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY9"
FT                   /transl_table=1
FT                   /translation="MYWYISFLRPPPVSTSNTDQRITITPQVANDLRTELRYEPTTIYY
FT                   TWQRVIPSISIATTLQELTTFIPPGSTYKPLDVPLPKNVQVGESWRLGLFSHNENPHSS
FT                   NGLLSGEERKWKLEPTNELLDLIDDTPDVLGVWSEGIEIARAVSGLNSGTIRGLGRQKE
FT                   PSIDKGKSKGKSKGKEKEKERDDRPKQGRIMREWALPEEGTLRIIEQTSFDLDKKVWDS
FT                   GLALSAWFWKHLANEGSLPLTGQKIFTLLKRQEKLRIVELGTGTGLVSIVLSLALKRIA
FT                   SLERKITATDLESAIPLMDENIALNNLNSQMNHISTDHENEQGEQSKGTLVDARVLDWD
FT                   QPIPAWVNNDHPELVIAADVTYNTSAFPSLLSTLTSLLLPSASSASLPNRPLLVLAYKE
FT                   RDPAERELWGMLKEKGIDMVMVDEIKGAEDYGSTEIWIGGSSLS"
FT   CDS_pept        join(384094..384121,384190..384632,384685..384820,
FT                   384886..384975,385041..385230,385302..385566)
FT                   /codon_start=1
FT                   /gene_family="HOG000138318" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789007"
FT                   /locus_tag="CNC01380"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42151.1"
FT                   /db_xref="EMBL:EAL21724.1"
FT                   /db_xref="HOGENOM:HBG067662"
FT                   /db_xref="HOGENOM:HBG175931"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000042C5F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY8"
FT                   /transl_table=1
FT                   /translation="MSPPRYTILGSTYKPLDVPLPKNVQVGESWRLGLFSHNENPHSSN
FT                   GLLSGEERKWKLEPTNELLDLIDDTPDVLGVWSEGIEIARAVSGLNSGTIRGLGRQKEP
FT                   SIDKGKSKGKSKGKEKEKERDDRPKQGRIMREWALPEEGTLRIIEQTSFDLDKKVWDSG
FT                   LALSAWFWKHLANEGSLPLTGQKIFTLLKRQEKLRIVELGTGTGLVSIVLSLALKRIAS
FT                   LERKITATDLESAIPLMDENIALNNLNSQMNHISTDHENEQGEQSKGTLVDARVLDWDQ
FT                   PIPAWVNNDHPELVIAADVTYNTSAFPSLLSTLTSLLLPSASSASLPNRPLLVLAYKER
FT                   DPAERELWGMLKEKGIDMVMVDEIKGAEDYGSTEIWIGGSSLS"
FT   CDS_pept        join(complement(388078..388135),complement(387983..388018),
FT                   complement(387791..387927),complement(387480..387743),
FT                   complement(387347..387431),complement(386853..387298),
FT                   complement(386681..386798),complement(386520..386626),
FT                   complement(386288..386453),complement(385862..386235),
FT                   complement(385648..385749))
FT                   /codon_start=1
FT                   /gene_family="HOG000163455" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789008"
FT                   /locus_tag="CNC01390"
FT                   /product="Transcription coactivator, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42154.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG351269"
FT                   /db_xref="HOGENOM:HBG714058"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI00004B43DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY7"
FT                   /transl_table=1
FT                   /translation="MTVTQRKPRVDNAQNDSRPIIEPGIKYTCDFCHVDITHTVRIKCA
FT                   MKQCEEVDLCPTCFCEGKEGLQHKAWHDYMVVEQNSQPIFTPDWGADEELLLISGLIQN
FT                   GLGNWAEVAQHVGTRTKEECEQHYLQVYLGVGEHGEDLRVKEKEADEKVDESKRRRREF
FT                   MPPMDRSFPYDPDEFQQRKKARIEELRKPQALPPSNAAPPVSAPTNHEIGGFMPARLEF
FT                   EHEVDNDAEMAVKDMEFGLVMQYGGDEQPQAKITRPPDEEEEEDEEGGGEDEKGVEKKG
FT                   KVKKEKQKEDEKEDKPVSPAIEDPDELEVKLAMMDIYFSKLDKREDAKEIIFDRGLTEY
FT                   RAIQAQDKKLTKEERELVQRYKPFAKLQTAEDFEVLVEGLIYEQTLRRRIAELQEYRRM
FT                   GITTAAEADVYDNVKNTRSMEFPTQKPAEVLPSGARINAGQHRFLHGTMATPLPDAKTR
FT                   EPTPRAIPAVGRKPPQPLNLANSASLDLLSSEEQSLCSTLRVLPKPYLTIKELYIRENE
FT                   RRQGLLRRRDARKMLNIDVNKSGRIFDFLVQSGMLVLAYEPQGKGKASLQAAAAAVAHG
FT                   AANGMTTMDGQSQGKDMLMERKKQGVQNDIFIEARQKYQNKQLALWFLGCKKYA"
FT   CDS_pept        join(388979..389285,389332..390437)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805495"
FT                   /locus_tag="CNC01400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42156.1"
FT                   /db_xref="HOGENOM:HBG067661"
FT                   /db_xref="HOGENOM:HBG175932"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI00004B43DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY6"
FT                   /transl_table=1
FT                   /translation="MRTSLIRNMSKSYDSIILGAGWAGSVAAKELTSKGHRVLVLEARD
FT                   RVGGRARTWTGGGAKIDIGCSWIHGYKEGNPARDIAKSLGVEARLPAAAEGVIYGPNGP
FT                   LSAEEADALRASLGTAVASSKLPHPSPPPTTSLASALFSPNSALLSTASDQSLAKALAR
FT                   SLEIPLGLKLEQASLKWAGWETTTSYAGSDAAPDGGYQSLVTKVLESSKAEVKLNSPAV
FT                   SIKETSSGVEVTTQSGETYSAASVLSTIPLGVLKSLPENFFTPALPAHLRETIGGTHVG
FT                   VLEKLLVQYPTAWWPNAEKVGSYTFLPTGPEPSASSTLEQVFEGSTLITANFAAPTLPG
FT                   PTPTLLTYLSETPAKILLQHPTEKVAEAFHSFLVKRFSPSSRPPAPSASALTTWLTDPL
FT                   SRGATTTPSIISTGERSPMDFKELSRPVWGGKLGFAGEHTEMDNRGSVAGAVISGFREA
FT                   DRIDKWLAARKE"
FT   CDS_pept        join(complement(390956..391061),complement(390788..390887),
FT                   complement(390571..390724))
FT                   /codon_start=1
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805496"
FT                   /locus_tag="CNC01410"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAW42158.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG236852"
FT                   /db_xref="HOGENOM:HBG317444"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI000042F407"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY5"
FT                   /transl_table=1
FT                   /translation="MAEYKEDLEKTGAGAQKIHKIRITLTSKNVKPLEKFCADLINRAK
FT                   DRDLNVRGPVRLPTKVLKHTTRKSPCGEGSKTWDRYQMRIHKRLIDLNSSADVVKQITS
FT                   ISLEPGVEVEVTIAA"
FT   CDS_pept        join(391376..391418,391498..391637,391714..391797,
FT                   391877..391954,392038..392067)
FT                   /codon_start=1
FT                   /gene_family="HOG000181652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636325"
FT                   /locus_tag="CNC01420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42162.1"
FT                   /db_xref="HOGENOM:HBG011422"
FT                   /db_xref="HOGENOM:HBG526194"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniParc:UPI000042CBE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY4"
FT                   /transl_table=1
FT                   /translation="MVRLITHNMLACHVKNCTKDNFPLVFSEVELVERPAPINPDFIKR
FT                   FLPKLDWKALVDTARSLGDTSLPDTMPENWTDEEIQALHHVLFELHVEEGIMTCRGCGH
FT                   AYPVANGIPNMLLAEHEVGR"
FT   CDS_pept        join(complement(394290..394535),complement(394172..394240),
FT                   complement(394019..394123),complement(393624..393969),
FT                   complement(393457..393577),complement(392154..393405))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805497"
FT                   /gene_name="PFS2"
FT                   /locus_tag="CNC01430"
FT                   /product="Polyadenylation factor subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42164.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG268234"
FT                   /db_xref="HOGENOM:HBG736644"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00004B43DF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKY3"
FT                   /transl_table=1
FT                   /translation="MTAPTVPADQHGHPLPGPADPAANDTWRPSRYREPLHPDNEEVLE
FT                   QAAYQAAVTRSSGDDRKRKIKPRRTVDYQGGVQKWRMLNKLKGVHEFRPAIHPNPSDIV
FT                   NFLPPVALRSNPSTSICDYWVHTSINKERSPTRVVRWTPDARRLLTGNDKGQFTLWNGA
FT                   SFNYESITQVHDDSIRSFTYSHNGQALVSADKGGTIKYFTPHLTNIHGFQGHREACHDV
FT                   SWSPNDERFVTCGDDGLVKIWSYREAKEERSLSGHGWDVRCVDWHPTKGLIVSGSKDML
FT                   VKFWDPRTGKDLSTLHSSKSTINTCRWSPDGHLVATAGQDSVIRLFDIRTFRELEVLKG
FT                   HEKEVNCIEWHPIHHSLLVSGDALGTINYFSLLSPTPSTPITTLSAAHEDAVFSLSFHP
FT                   LGHILCSGSKDFTARFWCRARPPGGQEFDKWHLTEEGAAQKELERITKREWGTNAPPAN
FT                   AAGGGGGGGGDKQQVALPGLSNLVAAVNSVKTGPTTTGGGPSGLPGLGAPNVHAGTPPS
FT                   RVSTPSSMGPPGPGAQGQAQGGQFPRGRSALPSQNDMLRHNHGSRGGFADRDRNGGGDR
FT                   GGMDRDRDSRGGRQDPRGNQMYGRGPGGPPPGPPPGQGGYNYPPAPPNYPPYPPSSYPP
FT                   PPNNQPGYPPAPNYAMPPGPGAPPQSYPYNRPPQGPPQNNNPGGQGNYGASASGGYGQY
FT                   GGGGGGGGGGGYGRDGRR"
FT   CDS_pept        join(394683..395925,395990..396193,396267..396364,
FT                   396453..396647,396725..396888,396942..397105,3
FT                   97181..397215)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093113"
FT                   /gene_name="ABD1"
FT                   /locus_tag="CNC01440"
FT                   /product="mRNA cap guanine-N7 methyltransferase "
FT                   /EC_number="2.1.1.56"
FT                   /function="RNA binding"
FT                   /function="mRNA (guanine-N7-)-methyltransferase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42167.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004482"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="HOGENOM:HBG175933"
FT                   /db_xref="HSSP:1RI5"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="UniParc:UPI00004B43E0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKY2"
FT                   /transl_table=1
FT                   /translation="MVYDPIRDCDVPAPHISAPPLSRSRSPPPPHRTPSASGSLRGLLN
FT                   DSPPPREPPRAASVHEDAESHRPKLSNILNDAEPPRQRSMLPPQQPIHAELEHGRRTSA
FT                   GSHAAQLARSPSMSLSPRSQNQSLPYPSSRPGSAAGSAHPFGYDPRQGTLSPVLSARRT
FT                   SEDQPRPTSSSSASGRRYTEPASQTPAPAPLGSSAYRPRHTSTPGNPSSAYAPRFTPQP
FT                   TTTPSSPSTSQHTPYTPHHSAPPRILHYNPHRQSAPSSVLRPIYPDEVAHLRQLAHANN
FT                   PLRQKPAARRYSYSGGRAPEPTPTPRTSLPGENDHSYFPPQWDDRPSMPPSEVSYGGPP
FT                   SSTPGAPPSGYSQYPPNWEAQTPGGNWDGERPGRLGKRRARDEEDDEYERNKRVVSGPV
FT                   AGQAYSKKVTVVAEHYNSRPEVGVERREFSPIIGLKKFNNWIKSVLIGKFAYRPRGKVL
FT                   DVGCGKGGDLNKWKQARIALYVGLDVADQSVQQAADRYRRMPKPGFDAFFYAHDCFSNP
FT                   LSDVLSPELQIKDLYDNVTMQFCMHYAFENAAKARMMIENVSRYLRRGGIFIGTIPNAE
FT                   LLLQLPDRDEELRFGNSCYSIQFTERRHKGVYGHDYRFYLTDAVEDVPEYLVDWENFVS
FT                   LASESGLRLVYKKAFHEILQEEKDSRDFGPLLGKMGVLNEYGESAMDADQWEAANLYMG
FT                   FAFEKM"
FT   CDS_pept        join(complement(398776..399646),complement(398546..398624),
FT                   complement(398323..398497),complement(397815..398254),
FT                   complement(397655..397745),complement(397550..397579))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636326"
FT                   /locus_tag="CNC01450"
FT                   /product="Triacylglycerol lipase, putative "
FT                   /protein_id="AAW42663.1"
FT                   /db_xref="HOGENOM:HBG067659"
FT                   /db_xref="HOGENOM:HBG175934"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI00004B43E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY1"
FT                   /transl_table=1
FT                   /translation="MLPRAPRTLYHPTKAMYQPHKVGNSARQTFNSQSRSDIRHHQQPP
FT                   STETADGAAKSRRKGKQRADPLLIQPNPGKEREIEGSTSSVPALIDEAIHTSISPTSLS
FT                   SSLESSFDRACPSPIPEPPRVHYPPSLRPRHPRLLSQLARSTLPTASVSCPSLEQPQHG
FT                   RRWSVSESMVIGAGEGSSLWQRSVPTTALSDEPFPDLDPTTGLPLELSFHRRGSASSDT
FT                   PSLHLQRTITGLLSAPTAKSAGESSVANMMPNFNFSLPRVSFPSKPSLDFGKRNFSTSS
FT                   SQDDWGSWANRSPKHPVVFCHGLLGFDYLGPASMPPLQISHWRGIREVLESNGVEVLIA
FT                   RVPATSSIKDRARILADFISEKYPGREINLVGHSMGGLDCRYLVSQIKDKSFKPISLTT
FT                   ISTPHRGSPFADYLIDNVIGRERLPSLLGLLETMRLPQSGDGSAFSALGTNSMKEFNAE
FT                   VVDSEDVKYYSWGASFEPGLLDTFKWPHSIIYAKEGANDGLVSVHSAMWGEYRGTLVGV
FT                   NHLDLVGWVNTVRYAVAGWTGKPIAFKPATFYLEVTDYLAEQGF"
FT   CDS_pept        join(402173..402466,402529..402631,402681..402979)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636327"
FT                   /locus_tag="CNC01460"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42169.1"
FT                   /db_xref="HOGENOM:HBG175935"
FT                   /db_xref="UniParc:UPI000042FE48"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKY0"
FT                   /transl_table=1
FT                   /translation="MDGCYEEVRNDGKFSTQISLLQDHVRSSLSMATELRLSSAPSHLV
FT                   LPHVLSAVQLSSELGMWRLYRFGVVVLAEVMLGMEAVPLSKKAIHEIESVWSQLIASDD
FT                   YEALARGALVIAKGYIELSLDSGSTAEHDSANDHLFQAFTYAKLLESRSLVMEITSLLA
FT                   LLSELRLSGEFADSAYIRGSKKSRDSMVDAYEEAQKGVGEAFSKGDMIVREVAEVVKWV
FT                   GVRVAEGWK"
FT   CDS_pept        join(403505..403507,403563..403655,403708..404036,
FT                   404092..404361,404415..404887,404934..405350,4
FT                   05398..406044)
FT                   /codon_start=1
FT                   /gene_family="HOG000172552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805498"
FT                   /locus_tag="CNC01470"
FT                   /product="GTP-binding protein, putative "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42171.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG064217"
FT                   /db_xref="HOGENOM:HBG610636"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI000042D592"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX9"
FT                   /transl_table=1
FT                   /translation="MPPRTKVQSSGLGKALINRKAKEAVAPKESQLYTLDDNNPLASVT
FT                   HERDLDEFLANAALADQDFTTERTKLRVISAPNMPTPSTNPFLLSAEEEKEVTKKKRDF
FT                   QGDLTVPRRPPWTRQMTRLELEKQERESFLEWRRDIAKLAETSNLLLTPFERNVQLWRQ
FT                   LWRVLERSQLVVQIVDARNPLGFRCQDLENYVKEIGSDENDEEITVAGKGKRRSLLLIN
FT                   KADLLTYDQRSAWAEYFEKEGISYAFFSAANAAAAQEQAEKQRLRQQEEYDGPKGSSEE
FT                   NEEESEEQQDETEDEQDETEEEHLINDLRETHLDEEDWSSESAGRSGNVSRSEVDEKLA
FT                   EGQTLSLSEVAQDVGARFGESTEQEDVRTRVLTVTELEDLFINAAPDLKDFATPQHPNP
FT                   KLMVGLVGYPNVGKSSTINSLLGAKKVSVSATPGKTKHFQTLVLSDTITLCDCPGLVFP
FT                   QFANTQADMVVDGVLPIDQMREYSAPVDLLCKRIPREILEGTYGIRIDVKDEEEGGTGK
FT                   VGWEEFLSAYAIARGMTRSSFGMPDTSRAARYVLKDYVNAKLLFAHPPPGIDADDFMSV
FT                   SRAETIARIEESYENGRKRAPVTHVSKNADTYVQPASAKAKDSLDDETEQGQDQTKRER
FT                   QSTSRQVKSTAASAPARSGREKASALDSVYFNESGAQPRLVIKGRNQPGDAQEGGQGFS
FT                   RTTRYPHQRLLGPDGMPILGAGGRDLGGANGKKHFKRKEGKKRSGKGYD"
FT   CDS_pept        join(406625..406780,406880..407062,407126..407334,
FT                   407392..407722,407778..407905,407950..408158,
FT                   408218..408443,408494..408562,408613..408634)
FT                   /codon_start=1
FT                   /gene_family="HOG000173549" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805499"
FT                   /locus_tag="CNC01480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42173.1"
FT                   /db_xref="HOGENOM:HBG055168"
FT                   /db_xref="HOGENOM:HBG367608"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="UniParc:UPI00004B43E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX8"
FT                   /transl_table=1
FT                   /translation="MLRTSGSTNKVLLSRLGCRLMQTQTAGGRAPNLPLPSMVGSKPPR
FT                   KEREEGNISSVFSSLSGEAEKPLPPRFAELKRTIIGEEANQRRLIAGWERLTKRLRDAA
FT                   EEIERKQQDNIPQTSYDEFINGGNASLIERIKACGAVIIRGVVDEQTALKWLEDVKAYI
FT                   AKNPSVKGFPENDKQVFELYWSKSQLAARSHPRSMAIQRALLSLFSHNPSAPVSLHTPV
FT                   TYADRLRIRHPGDAQFALGPHADGGSVERWEDETYRKVYQRCLEGRWEEFDAWTIGERA
FT                   LANQNMYDGPGSCGVFRAFQGWTSMSDTGPNEGTLRVYPLIKELTAYTMMRPLFREKQP
FT                   RATLSRDEYLSPANWELDFETSRFPNSPLARCQEYNDETHPHLELERTMVSVPRVKPGD
FT                   QAWWHGDMIHSVESMHQGQGPSAVLYIPAVPLTPQNADYVRDQRSQFMQGRPAPDFPGG
FT                   VGESSFAGRGTQEDIESHDGRQAMGLEPFEINERLAPGERQVRQQANEILGF"
FT   CDS_pept        join(complement(409373..409459),complement(409244..409315),
FT                   complement(409040..409190),complement(408957..408979),
FT                   complement(408709..408900))
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805500"
FT                   /gene_name="CYP1"
FT                   /locus_tag="CNC01490"
FT                   /product="Peptidyl-prolyl cis-trans isomerase-like 1 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAW42175.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000042DA62"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKX7"
FT                   /transl_table=1
FT                   /translation="MSGPSPTYVTFDTSVGSFTVELYTAHAPKTCNNFAKLAERGYYNG
FT                   VIFHRIIPNFMIQGGDPTGTGRGGTSIYGDRFADEIHPELRFVGAGILAMANSGPNTNG
FT                   SQFFITCAPTPYLDGKHTIFGRVSSGMKTIQRLEAVRTDKDDRPVEEIKIHRARLGDAT
FT                   QGGGLAVAMPA"
FT   CDS_pept        join(409884..409937,409991..410033,410091..410249,
FT                   410302..410418,410475..410562,410618..410699,
FT                   410755..410838,410898..411144,411194..411211,
FT                   411278..411409,411465..411510,411561..411629,
FT                   411681..411804,411859..411864)
FT                   /codon_start=1
FT                   /gene_family="HOG000210954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805501"
FT                   /locus_tag="CNC01500"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /protein_id="AAW42177.1"
FT                   /db_xref="HOGENOM:HBG059099"
FT                   /db_xref="HOGENOM:HBG619751"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniParc:UPI000042F786"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX6"
FT                   /transl_table=1
FT                   /translation="MGRNGMFGSFQGFDAFGKTMEDVKIKTRTGALLTFISLSIILTSV
FT                   MLEFIDYRRIHMEPSIIVDRSRGEKLVIDFDIEFPRVPCYLLSLDVMDISGEHQTEFEH
FT                   QVTKTRMNKDGNVISKVQGGQLKGDVERANLNQDPNYCGSCYGALPPESGCCNSCEEVR
FT                   QAYGRKGWSFSDPEGIEQCVEEGWMDKMKEQNEEGCRIDGHIRVNKVIGNLHFSPGRSF
FT                   QNNMMQMLELVPYLRDKNHHDFGHIVHKFRFGADMTKAEELTVLPKEQRWRDKLGLRDP
FT                   LQGIKAHTEVSNYMFQYFLKVVSTNFISLSGEEISSHQYSVTQYERDLRTGNAPGKDAH
FT                   GHMTSHGMMGVPGVFFNYEISPMKVIHTEERQSFAHFLTSTCAIVGGVLTVASLVDSLI
FT                   FNSSKRLKKKSEDSFRGPSGKIL"
FT   CDS_pept        join(complement(412871..412965),complement(412783..412824),
FT                   complement(412645..412733),complement(412341..412595),
FT                   complement(412133..412281),complement(412053..412082))
FT                   /codon_start=1
FT                   /gene_family="HOG000199586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093114"
FT                   /locus_tag="CNC01510"
FT                   /product="Mitotic spindle checkpoint-related protein,
FT                   putative"
FT                   /biological_process="mitosis"
FT                   /protein_id="AAW42179.1"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="HOGENOM:HBG028452"
FT                   /db_xref="HOGENOM:HBG314247"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="UniParc:UPI000042F34D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX5"
FT                   /transl_table=1
FT                   /translation="MAQKQATRTNQAITLKGSTALVTEFFEYSVNSILYQRGVYPSDDF
FT                   RMVKKYGLPMLVTADEELKEYISTVLNQVQEWLLSSSLSRIVLAIKSVETGETLERWQF
FT                   DIYTDESALAPLPGGPPKSAGSKKKEKTEKEVQGEIREIMKQITSSVTFLPILEEQCTF
FT                   TILAHTNDSPDVAIPATWNDADPHLIDKGKVEQVRLRSFSTNVHSLEAMVAYRVGE"
FT   CDS_pept        join(413196..413546,413603..414156,414206..414827,
FT                   414877..415020,415076..415375,415440..415904)
FT                   /codon_start=1
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942091"
FT                   /gene_name="MEF1"
FT                   /locus_tag="CNC01520"
FT                   /product="Elongation factor G, mitochondrial "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAW42181.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="HSSP:1FNM"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00004B43E3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKX4"
FT                   /transl_table=1
FT                   /translation="MSAIARAAARVRQQNTTPLQRPLLLQRKPVLTHTLALHASPLKPS
FT                   LATSITSPNFQQSFQRRWASASATAEEGAKEEVWPQRKLPELTETDKLRLRRQRNVGIS
FT                   AHIDSGKTTLTERVLYYTGRIRDIHEVRGRDAVGAKMDSMELEREKGITIQSAATFADW
FT                   VAPKPPTELKEGETVGNTDKQKFAINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVSG
FT                   VQSQTITVDRQMRRYNVPRLAFINKMDRAGSNPFRVIGQLRGKLKMNAAAVQVPIGSES
FT                   DFAGVVDIVRMKAIYNEGVKGNQIVETDEIPESVRALAEEKRAELIEQLSEADETLCDL
FT                   FLDEAPITPTDIAQALQRATTSLRFTPVFMGSAIKNTGVQPLLDGVCAYLPNPSEVQNQ
FT                   AMDATLPAHAPTIPLVPATDAPLVGLAFKLEEGRYGQLTYMRVYQGELKRGSMIYNART
FT                   GKRVKVPRLVRMHADEMEDVDAVVAGEICAMFGVECSSGDTFTDGSSTYTMTSMFVPEP
FT                   VISLSIRPEGNETPNFSRALNRFQKEDPTFRVHVDSESQETIISGMGELHLDIYVERMK
FT                   REYNVACVTGKPRVAFRETITEAAKFNYTHKKQSGGSGQFGRVIGSIEPMETDPDTGKD
FT                   TAFENRIIGGNIPNQFIPAIQKGFQEALDRGLITGHPITGCKFVLDDGSAHAVDSNELA
FT                   FRLAAIGAFREAFNKARPVVLEPVMTVEIVAPIEFQGNVIGAINQRKGTIVDTEVRDDE
FT                   FTLTAEVALNDMFGYSSQLRGMTQGKGEFSMEYKNHQPVLPNIQKEMAEAFRKKQLSK"
FT   CDS_pept        join(complement(426266..426488),complement(425853..426113),
FT                   complement(425183..425812),complement(425002..425143),
FT                   complement(424809..424960),complement(424553..424728),
FT                   complement(424239..424515),complement(423749..424194),
FT                   complement(423220..423691),complement(422819..423172),
FT                   complement(422533..422653),complement(420437..422479),
FT                   complement(419122..420387),complement(418507..419071),
FT                   complement(417468..418459),complement(416784..417414),
FT                   complement(416588..416638))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805502"
FT                   /locus_tag="CNC01530"
FT                   /product="Fermentation-related protein, putative "
FT                   /protein_id="AAW42183.1"
FT                   /db_xref="HOGENOM:HBG067657"
FT                   /db_xref="HOGENOM:HBG175937"
FT                   /db_xref="UniParc:UPI00004B43E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX3"
FT                   /transl_table=1
FT                   /translation="MAVPVNLLLLIELAAVIVASTAFLFYWNRLLASFVAFLIRLYAWR
FT                   VHHAYISIGSLQISPLAGRLSFRNAEYHSSKLPCRIIVYAKGVEAFVYNRTPAYDDIVE
FT                   RMKKHENEAGGVKGASHGYGDFEEELGLRARLKNLARMSTKDSSAKGTPSDNGHSSSSY
FT                   PPVTHELPAQVKPVKPPPSDSINWFREALPLELRVVAGSIVLGNDATPTLLIGDFKRAE
FT                   GILETSDSRSLLDLYKMAVELKFHEANVLTRTNVDYSGPLLAHGKKVYDELLKQQVDLV
FT                   NKPPSTISVFSGFHFLSRQFPFLYDPKFSTAPVPGLPTDKLWKGLARYRLPEDDTIQSP
FT                   RKEGGDEREYAKATNLLEAPELTLTYYADIPGNVPDPLQTPYGDILDEIGNVDLPPEYG
FT                   IDIIIRKGTVKYGPWADRQREALQKAFAPALFFDSEPKARLRPGDTRVHTALVLRVMLE
FT                   DETVLRIPTREKRRYGWLDVVVGPNSSVTYTQDQIATQRGYDSMLVLHLDSLGISSSVN
FT                   LDTFIQAKTCKLSMAMPTPLQWNAKRDWGMDVVFDTPSISLLRDHVTLISDLAKDWSSG
FT                   TTGGDYHHFVPNHYNFRVSLINYAFHLYINDYNIVDAPGSRDSNAFMDVYGPRLDAVVA
FT                   VASTQYRPEASVVPFSISLSDARVELCVPKWDTHRTFGPEVLEVGQVGQLIASGSYRYY
FT                   AVPRPEHQETLTLHLEGKHVKFKMLGWVLRRLFCVKDNYFGSFTQFTTMDEFLERFDHD
FT                   PASVGDPVEEKYRPGRSDPYAVHITMNVEESLILMCDEIYNFSGGIALPVPQLQMTIKS
FT                   VEQFMELSLNATPTYIAAAPQLLPLYERGSAPVVSGEEAIFIEGIELKASRLFGPKPRA
FT                   TTYLCLWEANIPKISAFLTPSLLTTLQAIGRSVGYTFSDPDNAPDQNYQLKTPPDVTFF
FT                   KFSINHALAMLTADSSAISLEALSGLTLDTSTWGTRSYSSNIGLLLPSFTINIVHRSPR
FT                   KTWRVVSSAAVGATLDVYNAPDRWRERVSAQQEFLKEQDSETGRVWYMYRGGQKPMEMI
FT                   DEEESESLLSERHGYDSNDSQPSSSIESGPEESNPSKTWGKRNPVKPFMTIQETDDSSV
FT                   SSAGDESDSASGTSSDSASEVSFPAEYVFDMADVLANKLRHFQFARDRYPPEIRLSASD
FT                   SDYGGGEEEIKGKRKARDEMASGKVVRLVTHAAQVNLHPESLQSISEIVSAISTGSVSY
FT                   EKRLDSLLISQVQDVADSKIPEQQMVLDIHVPSATMRLSGGEPSSALISHIQHIRCNIH
FT                   RYTLINQRPVLDLIFSVVSITASAMSSSDTASSLKDIVGPTTESPEYLPLAHFVASAIT
FT                   AGFHSGHGIRIHSKVSHAHFDTVTPAITFGSAFAERWQAVIQEANFSHPKTGSDAAMLC
FT                   HILYSAINSQRGAYLPSFAYVTPHGLHEQDSQLGNRRQTGWWLLTRFRDWLRGGLLDEA
FT                   DVVANISDMANYFVSNLIQVDDSLVGTENLVRDQPFFKRAFNIGSSCTPETECDTPIDV
FT                   FVYIDNASVRHYGRLLGSTATAMSYINISKLSFGCATVIAMIEERKISQMRMVVAIQTV
FT                   GLEVHDSILTLARLIVHIPCKPKPEFGKGESPGESLPSFNAIGKSPSAIAINIQLETLD
FT                   ATIIGGGLRLRSGARQLQLTALTRHRLHSNPVSGRSTRESLSLTCRLIEIILIQPVENP
FT                   AAITHSTDRVVISLKTQGWRASGERIASVDKPSTEIRAMAGLKLLEFDSRPQLRAFYSF
FT                   IQQWKAKELPLYASAVDDMKGAIKAWTNGPPSKSTPVLLTDLDITIEALHFQVRAAKAL
FT                   WLRWEVGKIYVVKSEKKKDIRFAVKVAPQVVGAYYSRRSKSSESSSLNLPSVAIIGNHR
FT                   HLQDKPHVFANLQLGLFSGVLRPAILDRLLSLHQNLQDDINHLVNDWRKDVRKAKEKLH
FT                   AQKGWRSPSPGARKVSLNKILYDVHVRVDGVRFGLRADDVPATIVFEALAAKGRATNQY
FT                   HHGNGLHWRAKVDHFSLSLGHLDDGYVSNDTEPFRRQRTASMTLDVEVEEIPATPLLTS
FT                   QLIIHLSHVRTVMHVEALSELTDLLKSWSSDLYILRDHRAREMAEVKQRTTKVLKRFES
FT                   AEHVNRSEISWLANRLLTVEIGGIGVAIPLVEGAVIEDCRKSDVPALLYSIRVISFHNR
FT                   HNEAARFRLQNMALQFIDRFDQSLPEHFTSDFHGSKNCMVVPSIESEAEMSSTHEAWHL
FT                   SAHCSASDFKLTLSPDISDDVIQLVELFERGKEKIAKVEAQYKVEVAGHAKETIASKYE
FT                   SPASPSARRQSQRIMVRTSFTFNSGTVELHRDLSDTEKATLSSETRRGRGWHDTVVLPA
FT                   VSLWMEYTGPKDEVPLFPQDEGDGSLLFNLAVHESRNLLRPTILPFFLQIANRLGRKAK
FT                   RTQSTPLDTSPKMPMEVSPAVPQGLSRRPITRTVSTRVQVSVTLRIDKSELRLSCAPDS
FT                   NAYVDLKWKSGGFFASTIIGDGSKATVAGTVSGVRAYLRHEFAEGKSCIEAGAKDMAFS
FT                   IDYSFESLTGRKYLSIVLDSLLSAQFRLEQFSAWLAFAAVWLDNAPNLELPSRPPLGEA
FT                   SSSSPSIHTASIPKVTVSALVRFRTVDFDTNIGVTNAKLEMTPVVLRTSSNGVKAELEL
FT                   DLGVTQITAKGDISGEIRSESLIFRTARQSSRGGAPDDPTVLNMSINAGTLSSNLSLQE
FT                   LSVIRFTLDPATVTLADDWQAFAQDPSSQVLLSFAVKAGVFRSVIRLLSIPSLVSKFYS
FT                   LSNTIESQERMACHRSSAYKSKRLRKSTEPSPMAAAILHTARKTGQTLTSTSTVKTAQN
FT                   MRFDLGGVDIGLFNSPPTDDHRGDFYRFTMGKVEADLERQLTAENLPKRDLNLLVSYVK
FT                   WVSSDGVKAAREVKKHRNLEESIQAASAHGRKEIASLPLMLSCPISSNRYTKHSTN"
FT   CDS_pept        join(426904..427290,427340..427744,427796..427888,
FT                   427936..428101,428151..428547,428598..429075,
FT                   429128..429424,429474..429834,429890..430818)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636328"
FT                   /locus_tag="CNC01540"
FT                   /product="DNA-directed DNA polymerase, putative "
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /protein_id="AAW42185.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="HOGENOM:HBG067656"
FT                   /db_xref="HOGENOM:HBG175938"
FT                   /db_xref="InterPro:IPR007015"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00004B43E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX2"
FT                   /transl_table=1
FT                   /translation="MTSNVLPLFWPLSNLSKETRLTASANLVSSLESFQRSFSQNAGSS
FT                   KGKEIEDDDEDEESASDSEESGMEVDASDDEEENDEKHSQAAKLDRQLSKDNAEDVVYS
FT                   VKRLVRGLGSSRESSRLGFAVALTELLSRIPTVTARQVFSLVIRNSQYSKNMKGSDERD
FT                   MMFARLFGMTAIVQSQSLFAPSATKDDFRGVIEELEKLGQAKAWMRESAWWALVQSVLL
FT                   LLESRVQWKEDALREVIDVVFEEKGWTQEKVALVLTLEQSGLDIDWKTHLAPTFKHTPL
FT                   LNTHNLVTLSRILKETSGDEEDGVSATITGSWKPQLHFVWNIILDRYFGPSALSTTLAS
FT                   FQDFFRVVVDESLFSNTSSPQRRYWGFQVFERALPLLPSSQMPLIFTPNFMRCWMNNLS
FT                   SPDRYLHKAAQQIAKKVQDIIKENPKVGYTLLSQLVGKHGRPDFDKVTKTKTVESIMGK
FT                   LNEKGVRDFVDFLKETILGASSHENLDAARLAERRSWALDQIQALCRNGSVPKDDAWVA
FT                   PLFDFLLVHGFFIIRSVNKKSPITAIHTVPKPPLSENTSIACRAKFFACAVELTTASIP
FT                   RKNGSEDSKARQQGCDASGRLWLRRAIDIISILVDDKKHVEVIADADEEIKSIRNAALE
FT                   SLSSLDKVKEDRKSISRAFEILISFFILQTYDEVEDSLENLEEVNTAAQQYLGQKEEEE
FT                   TQAADMLLDVLIALLDKGSSDLRNLANLVFDIISPELTKSSLNLLSAQLEQSAAEAAAN
FT                   ESAEESDEDADGDDAASDSDGGEANEEDEDEEEDEEHDEDLGDVDPAFRQRVAEALKVS
FT                   GMDAGEDVEEGSEAESEEYWDDDQMMKVDEQLAQVFRERAAAASKNDMKHILTESIHFK
FT                   NRILDFYDTYAKRQPTNPLIIDVILTLLKLIRSGGVSEAEVTNKAAGILRSKFNKPKDV
FT                   PSTVNIEAASESLKTIHSMAQKAHSAEFSTLCSLCSLFVSRAIDASGISSNSATSTVVE
FT                   IYRATLKDFIIRKASLVHPPFLLEFVKRFPVRAFSLYHDLVSYVAPGAAVNAFRQLQAY
FT                   NALQILAQHLPVISKSVSPTEVIKFVQEASESVFTTLETAAEANSDSKDALNAQKLKDV
FT                   VKFALQLARNSKNVGISWDIRRVSEVGETLKHGRRTKEMKGVHSMWIQLEAILSNKKGE
FT                   KRKR"
FT   CDS_pept        join(complement(436506..436528),complement(435674..436434),
FT                   complement(435609..435624),complement(435542..435563),
FT                   complement(435463..435491),complement(435344..435409),
FT                   complement(435157..435282),complement(434889..435103),
FT                   complement(434712..434838),complement(434413..434663),
FT                   complement(434280..434360),complement(434186..434232),
FT                   complement(434087..434136),complement(433980..434032),
FT                   complement(433920..433929),complement(433799..433864),
FT                   complement(433368..433746),complement(433208..433309),
FT                   complement(433083..433147),complement(432981..433025),
FT                   complement(432698..432929),complement(432536..432632),
FT                   complement(432457..432482),complement(432319..432401),
FT                   complement(432247..432257),complement(432073..432196),
FT                   complement(431863..432032),complement(431731..431809),
FT                   complement(431459..431678))
FT                   /codon_start=1
FT                   /gene_family="HOG000029776" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805503"
FT                   /gene_name="MSH3"
FT                   /locus_tag="CNC01550"
FT                   /product="DNA mismatch repair protein MSH3 "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42187.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG377949"
FT                   /db_xref="HOGENOM:HBG735169"
FT                   /db_xref="HSSP:1EWR"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniParc:UPI00004B43E6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKX1"
FT                   /transl_table=1
FT                   /translation="MPSEGSQQPSLDSFFKRKNPRVEPYSRTGNNAIIDLTDSPPNKKI
FT                   KLDDEGSQKNRSMTQTSSSYFKGHPTARPLSVDKRLPRKPSAAIQAYKLQDVIPPQPSH
FT                   SGLAFETCSLVPQASFVPDSQPEPSASPAPQRTTEQLKRHEEWKTRILAMSGSFRRKRS
FT                   LALDEAVAAEAREAAGLEDEGTPFDGSDGDDYKSESEKNAEEVGKQLKKYVAKELAGKG
FT                   KSKGKKKEEIGPSGLAYTPLEKQFMEIKEQNRDVLLLMEVGYKYKFHGEDAKTASRELG
FT                   IVAFPNRNFFTASIPTHRLHIHVKKLLSLGYKVGVITQTETAALKKIGDNRNAPFARKL
FT                   THLFTAATYVEDPSLSSSSSSSSSVRFDDPVVPGTAPPPTNALVAIVEQPVDRASDDRV
FT                   KVGLVCVVPGTGDITWDEFDDSQIRTELETRLAHLSPAELLLPKQRLSKATEKVLTYFA
FT                   GEPKHRGRNAVRIERIDNIPEYDAAFDFLTNFYHCKEHKATVSKGDVNDERHLMTEGNK
FT                   QWSLQPKLSQDGADISLDEEIYLASGVSSSKAILTLVDFPKQVVISMAVAIRYMKRFGL
FT                   ENAFKHTSSFVRFANRSHMLLSSNTLANLEIYQNQTDGGLYGSLIWLLDHCKTRMGKRL
FT                   LREWVGRPLLDVAALKARADAIEEIMENNSYHMEKLRSLLINMPDLVRGLTRVQYGKAT
FT                   PNELATLLITLVRLASEFKPNMGNVFRSCLLNNIPNTLPTILDTSQRFLNALNLKQARE
FT                   NDVANLWADPDRFPDIQDVKDCISVCEMELNEHLMELRKILKKPTLRYITVSGIEYLVE
FT                   VPIRDTKIVPAQWMKISATRTVNRYHTPKILAITKERTQHLEKLSIVAREAFIAFQSEV
FT                   AEYHELVVVSKQIAVIDCLMSLAQTAAASGYCKPKFVAEPELKILAGRHPMVEMLREES
FT                   YVPFDIHFSKEEGTTKIITGPNMAGKSSTVRAMALIVCMAQIGSFVPAASVTLSVHDSV
FT                   QTRMGASDEIGRGKSTFMVELSETSDILQTITPRSLVVLDELGRGTSTYDGIAIAYATL
FT                   SHIAEIGCNTLFVTHYPTVAQDLAREKPDKISNWHMSFDEIQMPDGGAEITFLYQLTRG
FT                   LQEASFGVWCARLAGLPKPILDTAQMRSSSLKAETQERLRGIVARRVGWMLHNLFDNKT
FT                   SSSQVLRNVEMLHNSLSSSSISFSQ"
FT   tRNA            complement(436889..436970)
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        join(complement(438834..439053),complement(438081..438769))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636329"
FT                   /locus_tag="CNC01570"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42189.1"
FT                   /db_xref="HOGENOM:HBG175939"
FT                   /db_xref="UniParc:UPI000042D99C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKX0"
FT                   /transl_table=1
FT                   /translation="MGRSLDPVWEFYYRIEQDVQSLGLKAKANSAHNNGWCKNCVRMKL
FT                   VGPEMATWVPDDSVLAETGQIETARRYKAMSLCQPYTGVPSRLRSHLQRCSHSQGIMIP
FT                   DAVPLKKRKSHPGSPGTEAGPSGRHSTPVKAGGRGKLSDEQQGEFNVHLWHIFNMLDIP
FT                   IETLTNPTFVQFFSKYIPQATLPSRSLFYTLSASRNIAPPNLSSAAATVGPTGSPDFQG
FT                   LARLAAGFASVPGVTGVSELSGVQGESGVPHHVESDGAHEPDLSHDSQMQQVSGASHIR
FT                   GVPGVSEDDISDGGKGELSYE"
FT   CDS_pept        439671..440879
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942092"
FT                   /locus_tag="CNC01580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42191.1"
FT                   /db_xref="HOGENOM:HBG175940"
FT                   /db_xref="UniParc:UPI000042C1B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW9"
FT                   /transl_table=1
FT                   /translation="MAYAISRLTAESDFSQCFDSHMLQQQSPDQEQTHVVAPGATIYDD
FT                   VTRLPIYDGEPWREAFNATKTTHKNGTNTAVSQLAGIDTSLLLSSPNSNASSPTNIFVP
FT                   ELLDVHKALDSEPLNQNQFRQLDSITEQYIIPGSLDFTSPAIKLEFDSQARQQYEANSQ
FT                   FDHASLFRKLGKPLSTPQVQFNVFSQFFVSPADNESFLSVNPDDVTLKRKVFESELTNG
FT                   REIKRRDVTSSFGDFTHGVQPPLLSQQLVSPVTDSGNVVFNSELHPKEGSDATHNSKVS
FT                   TTRPKSVVPEKFLNDGSAELALGMSVTKIQSFPTFEELLKHVQPCHYSHAKSFGEKIAR
FT                   NRIKAKNAAKRSRDQRRAKIERVEDLEKRIEELKMQVKGMKLLLGRLVDSGAINEDVVQ
FT                   AYL"
FT   CDS_pept        join(complement(442138..442681),complement(441855..442086),
FT                   complement(441398..441801),complement(441025..441347))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093115"
FT                   /locus_tag="CNC01590"
FT                   /product="Rab escort protein, putative "
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="AAW42193.1"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG067655"
FT                   /db_xref="HOGENOM:HBG175941"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI00004B43E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW8"
FT                   /transl_table=1
FT                   /translation="MSNIELESDSYDVVVIGTGIAESIAAAALAKAGKTVLHLDPNEYY
FT                   GGEQASLTLDELVEWSTTRVESSSAAVSYTHASTSVVTPTLQNDRRRYALSLFPAILPS
FT                   RGPLIDVLISSDVSKYVSFKLLDSVNIWDEDCAGARKVPGSKEEIFKDKSVSLMDKRKL
FT                   MKFFMFAAGEFEHNDIIRGKETQPLLGFLQDSFALPTGLALSIAYAIAHCTSPEDQTLP
FT                   ALMKTRRYLKSLGRYGSSAFLVGQYGGAGEIAQGFCRGCAVYGGTYVLGQFGKPTLIDA
FT                   NDDDVTLSLPCHPRPVTAKHLISSSNHLPPSLLIPKSEPSKRTITAHSIAIISSLPKVL
FT                   QRQLPSADDENGRSQLPEENDDTGLIVFPPENGNPTVRCLINGEGTGSCPSGQYILYFS
FT                   CPASTASSPSNLLKPYLQRITSEPLFESYYVSTRATSSYSASSPKVIIVTPFYRDDLIT
FT                   EGLDWEVKEAEKAYYSVVGQDGVPFFDVTESEADEMGIFEDH"
FT   CDS_pept        join(443150..443243,443309..443704,443762..443799)
FT                   /codon_start=1
FT                   /gene_family="HOG000157271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942093"
FT                   /locus_tag="CNC01600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42195.1"
FT                   /db_xref="HOGENOM:HBG175942"
FT                   /db_xref="HOGENOM:HBG328861"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI00004B43E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW7"
FT                   /transl_table=1
FT                   /translation="MTTSLFVPVAYITVLVTAMAIFSRVYRRRRAVSKTSIEPWFPSHP
FT                   TREVYMSLLADEPPAPENLLKAALLSRAITDVQRIWRLKDDKTALASLHTRGLVGDDTM
FT                   ARFAAAEKELEAEIVDVISEANTFKQGWGQFLFATATEMAQSEKTKEAVINMHKTRIAE
FT                   EKRLARRAKYDT"
FT   CDS_pept        join(complement(444870..444952),complement(444755..444814),
FT                   complement(444603..444703),complement(444482..444549))
FT                   /codon_start=1
FT                   /gene_family="HOG000234654" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093116"
FT                   /locus_tag="CNC01610"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42197.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG210755"
FT                   /db_xref="HOGENOM:HBG385452"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="UniParc:UPI000042C1A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K8H5"
FT                   /transl_table=1
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGA"
FT   CDS_pept        join(complement(450007..450154),complement(449801..449959),
FT                   complement(449494..449755),complement(448138..449446),
FT                   complement(446957..448089),complement(446302..446910),
FT                   complement(445894..446251))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942094"
FT                   /locus_tag="CNC01620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42199.1"
FT                   /db_xref="HOGENOM:HBG067654"
FT                   /db_xref="HOGENOM:HBG175943"
FT                   /db_xref="UniParc:UPI00004B43E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW5"
FT                   /transl_table=1
FT                   /translation="MPSPPLSILQSLSPRIAVLTSEDVVKSSKENGCAGLHELLRPWEG
FT                   GTERVSILSTTLTPTVHPTFPVRFVSYDTVYTNPPRSAPSPDILVDIISSVVGAKKPED
FT                   EQHYPLTRSLLLSSRPVAPYETFNHPVGVLFAVSTSTPDPLGALNKLHARTIAPSAQSL
FT                   PWLDGHTVLRFYVVVHDVSQMGDDMTPAHELLASVKRAYGPHSTLLVINSQVDRRPEPP
FT                   SPDTSTHPAIIVPRPFTPENVNPSALSQVYASALSSLTLSPMSATSPSMKDDNGELNGL
FT                   DKPRKLYGSRLTAEDTQRLAALVRELVVQSLVPWMEARIREWSEIYHNNRRGITGRLFG
FT                   AGRKFFGSRPNSPATNAVGYNASAGYYSLAAVEALSRRLADFEFMLRDYRSAANIYDSL
FT                   RRDFAQDRAWRYASAATEMYGLSLLLAHSFFSPSIPPTTTPIPFTNLQHTEITSWLEQA
FT                   VISYHQSGPSSQIQIDALRITVLYYEAWKAIREWRGVGAALVKGAGEADEVPSAVLIEE
FT                   AAVADTEGGKSGKGKRRSAFHLILAARRYETAGLKTYSRRCLDRASQIYRSTPWTAAQD
FT                   RIEYSLGRQAYTLGESDVAVEHFLRLLKKENTGVPGSQAGPLQDMALAYEQLRVHPELL
FT                   ESSKDRLQLPTPIFDVKKTRIITSFSSSFESGPSKDNWAQLEEQALRSWDRKGKKPSNL
FT                   LPDEKRNIVGTDESFIVELVATNPINAPLFLSDIALAFSPSDNITVSPVDEITLNPYET
FT                   RAICVNVTANGAMSTTSVIRLFGVSFRFHKFFPCTQSLERKGRRLHATKAHRLTPTYAS
FT                   DTSLSLSIIPERPRLDVDLVGIPDRVFVGEEVGGIIRVKNPGRKTVKDLKMIWTKGVLI
FT                   RRKNDADESSTMTISNRIENNKPSILLPEEIPAGQTKDIAIILSGFKQGQINLLGLITF
FT                   ESAGDGEIVAGIVKTCINVQPLMTFKTTITPIEASAKELALVLEVMNVSSTEVRVDGVH
FT                   GVSVLWNVKAHEVVGTLLPNQTLRSVVQIKQGATIADLSQTAVVEALAKLIEGQAPDEI
FT                   AADIQPTVSLCSELPIDTLPHYFASRNIHRISYLREQFPTISADFLPDLFPLLDPLDLD
FT                   IVLSYTICSPNSLRKGRLISHSLRPAPSFSMVESLRRDVEAAIAGGSKQTRTMYEETGR
FT                   LRRVLMASVLDGCLGREEDPVEVTVKVGEDNGPIEHDFKMGACKVPVAFTIHNRSPILP
FT                   IRFILYLPSPSPSIPSIASEPSALIPARFIGNLIFRGTLKSGETHVLNSAVWVYIAGLM
FT                   SLNGWNLIVETGEIEVDTAGWIPRKIWSKKGSEKVVEIRGL"
FT   CDS_pept        450705..451601
FT                   /codon_start=1
FT                   /gene_family="HOG000138317" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942095"
FT                   /locus_tag="CNC01630"
FT                   /product="60s ribosomal protein l7, mitochondrial, putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42201.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG175944"
FT                   /db_xref="HOGENOM:HBG737386"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniParc:UPI000042F785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW4"
FT                   /transl_table=1
FT                   /translation="MGAQSVRSFTASASRVSLKRAAPISRHASTKAAVQQDEWSLPYIH
FT                   LGPTHASRYSQHYNNSLASDVMYMTYSHRLSQRPAKPETLQPPQTPYEANRARPPIMRG
FT                   NRAVRTKTTEITPATVPKLESIIVHTMVKEAIGNKNSLLSAIAALRAISGETPNGAGRK
FT                   GSSGVQVITAKKSAAAWKLREGMPVAVKVELKGEAMYDFIQSLVDFVLPRLRDFSGVPL
FT                   PPASTPKSSPASLAGVVSFGFGPTAMSFFPQIEANTDAYPKMHGFHVFFKTNLTGENAQ
FT                   EHARTLVSGFRIPFHRR"
FT   CDS_pept        join(complement(453666..454703),complement(453472..453610),
FT                   complement(453198..453417),complement(452664..453150),
FT                   complement(452550..452614),complement(451769..452498))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805504"
FT                   /locus_tag="CNC01640"
FT                   /product="Glicosidase, putative"
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAW42662.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG051691"
FT                   /db_xref="HOGENOM:HBG329325"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00004B43EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW3"
FT                   /transl_table=1
FT                   /translation="MPIVERELFGFQLATSPSIGDSITSFSLVSSPESIYKDFTYSISF
FT                   PLPNVYRILLTGPNRTRPLQDNVVLDTSESKFKVIALDNDGCEATFDFPSPISESLDGA
FT                   EKRRRQLHLSWKEHITLTTYETLLSTGQQLRLLGDLPNRSYALTEHGVMRHWWVEIDNL
FT                   HLGLGEKAAPLDLSNRSFMNHGSDSAAYDAYQTDPLYKHTPYLISTPKPTSEGEELPST
FT                   YAIYHPTNAGGEWNVRRLHDDPWGYFKSYTQDYGGLEEWVLVGKGVEQVVRTFAEIVGR
FT                   PRLVGRDWLGYLGESHRTKYVISDADSMKASGMGLGESDDPPAQELLSTWPELCRKYDI
FT                   PCSAMHLSSGYTADKDGNRCVFTMNTKRYPDFKGMVAHFHKAGIKVVPNIKPYVLQTHP
FT                   HYKDLHSSNALFYDPYSKSPVVTRIWSSGVGDNEKGSWVDMTSEEGRQWWADGVKSLID
FT                   LGVDGMWDDNNEYYLHDDSFVCATSLPHEFTSSPSGPVTIGEIGRMINTELVNYVSHTT
FT                   LEKAHPTRRTYVLTRSGNVGTFKYANSTWSGDNYTSWHNLRGSQAIQFNAGMSLMQSYG
FT                   SDIGGFGGPLPGEEMFVRWVQLGVTHSRFCIHSFKPDQSDISGVGATNTPWMYPAVLPI
FT                   IREAIKWRYEHLPFFNSLMWESHLRATPTTTWLGFGPFASDPALYEASILEGFDAWLGT
FT                   GRILVCPALFEGQLTREVYFPKACMDDKSLYFDLHAPYRTYKAGDRVMIATPMEHMGLF
FT                   AREGAVVPVGKRYHTVTQKQGPARQTPDGVDVVLEDEGGVVGLDDWRGVKIFPGHEGNA
FT                   YRGQWTEDDGISATPDKTVVEVEYVGGKDEVTIGFKLTEHKFKTLWGRKLAVLLPVGDE
FT                   RSVKGGKEDVWEGRKVWNIEF"
FT   CDS_pept        join(complement(457324..457620),complement(456838..457271),
FT                   complement(456723..456788),complement(456607..456672),
FT                   complement(456427..456541),complement(456127..456358),
FT                   complement(455768..456067),complement(455362..455690),
FT                   complement(455173..455295))
FT                   /codon_start=1
FT                   /gene_family="HOG000138316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789009"
FT                   /locus_tag="CNC01650"
FT                   /product="Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine
FT                   amidase, putative"
FT                   /function="binding"
FT                   /protein_id="AAW42203.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG067653"
FT                   /db_xref="HOGENOM:HBG175945"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00004B43EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW1"
FT                   /transl_table=1
FT                   /translation="MFNQPSDSPFRDYQAYVHIVNYCAAALAAGIYQGIPQLSVPSPKE
FT                   VGDLNRLWREYLLTHKLEVLSSFRRRRSVVSDDMQGVIKNLQQHTYSLRDPRGDPSMQG
FT                   VSEYELRALVPDITSSIAFISSNPPFTPFGQVDAEVLALCRWFKDDYMRWVDPIKCPTC
FT                   DGPTFSAGTVPPDGTEHWEGAGRVELHVCKDKNCAAQRRFPRYGKVSTLLRTREGRCGE
FT                   WAHLFYVFLRAKGIESRYVWNSEDHVWCEYWSPALRHWVHVDPCEGAINKPLIYALGWG
FT                   KKQAFCLAFGQYGAEDVSAAYIDDFDGDCRLRRRARGWKERDLRRALFAQTVALRLKMD
FT                   LPQRSRLEVMDQLQALWISDREGRMREAEKSELIGRISGPDDWKRLRDELGLNAKIIQK
FT                   PQYTVVSNLESDNQALVTFGDAHWDGSTIVLTTGNSQTSAVFHPHPIDQSDTFSCTVTF
FT                   RLTSPPGAGEADGISIIFVPKKALGLGGYGLGYSGLGGKGDFAVEVDTYRTQDYADDPP
FT                   TPHISVHSPPDAHHRNSIGCTAPGTLPKLSNGKEHKLQILYRGEDRRVRGYLTISSEGS
FT                   VKDETDIEVFDIVVPSGNEQKPWFIGVTGSCGGLWQKQEIVDWSLQLVAFGDGQTILQK
FT                   SSGKAKAGCERNDERDNI"
FT   CDS_pept        join(complement(457324..457620),complement(456838..457271),
FT                   complement(456723..456788),complement(456607..456672),
FT                   complement(456427..456541),complement(456127..456358),
FT                   complement(455792..456067),complement(455362..455594),
FT                   complement(455173..455295))
FT                   /codon_start=1
FT                   /gene_family="HOG000138316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789009"
FT                   /locus_tag="CNC01650"
FT                   /product="Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine
FT                   amidase, putative"
FT                   /function="binding"
FT                   /protein_id="AAW42204.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG067653"
FT                   /db_xref="HOGENOM:HBG175945"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00004B43EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW1"
FT                   /transl_table=1
FT                   /translation="MFNQPSDSPFRDYQAYVHIVNYCAAALAAGIYQGIPQLSVPSPKE
FT                   VGDLNRLWREYLLTHKLEVLSSFRRRRSVVSDDMQGVIKNLQQHTYSLRDPRGDPSMQG
FT                   VSEYELRALVPDITSSIAFISSNPPFTPFGQVDAEVLALCRWFKDDYMRWVDPIKCPTC
FT                   DGPTFSAGTVPPDGTEHWEGAGRVELHVCKDKNCAAQRRFPRYGKVSTLLRTREGRCGE
FT                   WAHLFYVFLRAKGIESRYVWNSEDHVWCEYWSPALRHWVHVDPCEGAINKPLIYALGWG
FT                   KKQAFCLAFGQYGAEDVSAAYIDDFDGDCRLRRRARGWKERDLRRALFAQTVALRLKMD
FT                   LPQRSRLEVMDQLQALWISDREGRMREAEKSELIGRISGPDDWKRLRDELGLNAKIIQK
FT                   PQYTVVSNLESDNQALVTFGDAHWDGSTIVLTTGNSQTSAVFHPHPIDQSDTFSCTVTF
FT                   RLTSPPGAGEADGISIIFVPKKALGLGGYGLGYSGLGGCTAPGTLPKLSNGKEHKLQIL
FT                   YRGEDRRVRGYLTISSEGSVKDETDIEVFDIVVPSGNEQKPWFIGVTGSCGGLWQKQEI
FT                   VDWSLQLVAFGDGQTILQKSSGKAKAGCERNDERDNI"
FT   CDS_pept        join(complement(458974..459060),complement(458803..458923),
FT                   complement(458531..458745),complement(458057..458482))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789010"
FT                   /locus_tag="CNC01660"
FT                   /product="Cytokine inducing-glycoprotein, putative "
FT                   /protein_id="AAW42661.1"
FT                   /db_xref="HOGENOM:HBG175946"
FT                   /db_xref="UniParc:UPI000042DE1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKW0"
FT                   /transl_table=1
FT                   /translation="MIFNRFTFTAAMAASAASAISVQRRAAITDFDTSPVAFAFPEPRG
FT                   FSASTASEAPCGGFDPVNRTSYPLSGGDVALIQQTDATNVNILWTSESDPTLFHSFSTY
FT                   SNSILDIAAGHYCQDAPDFSSLGFAEGDNATLLVIYQLDGADTYYYQCADVSLVSATSF
FT                   TTDEQYVCGNYTSELEIASSEESLHLGNTTTSESTSSGTTGTASTSSGSTNPHVSSSSS
FT                   GSKLSAAEGGGIGASVTIFVFAVIAGLLWWSGLLRFGKKKQAVVHDHESVSSGVPTKER
FT                   L"
FT   CDS_pept        join(complement(463758..463966),complement(463662..463696),
FT                   complement(463516..463596),complement(463075..463461),
FT                   complement(462862..463006),complement(462579..462804),
FT                   complement(462367..462459),complement(462142..462308),
FT                   complement(461595..462092),complement(461412..461535))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942096"
FT                   /locus_tag="CNC01670"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42660.1"
FT                   /db_xref="HOGENOM:HBG067652"
FT                   /db_xref="HOGENOM:HBG175947"
FT                   /db_xref="UniParc:UPI00004B43ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV9"
FT                   /transl_table=1
FT                   /translation="MFSPILSPYRLPKPIFVLVCLLLILGLLFLSFASHDESRGYMIDI
FT                   FKKAGANVGVSASRLSGNAEEDAMREWEFRRALQHEGTSARVQAFLDKARSGKAFTVAS
FT                   IGGSVSKGRGLTPPKPSQLVHNTFRRSSEGDSVRPSDVPDDSPQDNIDLTEVIPSSAQS
FT                   ELEPTGSAIEENQGKNVSHPIAPLVHLGASTLYSHENLHVQIFEWLNETFPNPDNRFIN
FT                   GAQGGVGAAYFGWCFKEHIPEDADLVLLELGINDLLEFDVFSQYEHLVRGLLELENKPA
FT                   LINIETFTTLFPSLLSSSSFHNDVLSFYDVPSLSIRDVVLPRILADPQQQMRRWFRTGD
FT                   DVAMGDPKVKEWGGVPVDVMHIDRSTSYGLSALGRLTSTPKKPTVRIMDVPATTLTGLF
FT                   NPDKADMRHAPVCRSQNSGKTHGKVSSLVDDFSEGTYKGLTLAEGSHGWSEWSWKEKRY
FT                   LIAREPGSRAIFDFTISLPQEPLISDDPSAFLLDGADDITAETPSQVHKTEGEDDMPVE
FT                   QEFPRGSLAHRSAGLRKIWSSAISHQPRPTSPTLPGRRYISQPNAKQNPQAGGSILIGY
FT                   QRSAKLGLGSVWCWIDDDRDGGQRVDGWWKLDKRNMGMVKEIAVGLEPGKHTLTCEILE
FT                   DTLDPMGGTEFRLFAIMHD"
FT   CDS_pept        join(complement(466933..467385),complement(466704..466870),
FT                   complement(466311..466653),complement(466133..466258),
FT                   complement(465717..466076),complement(464941..465666),
FT                   complement(464749..464886),complement(464506..464691))
FT                   /codon_start=1
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805505"
FT                   /locus_tag="CNC01680"
FT                   /product="Dynamin protein dnm1, putative "
FT                   /EC_number="3.6.5.5"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAW42206.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG326669"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000042F405"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV8"
FT                   /transl_table=1
FT                   /translation="MSMDGDLIALVNKLQDTFNAIGGDAVDLPQIVVVGSQSSGKSSVL
FT                   ETIVGRDFLPRGSGIVTRRPLILQLIHTPPRSSPRTLENIDDGYLPNLDQTPTAGAGVM
FT                   RPGGRSMGEGTGAEYAEFLHINRRFTDFEEIRKEIEAETFRVAGQNKGVSKLPINLKIY
FT                   GPGVLNLTLVDLPGLTKVPVGDQPTDIERQIKNLVLDYISKPNAVILAVSPANVDLANS
FT                   DALKLARSVDPRGLRTLGVLTKLDLMDAGTNALDILTGRTYPLKLGFVGVVNRSQQDIN
FT                   ENLPMEDARAKEEEFFRTHPVYRNIAHRCGTKYLAKTLNHVLMNHIREKLPDMKARLNT
FT                   LMGQTQQELNAFGDATFLGEQHRGSLILKLMTEFSKDFVSSIEGTSLEISTKELSGGAR
FT                   VYYIFNEVFGHALQGIDPAHNLSLADIRTAIRNSTGPRPSLFVPEVAFDLLVKPQIKLL
FT                   EAPSLRCVELVYEELMKICHNCTSPELQRFPRLLTQLVEVVSDLLRERLGPTSDYVSSL
FT                   ISIQAAYINTNHPDFVAGSAAIARAGAPPTTQISKVQEATSEVDDEESEAESEASAPNG
FT                   YVTHPRSASASVPDIRRPTTALGGKETKSRKHIRTASGSHSGHTSGARQGANALLGAAS
FT                   AHNMAGTSPHTAKETFLNYFLGGRNGAGEDAGSVQRALGKSHVMQHHAQGQYQPQQREK
FT                   DLLPDLGGRRGGRLENSASFDMKSLGKHLEATTGDEMQLTPREEMETTLIRSLIASYFG
FT                   ITRQTIQDLVPKAIMHLLVNFSRDAIQQRLVTQLYKPELFADLLFEDEALVSERTRVKA
FT                   LLDAYKEAFKVLSEVSLKST"
FT   CDS_pept        join(complement(469588..469598),complement(468768..469539),
FT                   complement(468412..468719),complement(468111..468354))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805506"
FT                   /locus_tag="CNC01690"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42208.1"
FT                   /db_xref="HOGENOM:HBG067651"
FT                   /db_xref="HOGENOM:HBG175948"
FT                   /db_xref="UniParc:UPI00004B43EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV7"
FT                   /transl_table=1
FT                   /translation="MSAKPTVRRTYGKAPPRASSPLFDPSSPPPALSSTYRSSSPLSYR
FT                   LDSPLGSSPPRPIRTRAKSPLFLPSEDDDDMDEQDTSQPEPSIVADLLGKGKQRAKRNP
FT                   IMEKKQVQSSLKGFFTSLPKKRPLEPSMTVSAVKPKQPKVFGPSRPITIASFLKTPQPS
FT                   NAKTSGSVKAKTGSMAQMHLTHLPLLHTCPTCGMSFVRGGPDEGVHVTHHARVLRGILW
FT                   EGMKKREGEGWKVVQEDVEFGGKRRGRIIALDGSFGGNKLVEILSTVDRVLSAPPLPPA
FT                   ILNRCKVFVFLTHSPPPPPSSSKRIKLDPTDNKLGKDKDKERVVSVVVAQGIKWAMKVL
FT                   KEGEMKTEKSKTIETGGFGSVTCDPTPLPTPLGIHRLYTTPSYRSHSLSSRLLDVACEH
FT                   TVYGCTFDPKKGEVAFSQPTESGRGVMERWGGGEVRVFVDDQSQL"
FT   CDS_pept        join(469838..469900,469950..470124,470174..470498,
FT                   470557..470920,470979..471157,471215..471501,
FT                   471558..471671,471735..471760)
FT                   /codon_start=1
FT                   /gene_family="HOG000061736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805507"
FT                   /locus_tag="CNC01700"
FT                   /product="Fumarate hydratase, putative "
FT                   /function="fumarate hydratase activity"
FT                   /biological_process="fumarate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="tricarboxylic acid cycle enzyme
FT                   complex"
FT                   /protein_id="AAW42210.1"
FT                   /db_xref="GO:0004333"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006106"
FT                   /db_xref="GO:0045239"
FT                   /db_xref="HOGENOM:HBG000141"
FT                   /db_xref="HOGENOM:HBG284369"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI000042DED5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV6"
FT                   /transl_table=1
FT                   /translation="MTTPTKTSSLKTTQMLARSLRLTRTLPRVSLASRGFSSTSYIMAE
FT                   QKFRKEKDTFGDLQVPADRYWGAQTQRSLMNFDIGGPTERMPPPLIKAFGVLKKAAAAV
FT                   NQTYGLPAEVAEHIQKAADEVISGKLIDEFPLVVFQTGSGTQTNMNVNEVISNRAIEMM
FT                   GGELGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVVEINEQLLPAMKELHAALKAKQDA
FT                   FENIIKIGRTHLQDATPLTLGQEFSGYVTQVERGIGRVEATLKNLSMLAQGGTAVGTGL
FT                   NTRKGFDEKVAAEISKITGYDFVTAPNKFEALAAHDAIVEASGALNVVAVSFMKIANDI
FT                   RYLGSGPRCGLGELELPENEPGSSIMPGKVNPTQCEALTMVAAQVMGNNTTISVAGSYG
FT                   QFELNVFKPVLIKNLLQSIRLLSDGARSFTKNCVVGIKANEDRIKKIMNESLMLATCLN
FT                   STLGYDDVAAIAKKAHKEGLTLKESTLALGKLTSEQFDEKVRPELMLAPTDA"
FT   CDS_pept        join(472189..472359,472451..473398,473451..473567,
FT                   473619..473726,473819..474203,474223..474872,
FT                   475017..475211,475312..475572,475625..475884,4
FT                   75936..476104)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636330"
FT                   /locus_tag="CNC01710"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42212.1"
FT                   /db_xref="HOGENOM:HBG067650"
FT                   /db_xref="HOGENOM:HBG175949"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniParc:UPI00004B43EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV5"
FT                   /transl_table=1
FT                   /translation="MEAICPVGDQYQNNDSLSDSENSPVNNLPPPPEPFPVDLLSQNVS
FT                   SSIGSRAESDQTLIVKHLRSVQRSCIDALSALLPDHFTQNGDFDWDPTLIADSDDRLAQ
FT                   ALMELLEVTYELEDLTPSPAESVLQEERGEEVVIGDSGSLENLTSQLDKLQAARVASRP
FT                   QTPIIGTYSDASAIHPAIRIVRLEFSWARLESLSLAVVELSRQRYQQSTEDRETSPPSY
FT                   ETYHNGSHELPQYSEVNSHGSSASVSKLADSPTAKDDFTSRSSLESSRSRRPADREKML
FT                   NELEAVTSAIERLYSISPQLSNQRVEFRPLARSSTEGRHHQNNETVDLKVDERVDEGQK
FT                   MKELDEIWCQLQGAKKKRMEDQRAGVNTSQSRSKEKFIARLIEQAEKRRLPCQDSEMAA
FT                   VDGELAKARELKDRDHFLRGLIERSADRRFDNQDAAAPAEDRSAARLAKATRLSSQDFP
FT                   LTLEDKLAENRSAFVSQLVEYSSAGRLYDQDSLPPSPREDENMRVGEEKDPMEIVTVKD
FT                   FLASSRPPVPQNKADAGEPAGKREMSSSEGGGKRRVVSKIAGMVRKGSVHLGLKSTFSP
FT                   VGEHKADESDENNVTYVVEHQENLRSLQVLVHGIGISSNLELNIQTLPSSSGSTNTAVI
FT                   TSKREPSLSIDVALPVLVYSDQITPLVPQSLYQEAKLSALPTPPASNALIITHALSAPD
FT                   FRSLKATVLCCAICERHLASLPFSQDPKQAYKDLPSDHWAEMIDIWMCHDDPAFTARLA
FT                   GMTEEGFWPRDGGVLVGGSYLLVEKTSGQWEILRMGTQKEEEALQQVSPFLSSDPGERT
FT                   ECWALAILPCPGRKLFWLIQRSKNKTIHPRVDQTFDLQRIREQRLHNETWRLISCKCGE
FT                   VVGKQRIDDGKPGSGTLRFSKWAIGLLDDGNDDGEITRFPLSVFIVSDMLELAQAHASF
FT                   RFIISEEETGVQKLYLWLFNASTSVSYFKPTPTSAQTSPLRSSFTVCQASEKRSVRSRR
FT                   SSTASSIKTSNSGGNGGSAKCDGRGKTIKAVKTMYKIVDESTNIDRLPGFGPGGQIEHL
FT                   TYSREVCSRLIATLKESTLVYPAAKRSMGAFDVGFLERA"
FT   CDS_pept        join(complement(477743..478047),complement(477564..477680),
FT                   complement(476761..477502),complement(476490..476705),
FT                   complement(476296..476436))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805508"
FT                   /locus_tag="CNC01720"
FT                   /product="Expressed protein"
FT                   /function="binding"
FT                   /protein_id="AAW42214.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG067649"
FT                   /db_xref="HOGENOM:HBG175950"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00004B43F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV4"
FT                   /transl_table=1
FT                   /translation="MPRITPAAILRSAAATRQPLTSRAAIRPILSPAVPSLLATTKRYQ
FT                   STSQQPNEHPKAENKEPDPKSTEPKPEGGKEGKKGLKVSWIFSGLAGLGALVTIYGLLE
FT                   FYSTLTTWPKEVRKPLRAALKAKLRGDYGKAETFFREALEIALQMGPSALQPEPLLKIS
FT                   GIYVELANVLEIQRQRVSAFVELRTALEMFGPDPLRRPGILPLPEATTLGGGPGGQWIG
FT                   EGYRLTEKDHVRAIGLYQKLGQLALEVASSPTGSTYASTLGEGSTGQMFKTWDDAAEYY
FT                   LSSALTSMLHLGLPGSSPTPSTEGPVILGRDVSLPDALPSDNPEDVDQGGQVDKRGLGM
FT                   TMESLSEVYARKGQYDMAGQLLLQAISLLLPPQSKETPPMRDRCQAAMLMTTVSSHALH
FT                   PPTPKSLKVSRSWSLRSLQLSQQALAEAEGGSFKDTPLEAAEAVCQRARAVGLHNMGML
FT                   AEMEKDYAGAQNLFKKALAASRETGFVEGKREALAALRRVQNLAGESA"
FT   CDS_pept        join(478229..478357,478419..478476,478539..478675,
FT                   478754..478876,478944..479053,479109..479238,4
FT                   79302..479775)
FT                   /codon_start=1
FT                   /gene_family="HOG000175731" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805509"
FT                   /locus_tag="CNC01730"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="AAW42658.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="HOGENOM:HBG315460"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI00004B43F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV3"
FT                   /transl_table=1
FT                   /translation="MQYVASPQEYPDTPSQSSTSARIPSPRAFDVVTAYRRALEDDKVP
FT                   HPIAAILALVELMEASTASTVTGLASELTVGRQALINTQASLGVRAGCQLWERFFALFP
FT                   GVGEDFPAYKKSLISQGRSFCAITAPQCREKIAELAVGFLRDDCVILTHSYSRTVIQTI
FT                   LRAHKQHKRIRVYVTEARPGCLGMKTHQFLTANGIPCTVVLDSAVAYVMERVDMVLVGS
FT                   EAVVESGGLVSSVGTYQVALVAKVMQKPFYALAESYKFLRHYPLSQTDLPIPASSDRPA
FT                   IPLEFPSTIPDTQFIPGFLSRGSSLTPQSRSPQAPATPPHAVGGGGVGVDGGKKYERME
FT                   MTKEMEEINPMVDVTTPDLIDFIITDLGEPLSPTSVSQYLVAQFSS"
FT   CDS_pept        join(complement(480034..481502),complement(479933..479972))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805510"
FT                   /locus_tag="CNC01740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42216.1"
FT                   /db_xref="HOGENOM:HBG067648"
FT                   /db_xref="HOGENOM:HBG175952"
FT                   /db_xref="UniParc:UPI00004B43F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV2"
FT                   /transl_table=1
FT                   /translation="MLGGAIDEIGLIDSRDTPPPMVGEPGKKQKPDMRIELDKAKGLEP
FT                   AAEVVNKGPMTPTSLPARGASLSSTTSPPPPPPPPVQGPTEMGAGIASSFPLHQPELET
FT                   TSNNPFSSQAGPFTHSPTTLSFHSPTAHPWPSAMSMSTSALKSHKSAGARALAYARAIN
FT                   EIARAETGLKAWCAAAAAEAHRRPIHHAPSKTQAPASSSPPVGLSPHPRNVSTGSEFPM
FT                   RADSYTAREISQRVIDPADQPTALPPNLPYPQLQAQINYHHQLSPGGSSLVGGGGLKPS
FT                   QSMQSVSSFTSSKKGGGGGGGGGGGFFSAIRKGSSRKESMSMSLGPPGGYLGGSASKKD
FT                   VRGLPISAPRSASPQKPDGTTTTTSSPRSGSGSGSHTPRVQTVPSPMGPRPLGPRGPGA
FT                   RGSFTPPGRTSLDTAAPSRISVVSPPRNLRASMDSVRLVGKTSAPPPSGTATVADSGED
FT                   VKYMADVLPYVEKSVLRAYLNRYGGDQMQALGAYLEDEKNGAVR"
FT   CDS_pept        join(485206..485248,485329..485488,485547..485670,
FT                   485747..485917,485985..486148,486200..486378,4
FT                   86448..486503)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093117"
FT                   /locus_tag="CNC01750"
FT                   /product="Cdc2 cyclin-dependent kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW42218.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003589FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV1"
FT                   /transl_table=1
FT                   /translation="MSLDNYQKIEKVGEGTYGVVYKAKDINTGHIVALKKIRLEAEDEG
FT                   VPSTSIREISLLKELSKDDNIVKLLDIVHSEAKLYLVFEFLDMDLKKYMDTIGEKDGLG
FT                   PDMVKKFSYQLVKGLYYCHGHRILHRDLKPQNLLINKSGDLKIGDFGLARAFGIPLRTY
FT                   THEVVTLWYRAPEVLLGSRHYSTAIDMWSVGCIVAEMATRQPLFPGDSEIDEIFRIFRV
FT                   LGTPDEDVWPGVRGLPDYKPTFPQWHPVELADVVKGFEADGLDLIAQTLVYDPAHRISA
FT                   KRALQHPYFDTVNLSAA"
FT   CDS_pept        join(complement(487736..487805),complement(487540..487677),
FT                   complement(486707..487476))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636331"
FT                   /locus_tag="CNC01760"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA-type intron splice site
FT                   recognition and cleavage"
FT                   /cellular_component="tRNA-intron endonuclease complex "
FT                   /protein_id="AAW42220.1"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0000214"
FT                   /db_xref="GO:0000379"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG067646"
FT                   /db_xref="HOGENOM:HBG175953"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="UniParc:UPI00004B43F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKV0"
FT                   /transl_table=1
FT                   /translation="MSPPPHSIPLYLVNGVATVWDAQTAATLHCVHNVSGLRAGTLPGV
FT                   AQQNGFLGLPLTLMQEETAYLVTQGIAHLVPLDPSPSPPSDETVKAHTAARVARLKALE
FT                   EKTREAEAKRLEESKKAFDKGGEKARLKREARARAKAEKAKESGEGLFAEDVKENVTAP
FT                   IVVSPAKTKTKHAGAPAAGHFHIVPSHPVLSQHPPESQSITSLPHPLFPFPTTPRQCAL
FT                   LGVFSKLQSLSYRVGLGPRFGGEWLIYPGDYLRYHAHFTSQVIVRDEPIRPTEIVAWGR
FT                   LGTGTKKAGLICCWDDGKREDGQDDQGGKEEDVEFYSLEWANFG"
FT   CDS_pept        join(488010..488082,488214..488280,488401..488461,
FT                   488693..488795,488847..488869)
FT                   /codon_start=1
FT                   /gene_family="HOG000166937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805511"
FT                   /locus_tag="CNC01770"
FT                   /product="U6 snRNA-associated sm-like protein lsm2,
FT                   putative"
FT                   /protein_id="AAW42222.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016654"
FT                   /db_xref="UniParc:UPI00004B43F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU9"
FT                   /transl_table=1
FT                   /translation="MVSRFRSRVPIFLTHSSEIAHLLVNQVITVELKNDLSITGTLKSV
FT                   DQFLNIRLDNISVEDPERHPHMMAVKNCFIRGSVVRYVRMAARSVDTTLLEDATRREAK
FT                   EGKK"
FT   CDS_pept        join(489049..489352,489410..489562,489627..489744,
FT                   489807..489892,489951..490084,490143..490469)
FT                   /codon_start=1
FT                   /gene_family="HOG000003697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093118"
FT                   /locus_tag="CNC01780"
FT                   /product="Prenyltransferase, putative "
FT                   /function="prenyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42224.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG007607"
FT                   /db_xref="HOGENOM:HBG324383"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="UniParc:UPI000042F404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU8"
FT                   /transl_table=1
FT                   /translation="MLLLSRTRLFPRPLLSPLSRPLPLRPRVLTTSAIRRASLPPTVPR
FT                   VSTELVHPKEQQQQLPAQPPTVFDKILPQWAQGAKPYLYLTRLDKPIGSVLLYWPCAWS
FT                   ITMASTVNHLPPTTPLFYMSLFAVGALIMRGAGCTINDMWDWKMDAKVERTKTRPLAAG
FT                   DVTQFGALTFLGAQLTAGLAVLTQLNWYSIVLGASSLGLVVIYPFMKRITYFPQVVLGF
FT                   AFNWGALLGWSAVAGAVDWTIATPMYLGGAAWCVAYDIIYAHQDKKDDVIAGVKSMALR
FT                   FPDTSRQVISTLSASFVSLLTFTGYMAGLGPLYYLISCGGAAAHLAWQCLTVNFDSRSD
FT                   CWKKFSSNGWLGGLIWSGIAADYVQQVMFGVPA"
FT   CDS_pept        join(complement(491593..491622),complement(491347..491538),
FT                   complement(491163..491291),complement(490942..490989),
FT                   complement(490837..490918),complement(490755..490784),
FT                   complement(490557..490702))
FT                   /codon_start=1
FT                   /gene_family="HOG000235024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942097"
FT                   /locus_tag="CNC01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42659.1"
FT                   /db_xref="HOGENOM:HBG175954"
FT                   /db_xref="HOGENOM:HBG593785"
FT                   /db_xref="UniParc:UPI00004B43F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU7"
FT                   /transl_table=1
FT                   /translation="MLSRSHALAGVLTCATVEKITLDPQEGGSTRMRGGIPAVSSYSVL
FT                   EKALANCLKITLPAGYLGSSFIGACLVACGFDINASKVACLVLAFIWILTLWWARSSWV
FT                   AWATIALMVGLVLWDIIDASILHERRRNMDTLARKINSSDASEYAHMIGCCGSRFWGAF
FT                   WLIISCCFFAAGVLVGIAAFKDDWQTQADKASNFLGGKLDVIICSRALSNITGTP"
FT   CDS_pept        join(complement(493676..494129),complement(493462..493618),
FT                   complement(493338..493414),complement(492528..493282))
FT                   /codon_start=1
FT                   /gene_family="HOG000209038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789011"
FT                   /locus_tag="CNC01800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW42226.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG067645"
FT                   /db_xref="HOGENOM:HBG175955"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI00004B43F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU6"
FT                   /transl_table=1
FT                   /translation="MPASQPLQLLFLGTATSTGLPLTPCLTLSTPYPHRWSNMVPLLQG
FT                   RDLSDRSPSPASTTISSTYSGSTYDPEGQWPKNIPCACCRSTVDPDVPEGWKNKRGNTS
FT                   VLLRKQSAEGDWKNVLVDVGKTFREQAMRFFPTWGVKTIDAVLLTHGHADAYFGLDDLR
FT                   EWCVRQGKAIPVYLNKETFHKVEETFPYMVDKTKVSGGGDVPQLIWKIIEDEGEFQVEG
FT                   IDVKVLPVHHGIYFHSILPPTNAEPVREPPAKIEPEPLICLAFEFDDSIIYMSDVSGIP
FT                   QRTWDRMLQTSSRRQTIFPTPVDSRGGDDTPKGVPKNQSISDLANLSISPRVPGRLEQL
FT                   RTHNVPVLIIDALWPLQPHASHFSLAQALIAALRLRAANTYVIGSTHPTSHFMWEEICN
FT                   SLTHRDGRDYEVRDHPDAAQAEWLVKRVWDKVFGEGEHEGLGERWMEEGGKVKPAWDGL
FT                   VIEVGGDQGLERADLSSKGLLI"
FT   CDS_pept        join(494481..494675,494731..495003,495056..495397)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805512"
FT                   /locus_tag="CNC01810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42228.1"
FT                   /db_xref="HOGENOM:HBG067644"
FT                   /db_xref="HOGENOM:HBG175956"
FT                   /db_xref="UniParc:UPI00004B43F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU5"
FT                   /transl_table=1
FT                   /translation="MSSSIPTPSASNRPFQSQFAGDQDQPGSFYRNLFYILVGLLCAFS
FT                   LFSFLTLMRARRRRRAVIDEALRLGVMVPGVPGYVPLQDRQALMWMKSDGNQLPDWWEI
FT                   GKLKGPDDPPLLNEEGRSNGPMDQQNSVAPPTGDLHQRQTNQESSSHNSDFFQPLAIIP
FT                   PVATETSAQPIPTSKLKFFPNHLAYRPSALLPPPARFNDINSENMMEKLDQLKGNVVEV
FT                   VTVIQMPVPSWTGTSTDDGDVQVFKEWGGIELGITNLRVAAESHQVS"
FT   CDS_pept        join(complement(497632..497924),complement(497471..497580),
FT                   complement(497345..497421),complement(497167..497283),
FT                   complement(497018..497115),complement(496933..496972),
FT                   complement(496807..496885),complement(496407..496746),
FT                   complement(496107..496346),complement(495804..496041),
FT                   complement(495584..495745))
FT                   /codon_start=1
FT                   /gene_family="HOG000218692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805513"
FT                   /locus_tag="CNC01820"
FT                   /product="Acetyl/propionyl CoA carboxylase, beta subunit,
FT                   putative"
FT                   /function="ligase activity"
FT                   /protein_id="AAW42230.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG055286"
FT                   /db_xref="HOGENOM:HBG461319"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="UniParc:UPI000042FF16"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU4"
FT                   /transl_table=1
FT                   /translation="MYPRSLTLPPVRPRPFSPVFLSLARTLIPQPPPPLVSSRPLPTTF
FT                   KKVSPQSESNRLFMEGLIREIETLRAQAKEGGGQKVLDRWKAKGTGKLSVRERVSALLD
FT                   PASPFLELSPLAAHDVYPDALPGAGLVTGIGMIAGRKCMIIANDPTVKGGTYFPLTVKK
FT                   HLRAQQVALENSLPCIYLVESGGAALPYQAEVFPDHDHFGRIFYNIARMSGMGIPQISV
FT                   VHGISVAGGAYMPAMSDVVIIVKDQGRIFLAGPPLVKAATGEIVDEEALGGGDMHTSVS
FT                   GVADYLATSDSHALRLAREAIRDLCPIPIAQALPSGSTAAGTREVVPPLYPTEDLNAIV
FT                   PADPRQTYDPREIIARLVDGSEFREFKKEFGKTIITGFAEVHGYTVGIIANAGVLLSPS
FT                   AQKATHFINLCSQRRIPLVFLVNVGGYMVGEKAERGGIAKDGAKMVRAVARAKVEKYTF
FT                   VVGGSYGAGNYGMCGRAYSPRFLFMWPNARISVMGPDQLSTVMHTVQGKRAQENGKAAE
FT                   DAERKRQELRDAIEKQSMGIYSTARLWDDGIIKPSDTRDILGLALELAHDERAKRPHGA
FT                   QGTRGEIGADGDNGDWGVFRM"
FT   CDS_pept        join(498603..498660,498719..498773,498835..498929,
FT                   498996..499162,499220..499275,499329..499375,4
FT                   99434..499534)
FT                   /codon_start=1
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636332"
FT                   /locus_tag="CNC01830"
FT                   /product="RAS1, putative"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42232.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI00004B43F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU3"
FT                   /transl_table=1
FT                   /translation="MSEKGYYGGDQRLVIVGCGGVGKTAITIRFVTSQFYDQEYNPTIE
FT                   DSYRKQVVVDNEATTLEILDTAGQEEYAAMADQWYTFGSGFLLVYSLTDRSSFEEIKNF
FT                   HREILRVKDRNYVPCVIVCNKCDLQKYRSVGQLEGRELARCSIQRIDQARAEGRTTDIS
FT                   SCSKASRRPISLTTSTTATKTNKTNEGEG"
FT   CDS_pept        join(complement(502262..502678),complement(501403..502205),
FT                   complement(500421..501221),complement(500290..500299))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805514"
FT                   /locus_tag="CNC01840"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42233.1"
FT                   /db_xref="HOGENOM:HBG067643"
FT                   /db_xref="HOGENOM:HBG175957"
FT                   /db_xref="UniParc:UPI00004B43F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU2"
FT                   /transl_table=1
FT                   /translation="MPSPKVPSNDSLLLSGDSPGPRVQWRVGPPLSAGQNGQNTAQSST
FT                   SDSSLSKKKKKHEIREKIINGFDSDSEDELDVGEETKPKTNVIGEVAEEPDLDGELAAL
FT                   VEEQEVDELEDDDDDVNEQIMQKRSVSIDDDISGELLELASGPPKKKKKQAMAPPLSHR
FT                   PSAQSQRSLSKSQVTPVQITSHRVSRHVPPPSVAPRPTPSVLQHFPSTPNTTIPFIPGF
FT                   PMNTTIISTANDPYSSPLQILAQSLPSPEMQNILFGTFFSDPILTEGLSLLQPQFMDHF
FT                   NRFMERRPARLQRGDATTLALTFIILASALRILPEETSRLLLASHGGSNAPSQIPRSLA
FT                   KIISGQSVSAADITPLDQRYLDLALLSAQIAEQADTYSIMLVMFKLVSYRYWMLGHRRE
FT                   ESVLAGTCETSLPYTILDAHQGIQLPSPLSEPDLYRVPQDARELPSVPPDSPPTPCTAL
FT                   LAHTHLARRVTAMLDSFATISASNISPDMVHHYDQILDTFQDSLPPFFKVFPMTDSRYD
FT                   ASFPYLPLQRVRLHTALFSYRCGLHRAQLPAYLWPTTSATARQVVAQISLSSLRVQRSA
FT                   RMLDAKVAFRLFSPVTVFENAATLCLIMYIDKAVSADAGLSPGPPRSAEFMGMRAGVAE
FT                   ALELLDMTGAGVDAVALFSKKATVVIRGMVSHVDAPLESQM"
FT   CDS_pept        join(complement(505153..505367),complement(505031..505100),
FT                   complement(504754..504971),complement(504587..504683),
FT                   complement(504476..504526),complement(504134..504422),
FT                   complement(504013..504070),complement(503780..503960),
FT                   complement(503422..503718))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805515"
FT                   /locus_tag="CNC01850"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42234.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG330141"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042EC01"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU1"
FT                   /transl_table=1
FT                   /translation="MPSQEDPKDSIKRDEEEWHENDLEKMDQLELAAQYEPNSDAEKAL
FT                   VWKIDKRIIPTIWALYTLSYLDRANVGNAKTGGLEADLNLTSTQYSIVLLVFFISYVIF
FT                   EVPSNMMISRLRPSLYLSGLCIIWGGIAACMAAAKTYQALAGIRFVLGFIEAGFAPGVA
FT                   FYLSSWYKRYELASRFSLYYTATAVSGAFSGLLAGAITGNLDGARGLAGWQWLFIIEGC
FT                   ASSFLGFFTWFIMPDWPSTTKFLSSDERVLAVQRLAYDGLSSTAGAQGHISHWAAFKMA
FT                   ACDWRTWVFALLYMLTQGAQTIQYFVPTLIGALGWTGYLGQYRTIPLYACAFVCIIGFC
FT                   WGADYYKAKPLFIIIGGALGTIFFIIVTCVTSHMVQYVFLIFAFGCVYALPPLVLTWVP
FT                   NVLSHPAEKRGVAIALVNALGCSASIYGVFLWPSEDAPRYIPGFAATTCFMALIVIITP
FT                   IMWYLVNRYPIQGPDVDKAVREEIERQKGRGTA"
FT   CDS_pept        join(506563..506642,506701..506829,506884..507189,
FT                   507248..507334,507393..507507,507569..507733)
FT                   /codon_start=1
FT                   /gene_family="HOG000227793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805516"
FT                   /locus_tag="CNC01860"
FT                   /product="Putative uncharacterized protein "
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="AAW42246.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055949"
FT                   /db_xref="HOGENOM:HBG327581"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00004302A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKU0"
FT                   /transl_table=1
FT                   /translation="MSLANNLTLDILKKAEEGGYGIVAQTCYDANMAVALVRAAERNKS
FT                   PAILQLFPVTLAAGGGPLLQYCLDVAHNASVPISVHLDHATDPEHLELSIGLAEKGIKF
FT                   DSIMVDASHADTDEENIAIAVPYIKRCRAAGVATEVELGRLEGGEAGLREITGAMLTDP
FT                   ANAEEFMKATGADILAPSYGNLHGSYKFIGGPKYKLEILKDLQERFRGRIPYLCAHGTD
FT                   ELPDSLFQDLVKAGVSKFNINSWARDPYVETLGKELSAGTPFPDASEKAIEAFAQVCDH
FT                   MMELLGSKGKAA"
FT   CDS_pept        join(complement(509527..509822),complement(509200..509477),
FT                   complement(508945..509146),complement(508537..508886),
FT                   complement(508356..508485),complement(508041..508304),
FT                   complement(507831..507993))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805517"
FT                   /gene_name="TRM6"
FT                   /locus_tag="CNC01870"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase non-
FT                   catalytic subunit TRM6"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42248.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG175958"
FT                   /db_xref="InterPro:IPR007316"
FT                   /db_xref="UniParc:UPI000042DE1D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKT9"
FT                   /transl_table=1
FT                   /translation="MTEKQQNSQQPSQLDSTASISALPPQLQQPAAGITGAPGNAEATT
FT                   SEPPSTKRPRKAIESSEPLTEVILRRLTTIKEGDTVLLRLPSDLVKSVVVQGDNLVQLG
FT                   KYGAFPASQLIGLHYDITYEIVSSSGSGASTPQPQSLDFSTEETQSKKGNKKNKNKGKD
FT                   TAAVSKNNPGWNNILRPLKRQLVVDAVIDDIVETNEFIEDLSETEKTTLSHDEIAELRA
FT                   QGCTPEEIIQAQIARHEKFGLKTDFSKEKWRRRKEKKFYQTVQPLAPSIPNVLYHYNLR
FT                   SPQSILHLRDDTLSQLLTMANVRPGGRYLVVDDTGGLITAAVLERMGSEGSILLFNESD
FT                   SPPAWGILQTMNFSDRELEPIKWLNWLEAEEEYQKPAPPVQAEPPTNPIKAAAKQRKYA
FT                   AQVAELNNTRNELHLGGWDGLILATTLNPISVVARLTPYLLGSAPIVVYSPYYQVLAEL
FT                   LSWSKKDPNYLNDTLTESWERTYQVLPGRTHPMMTTSATGGYLWNATRVHPSQFQPESH
FT                   QRFKRRKTGKAPGKEQLSSVAKDEEAVNESLEIDPEELANEGE"
FT   CDS_pept        join(510122..510556,510603..510807,510857..511170,
FT                   511225..511377)
FT                   /codon_start=1
FT                   /gene_family="HOG000201672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805518"
FT                   /locus_tag="CNC01880"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /protein_id="AAW42250.1"
FT                   /db_xref="HOGENOM:HBG380294"
FT                   /db_xref="HOGENOM:HBG745098"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniParc:UPI00004B43FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT8"
FT                   /transl_table=1
FT                   /translation="MSIPAMAQQPYMSHSPPPLQHPKPTHIAYPPPEPPHTPAQSTDSS
FT                   PYSQAQRISQDGYLRYSSPPAGEPLASSSGFSSYAPPPTGQQPVQSRQTYGQAGTPGVQ
FT                   GVHGYGVPGYAWPGMNDATAQMGMQFGKSAVAAGQEYVEKNFTRYLPLQLIKISFSVTN
FT                   SYVLNKLRLILFPWRHKPWSRQSRRSTDNGAVEGWQAPRDDINAPDLYIPTMALVTYTL
FT                   LCALASGLQSRFHPEVLGLSLSKALAVVITEFCAIKLGCYLLDVRGSGASGVELVGYGG
FT                   YKFVGIIATIVVSLLGLGKMITLGVFIYTFAANAFFLLRSLKYVLLPDASVSSSVTTLS
FT                   HSQRSRRVQFLFFVAVAQVLWMGWLSRV"
FT   CDS_pept        join(complement(514742..515035),complement(514335..514681),
FT                   complement(514125..514270),complement(514004..514073),
FT                   complement(513827..513953),complement(513648..513780),
FT                   complement(513444..513596),complement(512835..513403),
FT                   complement(511859..512776))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805519"
FT                   /locus_tag="CNC01890"
FT                   /product="Na+/H+ exchanger AnNHA1, putative "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42253.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG067642"
FT                   /db_xref="HOGENOM:HBG175959"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI00004B43FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT7"
FT                   /transl_table=1
FT                   /translation="MTAFHPFEVTAPHLAYTFLGGFVVIFGMVSLFVKEKLYVGEAPIA
FT                   TVVGIIIGPHCLNFFNPAGWGSGTQEVANDITLEFTRVVIAISVFAVGVELPKAYMKRH
FT                   WRSLFFLLGPCMVWGWMVSALLIWGLIPDLTFLASLVVAAGVTPTDPILAQAVIGGKFA
FT                   DKHVPAHIRHLLSAESGSNDGAAFPFLYIALYLLLDASPGHAVGEWFYMTWAYEIILGI
FT                   VIGAILGFCARKFMKFAERKRLVDRQSYVAQYVSLAVLSIGVTSLLGSDDLLSAFACGC
FT                   AFAWDGFFNKATEDAVFSNVIDLLFNCAAFIYIGAIIPFNHFNDLPDLRVWRLVVLAIL
FT                   VLLVRRLPSIIVCYKFIPDIKTFREALFTGWFGPMGVGAVFISTLARSSLPEGEPEQNT
FT                   EAVDRLKDVIMPVTLFLVLSSIVTHGMSIPFFSLGRRVHSITYTRSRNLSMDTRGDEPA
FT                   WTTHARRIIPGQEIIVNRDDDEEGDLGVRRRDTLTSDSNGRITEKIEEEDSGESGESSS
FT                   SRTRQGEMIEMIEKRGSSRHGSQASQGEAAEEGERWRSSRGGSPDLANDPETQREIEEG
FT                   REEIEDKEGAGRRTPPLAKYREGNHLIVERKIRDSDEVEVEVIRNHFAENKKTESDRFN
FT                   HPHRLKSRELDDLLHHLPKSLEHATSRVQDGGKDAVDRLGLGLMGIRTPEPSPPIESHG
FT                   DSRHDHGYGLERTQSPEGLAGEGRDTEGGGDVSHGSDYEEDEANYEDVPDETPRQRRKR
FT                   MKPPAIVVSRQNSAGPPKRSIRSRLFGRRQHSSNSPSRAEEGLAPPNHSLLAPSSSRSR
FT                   PRNIAAEPESILAEDSRGVSSPSQPQNLAIPLTRTLSASRSSPAVRFADDASPSSETAP
FT                   GQSNYGSNAPGFKKNPALAMYRSASVQSTGSNKDGPSVSFKEPEIKR"
FT   CDS_pept        join(515486..516074,516131..516351)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805520"
FT                   /locus_tag="CNC01900"
FT                   /product="Structural constituent of ribosome, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42255.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG175960"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniParc:UPI000042DA61"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT6"
FT                   /transl_table=1
FT                   /translation="MSRQNLLFTTLRATFAPLAGPSTPRAFSSSQPSLVSTRKLVAKRR
FT                   KAANLALQASRVRKPDSIDPVLGRVQYKGEAPTNPWEGCRLQRVLLDYNAIAYSMPPDY
FT                   TAGEQPPYLLPGVSKEDAELLFRAVPHASTELRYASGQGSEKTEQEQARQSEMMMRILD
FT                   LRNANKNAINVLNRQRVIDEFGAGVDSGSSAVQAALLTAKIHNLLSHIEENPRDTSNKR
FT                   ALRLLVQERARHLKYWKRKQGEEAYDKLLTDLGLQREAVEGELFIGF"
FT   CDS_pept        join(complement(519240..519469),complement(519097..519199),
FT                   complement(518997..519044),complement(518902..518949),
FT                   complement(518707..518851),complement(518633..518654),
FT                   complement(518268..518581),complement(518124..518217),
FT                   complement(518020..518085),complement(517909..517929),
FT                   complement(517804..517858),complement(517659..517753),
FT                   complement(517486..517603),complement(517266..517436),
FT                   complement(516551..517222))
FT                   /codon_start=1
FT                   /gene_family="HOG000008989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805521"
FT                   /locus_tag="CNC01910"
FT                   /product="Methylcrotonoyl-Coenzyme A carboxylase 1,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="ligase activity"
FT                   /protein_id="AAW42257.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG379342"
FT                   /db_xref="HOGENOM:HBG535236"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI00004B43FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT5"
FT                   /transl_table=1
FT                   /translation="MRPIRGILINRGALAMPQYIKPHRLTRAHHMVAANRTPCGGQYST
FT                   VAQHGNLVHLFDGNTELKVGKRPFKKILIANRGEIACAIIRTARRLGIATVSVYSEADR
FT                   NCQHVAMADEAYLIGPSPSSESYLKMEKILHIAKLTGAEAIHPGYGFLSESSDFAEKVR
FT                   DAGLIFIGPSAEAIKSMGSKRESKEIMVAAGVPCVPGYHGADQSYDALLKGSQQTGYPL
FT                   IIKPTHGGGGKGMRIVRDPLTLQDELLSAQREALKSFGNDEVLLERWLEKPRHVEVQVF
FT                   GDQFGNCVALWERDCSVQRRHQKIIEEAPAPGLSPALKRDFAEKAVAAAKAINYVGAGT
FT                   VEFIMDAETGEHFFMEMNTRLQVEHPVTEMITGMDLIEWQLSIAAGNPIPYTQDKIPCI
FT                   GHAFEARIYAEKPEYNFLPDTGKLFHVRSPINTPHRLETGFQEGDEISSHYDPMIAKLV
FT                   VHGKDRPQALSLLRSALAEYQIVGPSTNIEFLKSVAEHDDFAAGSVETSFIPSHHDELF
FT                   PPRVVPQDILAQAAVFLVLRAESGQKSLAPAGPWASLVHRRFSDICTFSFRLDSEQVTV
FT                   NPVESGYHVAIAGQDLYSQLIQSCVTSSTEFSAQIGPKKIQSTIIPIFVNGLEKLHIFS
FT                   SSSHYVITHHPSPLEGIEGPQSSSSSGTGTLVSPMPATVIEVKVKKGDKVKENQVLCVL
FT                   ESMKMEINLRAERDGVVGEVRAEKGKGVEEGEILVLLEP"
FT   CDS_pept        join(521637..521822,521881..521928,521989..522040,
FT                   522091..522813,522860..522926,522983..523353,
FT                   523404..523468,523527..523589)
FT                   /codon_start=1
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805522"
FT                   /locus_tag="CNC01920"
FT                   /product="Cytosine-purine permease, putative "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42133.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123924"
FT                   /db_xref="HOGENOM:HBG396658"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI000042FF15"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT4"
FT                   /transl_table=1
FT                   /translation="MSDIEKGLQPLDAPKVSDSYEGLPTVDAGVYSGKHNAGEPTSRWA
FT                   KFDELNRKLEHKMGIESRGIERVSESDRTDTRLHGNLFIWASANTVLPTLGVGILGPLL
FT                   FGLGLGDSMLSVFFFNAATACIPAFMSTFGPKLGLRQMTSARYSWGFWGAKLVALLNCI
FT                   ACVGWSIVNTISGAQTLVAVSEYKISAAVGVVIIALVTLFIGLFGYRFVHQYERYSWLP
FT                   TFITFLVMLGVSAKHLANVPWGVGQAEAAGVLSFGGTIWGFAIGWSSLSSDFNVYMPAE
FT                   AKSWKVFAWTYTGLIFPLVLVEWLGAAIGCAALVVTDWSDAYHEHELGGLVGAVFIPSM
FT                   HNGGKFFMTLLVLSVVANNTVNVYSMGLSVSVISNWLAAIPRLVWPCVITAIYIPVAIV
FT                   GASSFATSLENFLNVLGYWLSIYATVVIEEHFIFRKGRYENYEAASTWNRSDRLPVGFA
FT                   AIAAGCCGAAGAVLGMAQAWFTGPIGKKVGGTADPSGGDIGWLLAFAFTGVTYPAFRVL
FT                   EKKWLRR"
FT   CDS_pept        join(complement(527866..528430),complement(527198..527812),
FT                   complement(527047..527133),complement(526802..526997),
FT                   complement(526419..526744),complement(526273..526361))
FT                   /codon_start=1
FT                   /gene_family="HOG000185118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942098"
FT                   /locus_tag="CNC01930"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="AAW42135.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058232"
FT                   /db_xref="HOGENOM:HBG331467"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00004B43FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT3"
FT                   /transl_table=1
FT                   /translation="MPPLPTAPPASIPTPSASVSATPPPSSFLTRTQKFLEENQRLILL
FT                   GCAVLAATGAGYYLYSRPDKSSPSTSTTSASKKNKKKKKKGGEKKDDKYLKNEGDRGPL
FT                   LEEIQPQAVKEDDSEEAIHLQGVPDQKELEGMSESARNELGATLKDRGNKLYSKKSFQK
FT                   AIECYTKAIEVSVKKVAVFYSNRAACYGNLTPPDYEKCVADCNEAIKLDRTYTKALKRR
FT                   ATAFENLNRNEEAVRDFTAVTIIERFQDDQASAAVERCLKKLASSRAAEILSKREANLP
FT                   SPTFISAYLAAFRPHPKPALPENPSQGDLTLSLAFDALEAADYPHALTYAAESIEQGIS
FT                   SKKGEAEAYNLRGTFKFLMGNAEGARDDLQKSLDIDSGFVQSWVKIASVHMELGDPATA
FT                   FGDFEAAIRHDADNPDIYYHRGQVYFITQEFDKALADYTKSVQLDSSFIFPHIQTAVCQ
FT                   YKMGNVGSSMASFRRILREFPDRGEASNYYGEILLDQQKFSESLDRFDKSIELDKERKP
FT                   RNVLPFVNKALALFQWKQDIAGAEALCKEALEIDPDCDVAVATLAQLSLQQGKIDEAIK
FT                   WFEKSAQLARTEGELINAITYEHASKAQVHFLKTYPEFAERLSQIAQAA"
FT   CDS_pept        join(533675..533807,533929..533981,534034..534450,
FT                   534519..534714,534765..534906,534958..535454,
FT                   535503..535560,535609..535912)
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636333"
FT                   /locus_tag="CNC01940"
FT                   /product="Monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42137.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B43FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT2"
FT                   /transl_table=1
FT                   /translation="MSSSEKGPVVGPGKIVTYGRLHGNALLYAIVGTATTGFSLFGYVR
FT                   LMSGIIASDQFNTEFPATFQHDVNDVHAGTVQGSVTSCYEVGCFLGALFAYFFGERMGR
FT                   RRVMLMGAVIMIIGTIISVCAFGPGDPRGNVGGFVQFIVGRVITGVGNGANTATIPSWV
FT                   AESSKAHNRGFLICMEASTVAVGTVIAYWIDFGLSFVNSSVSWRFPIALQILFALVLIG
FT                   GVMVLPESPRWLIAHGYDHEGLRVIAALDSKAEDDPVAIADKNKVSDAIAAQQNAKASR
FT                   KRDILKGGKNQHLRRAMVGASTQLFQQIGGCNAVIYYSTVLFENQIGLDSTLALILGGV
FT                   LSIVYAIFALTSFFLVERVGRRKLFLIGTFGQAAAMFITFGCLLPGDAQSAKGGAFGLY
FT                   LFIAFFGATWLPLPWLYPAELNSMAVRTQANAISTMVNWLFNFTVVQVLPTMTASIGAY
FT                   TFLFFACINCVFLPFIYLFYPETTGRTLEELDVIFAHAHLTERRPTLVAAELPKLTDFQ
FT                   VQEMTDRYDIHGGAADTENPSAYGAPINAGAPDTSLPPKHPQDDPNYYPDGSRRPSGGT
FT                   AESGEQTRVTTPSGEKAGATPPS"
FT   CDS_pept        join(complement(540336..540401),complement(540020..540265),
FT                   complement(539849..539923),complement(539543..539795),
FT                   complement(539416..539477))
FT                   /codon_start=1
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805523"
FT                   /locus_tag="CNC01950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42139.1"
FT                   /db_xref="HOGENOM:HBG301781"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI00004B43FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT1"
FT                   /transl_table=1
FT                   /translation="MSQPSKAVLFVFTSAEKLLNGAPTGWYLPEAAHPYYVLSPHYRIE
FT                   AISTKGGPVPVDETSVKNFQDEDSQKFLKDPEAQNLVKNTKKVEDVKAADYEAMFVIGG
FT                   HGPLIDLAKSEKFAKLVEDFYVAKKPVSAVCHGPGAFILATNPATRRSIFAGARVTGFS
FT                   NSEEAQTPYNDFVNILPFSLEDKIKELGGQYEKADQDWGVKVIWDQGVLTGQNPASAGP
FT                   LAVKLKEILEA"
FT   CDS_pept        join(542643..542705,542763..542904,542971..543145,
FT                   543203..543323,543383..543471,543517..543711,
FT                   543765..544008,544084..544635)
FT                   /codon_start=1
FT                   /gene_family="HOG000225685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805524"
FT                   /locus_tag="CNC01960"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW42141.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG461643"
FT                   /db_xref="HOGENOM:HBG746084"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniParc:UPI00004B4400"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKT0"
FT                   /transl_table=1
FT                   /translation="MKLDATDLRYISADEFRVLTAVEMGSKNHEVVPSQLAAELSQIRG
FT                   GNVKKALGDLAKRNLVARVQNVKYDGFRLTYGGLDYLALRTFSRRKPPSVHSVGTRIGV
FT                   GKESDIYVVADEHGEKRVLKMHRLGRISFRAIKSKRDYLGKRKSASWMYMSRLSAQKEF
FT                   AFMKALYQHGFPVPVPIDQARHCVVMSLVDGYPLRSVEAVEDPADLYSKLMELIVRLAH
FT                   AGLIHGDFNEFNIMLLRKTGEPIVIDFPQMVSTRHENAEYFFNRDVNCIRRFFRRRFRY
FT                   EATSWPTWKNVLEIEAGNAENAVQEEVSDGLTDLAMVQNRVRIDLEVEASGFGRALQRE
FT                   LEDYMIEVQDIPASESEEEEEEEEDEDKKEEEEAEALSSHVQGNDEEELSDEAAVAAHL
FT                   EALRLHRALGNDVSDEDAGPYSEHSLTDFASDDDSDDSDDSTGVAQTDFTTYTPSMRNQ
FT                   PRHHTRLPVKEFEKKGGARSAIAKQVERERHQTERKANAGKTSVKLGKQKGHKWKSSDK
FT                   YVVGKDSGW"
FT   CDS_pept        join(545424..545531,545591..546484,546545..546746,
FT                   546803..547054,547105..547323,547372..547504,
FT                   547558..547619,547668..547819,547870..547973,
FT                   548028..548094,548153..548308)
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636334"
FT                   /locus_tag="CNC01970"
FT                   /product="ATP-dependent peptidase, putative "
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42143.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI000042CB35"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS9"
FT                   /transl_table=1
FT                   /translation="MLSRSVQVAGLDLFVSSRAASLRCQKYCARSPSNLKEMRIPRKTS
FT                   QMVSRPCISFRGLHSSTSWNGIFSSRSTTAKPSETQTDVDQPLTPFQARVAELEIKAHA
FT                   NKEDPDAQLEFLRQLSEGGEFAGLVAYYEGMALAEDTSGSQALLRNDEAWAIFMDALAR
FT                   SGRLGDIVTKVRRRDQLLASIGANGGSSSSAPLVSNPTPSSVSANNSSTSTPSVSSPGP
FT                   SLTSSLLSRAVSPTSLANASNASTSQSHPGAGSPLNPIYVQMAPPTPQMNAWRALRWVA
FT                   GFLLWGFIILTVMSMVIENTGLLKAGPGPVEFEPEEGKIVKFSDVHGVEEAKAELEEIV
FT                   EFLKNPEKFSALGGKLPKGVLLTGPPGTGKTMLARAVAGEAEVPFLFASGSSFDEMFVG
FT                   VGAKRVRELFAAARKKAPAIIFIDELDAIGSKRSAKDQHYMKQTLNQLLVELDGFEQAE
FT                   GVIIIAATNFPESLDKALTRPGRFDRHVVVGLPDVRGRIEILKHHMSEVQYDVDVDPSV
FT                   IARGCPGMSGADLQNLVNQAAVKASRDGSNSVQLKHFEWAKDRILMGAERKSHYVTEES
FT                   KRATAYHEGGHALVALHTPGAMPLHKVTIMPRGQALGITFQLPEQDKDSYTRREFNAMI
FT                   DVALGGRAAEEMIFGHDNVTSGCSSDLQRATDVATRMIRNYGFSDKVGLVAHGDEESVY
FT                   LSSKKKDEIESEIRSFLDQSMTRTENLLKTHENELHRLADALIEYETLSLDEVKQVLEG
FT                   KRLSRPTTEGESLKGQGEKSGKGPIVDGI"
FT   CDS_pept        join(complement(549523..549556),complement(549156..549234),
FT                   complement(548995..549082),complement(548753..548767))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636335"
FT                   /locus_tag="CNC01980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42145.1"
FT                   /db_xref="HOGENOM:HBG175961"
FT                   /db_xref="UniParc:UPI00004B4401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS8"
FT                   /transl_table=1
FT                   /translation="MSNSPVDPPAPEEPNTLAKVLWKWGFLCPLLWFIGMTIMWIPLKS
FT                   TEEEHGPEKAQKLEEMIVILRKGLGV"
FT   CDS_pept        join(550407..550656,550713..550716,550774..550879,
FT                   550940..550961,551076..551095,551143..551190,
FT                   551242..551315,551389..551425,551483..551567,
FT                   551627..551704,551772..551965,552025..552089,
FT                   552148..552223,552275..552389,552440..552516,
FT                   552568..552636,552709..552744,552803..552883,5
FT                   52940..553107)
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581867"
FT                   /locus_tag="CNC01990"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42147.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG326782"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4403"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS7"
FT                   /transl_table=1
FT                   /translation="MEKSSSGYGAAPVALSYEQQLKETGQSEFHESVGEAQAPSSMALK
FT                   VAGLHDDGLAPGTEARKRIEKRLKLKLDLRFSILIVIYILNYIDRNNAAAARLKGFEED
FT                   LNLTGQRFPTILSILYVGYILFQVPSNMLLNHIGRPSIYLPIAMLIWGMISVLTGVCHN
FT                   YVGVLLTRLFLGVVEAAFLPGALFILSKWYRKDEISLRYTLLYCGNLISNAFGSLIAAG
FT                   VLANMDGKLGHAAWRWLFYIEGALTMFFALIAMIMLPDFPHNSKRGFTEEELKVAQLRM
FT                   LEDVGEIDQDSKDEKWHTGFIMAITDWKIYILMGSLTTCVTGLSFNIYFPTLTKTLGYG
FT                   TTETLLLAAPPWIFSCLLALANSTHSDRTNEKFWHSTWPLLMGIVGFIISIAVPPEKKA
FT                   GRYVALFLQAGSYAGYIIMYTWMSSSFPRPPAKRAVALAFMNAMSQVGNIVGSYIWPTK
FT                   FGPSYAKSYGIVLSMFGATILLNMWFRIILMRANKRLEEGERAFDEHGDTLERAAALES
FT                   TTVQDAMRMQRGFRYLV"
FT   CDS_pept        join(550407..550660,550774..550879,550940..550961,
FT                   551076..551095,551143..551190,551242..551315,
FT                   551389..551425,551483..551567,551627..551704,
FT                   551772..551965,552025..552089,552148..552223,
FT                   552275..552389,552440..552516,552568..552636,
FT                   552709..552744,552803..552883,552940..553107)
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581867"
FT                   /locus_tag="CNC01990"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42148.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG326782"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS7"
FT                   /transl_table=1
FT                   /translation="MEKSSSGYGAAPVALSYEQQLKETGQSEFHESVGEAQAPSSMALK
FT                   VAGLHDDGLAPGTEARKRIEKRLKLKLDLRFSILIVIYSANYIDRNNAAAARLKGFEED
FT                   LNLTGQRFPTILSILYVGYILFQVPSNMLLNHIGRPSIYLPIAMLIWGMISVLTGVCHN
FT                   YVGVLLTRLFLGVVEAAFLPGALFILSKWYRKDEISLRYTLLYCGNLISNAFGSLIAAG
FT                   VLANMDGKLGHAAWRWLFYIEGALTMFFALIAMIMLPDFPHNSKRGFTEEELKVAQLRM
FT                   LEDVGEIDQDSKDEKWHTGFIMAITDWKIYILMGSLTTCVTGLSFNIYFPTLTKTLGYG
FT                   TTETLLLAAPPWIFSCLLALANSTHSDRTNEKFWHSTWPLLMGIVGFIISIAVPPEKKA
FT                   GRYVALFLQAGSYAGYIIMYTWMSSSFPRPPAKRAVALAFMNAMSQVGNIVGSYIWPTK
FT                   FGPSYAKSYGIVLSMFGATILLNMWFRIILMRANKRLEEGERAFDEHGDTLERAAALES
FT                   TTVQDAMRMQRGFRYLV"
FT   CDS_pept        join(complement(558965..559081),complement(558830..558917),
FT                   complement(558706..558781),complement(558578..558658),
FT                   complement(558342..558511),complement(558233..558291),
FT                   complement(558072..558189),complement(557858..558022),
FT                   complement(557735..557802),complement(557536..557687),
FT                   complement(557289..557481))
FT                   /codon_start=1
FT                   /gene_family="HOG000166793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805526"
FT                   /locus_tag="CNC02000"
FT                   /product="NEDD8 activating enzyme, putative "
FT                   /function="ATP binding"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein neddylation"
FT                   /protein_id="AAW42150.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="GO:0045116"
FT                   /db_xref="HOGENOM:HBG028577"
FT                   /db_xref="HOGENOM:HBG521753"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR014929"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI000042F34B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS5"
FT                   /transl_table=1
FT                   /translation="MTAAHIQSYHSDPTRYAAVDNLLHRKGPWTDERFQGGTETANFLR
FT                   TKAKILVIGAGGLGCEILQNLALSGFNDIHVIDMDTIDISNLNRQFLFREADVGKSKAL
FT                   VAAEFVMKRVPGCTVTPYHGRIQDHPTSFYSTFDVIVAGLDSISARRWINATLVQMAQE
FT                   DEENIKPLVDGGTEGFKGQARVILPTITSCYECSIDMLTPPTAFPICTIANTPRLPEHC
FT                   IEWASVLEWPKVFRDKKLDTDDPEHIEWLYKQAAARAGQFNIEGVTWALTQGVVKNIIP
FT                   AIASTNAIIAASCCNEAFKIATASAPYLNNYMMYVGNESVYTYTFEHEQRPDCPVCGGE
FT                   SLVAEVKRDWTLQQLIESLSQRQDLQVSRPSLSFSSGKALFWPSPPDVYEATKANLELL
FT                   LSDLVQDNDAIVLVDPALPVSASVTVKFV"
FT   CDS_pept        join(559349..559512,559573..559692,559745..559847,
FT                   559897..560034,560087..560166,560215..560455)
FT                   /codon_start=1
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805527"
FT                   /locus_tag="CNC02010"
FT                   /product="Exosome complex exonuclease rrp45, putative "
FT                   /EC_number="3.1.13.-"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAW42153.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000042C6DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS4"
FT                   /transl_table=1
FT                   /translation="MVREIDPPSVQNEFLLAALAEGKRLDGRLPLQMRDVHYIFGDELG
FT                   CVECRLGKTAILAQVSATIVKPRDDRPYEGFLLINSEIGPMASSVYENGRPGDDEVMIG
FT                   RLLEKSIRRTEAIDREALCILAGEKVWQLRLTLHFLSDSGNLLDCAALAGMAALKHFRK
FT                   PDVEVIGDEVIIHSPEERAPVPLAIHHTPLCLTFAYFENLPPILDPSHVEMMLCSGTLT
FT                   LTLNAQREICVLSKAGGAPLGAEEIMGVVKVGVDKVRELVRHLEEELEKDRTSRVVEVR
FT                   "
FT   CDS_pept        join(562179..563501,563552..565455,565505..565781,
FT                   565830..566333)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942099"
FT                   /locus_tag="CNC02020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42155.1"
FT                   /db_xref="HOGENOM:HBG067639"
FT                   /db_xref="HOGENOM:HBG175963"
FT                   /db_xref="UniParc:UPI00004B4404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS3"
FT                   /transl_table=1
FT                   /translation="MRGERPRRPSDVFSEGSRSATSSVFPFKTSPTNSTFTGRSANTLT
FT                   NTDSASPSRLPSSPRSHNLRAVVNEDIPPVPESTLTPTRLQPVKANSILSNASAASTPT
FT                   PSLVLHNPAYVPGQPRPIRPTHHGEGSLSSRAATPNGQPHFDILLNSRSVTPDSQSPPN
FT                   TLRSSAAYSDATQSTNTSPSPLLHYPISLAKATSLSRSYSVNQASLPIGGDSDQSSVTR
FT                   RRAGTITLGETESGRGLNFSSEAHPFLQREIVEEEEYEHEEEQKTRSREHLKEEENDAG
FT                   STLELKEAINRHSLGASWYDPKTSIDEEESFQNGHKSQARDVVETAIFSLDALRTDDET
FT                   AEGAGFFSPIPLQRLSCDSLDSVFDPKQDVPQWIDIFDGNDFVRVDSETDDISDWPEKP
FT                   ELLLEKITGLGVEELMLLQEELVTKARREREAMGLGFSPLISDTPTIPKQYCSLKQQSP
FT                   RLNVEGPPAVDARTTNPMTMNGIIPVTSAMESSSSMASQIADTIPCAPQRPVLDMPPQP
FT                   LPAPPTQEVPNAESFSSATRMRGNVIDNTTESLETEKEKDFRTRIAAATAALNRNPSIQ
FT                   GARLERKNTKRGAAMVISSPKLLSSTAKVPTHPLTPPDHPSAVDSILEKSLEKMSGSGS
FT                   KMSQKWKKLMKKGPSVSSSEAFKPVHPMSAANSGSTDPNSIPQPAPVARLQRSNSQSVS
FT                   RTLGAPIQLRQEANTAISLSSAPPDLKSFQFPRRIDQREGSNADQKTCPAMTISQVPTR
FT                   VITPPNTTVHGDAPLDQLSERTQSPTQDTAILNFLQAGRQLGLKEDQLKAILVQKEMLN
FT                   DSDTIASKDSALPNSEPVLKISPSSSARQRSPTPIWQAEKAIAKQKKEGLFRSLSKKAR
FT                   ELPIRMRTPEPPQKEVVTPVSVSRPLHDKVVLRRTMIFPDGLTPSAFQMSSDVTPGSPS
FT                   SSNVGRQPSQRKLSIRRKPLNLSKEDRELVSNSPPAHQTGFGSNASPSQKHENIAHEDQ
FT                   NFGFVYRNPAHRADDSTKRRSLASMTLSRRSLSGMSERSSTAGSLIDMYGDDRNGGEEM
FT                   LLKSPPLDRDSRIIETIQNGPAQAVEICEYADGQVVWSVVDALRTSVAASVDENDGPFG
FT                   HRLSQSSSNYSANKVSVFGEKHDYFTETESMSRPSGANIAPLNVRHIANRKSIIKPRPP
FT                   TDVYFTSSHDVADLIDHLSRDLEASRGRIDIISSHDSSVDTDRPFHHTPFNIEQHRTPG
FT                   SPSSNSQFEDAPSPAPPPRRIPFSQRIHPRSPRSYHPASEINIEEETSLKHHVGHQIGR
FT                   SSNTNSFTNCETHDPSSRHFANSSHVQGKSLEYRLQELMDRMRNAKPDGRR"
FT   CDS_pept        join(complement(568558..568909),complement(568302..568488),
FT                   complement(568122..568221),complement(567771..568070),
FT                   complement(567356..567715))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789012"
FT                   /locus_tag="CNC02030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42157.1"
FT                   /db_xref="HOGENOM:HBG067638"
FT                   /db_xref="HOGENOM:HBG175964"
FT                   /db_xref="UniParc:UPI00004B4405"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS2"
FT                   /transl_table=1
FT                   /translation="MFPHRHPHTIHWIVVSLVLFLSSLTSSQSTATVTSSSGVSSVTQS
FT                   SWTESSLKEDTQTTARIAAVNDTTFGTAGGTAPQSDTTATTTTHNLVTATTPIPLAATL
FT                   GLIMPNPWQTLYTELNYTFGFVDAVPRPAPTYGGWMREVVPLIIMSNYTVDVLPSSGSE
FT                   DPTSVEAIPVGSTGLCGTTAENFPIGYPFRFTTPGWYMFVVNQTYMQANITENNQCSWP
FT                   ILQQKSFFATQIFSLAAYPTVSPGPASPTSAYTVWADVSTTTPGSLPIDAEPTTEGQKL
FT                   GLALGIAGGVLGLAIIASIIWWVRKKRNLEAECLAFSRLPSQEQEAFLREHAKNLRPFL
FT                   NTRQPQYPDRNGLYRYQAPPSAPPGTMAYALWYSRQLWNNQVMQRQNPSIWNNKYGFEP
FT                   RMGNAVALGPESNMLNPVHIPYAQQHAQVYGPH"
FT   CDS_pept        join(569386..569589,569640..569750,569810..569890,
FT                   569943..570838,570888..571239)
FT                   /codon_start=1
FT                   /gene_family="HOG000226717" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805528"
FT                   /locus_tag="CNC02040"
FT                   /product="DNAj protein, putative"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42159.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00004B4407"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKS0"
FT                   /transl_table=1
FT                   /translation="MPPRITSRALSTLSTAQSSAGSSSTLPPSTFSLRQHKRSPSSHSF
FT                   TFRHFGPLLAHPRNPSTASLGWRRSFHSSTVHPASAKDPYNVLGVNKDASSSDIKKAYY
FT                   SLAKKWHPDSSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFAHGA
FT                   GGFGGFQGFGPGFGDGASDLFESLFGGAFGGGSSAFGGRQRPVRGDDLEVGVNLSFLEA
FT                   CNGVTRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMASTCQTCG
FT                   GTGSTIPKNARCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDKPLSASGPAGD
FT                   LLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKNGTQNGEE
FT                   AVLKGRGVKSVYGGRRNDRGDLIVGWKVQIPRSLTPFQRKILQAYADDIEGRNPQVHFG
FT                   PLPSDPPVTNPSSPPKEPTNGEGSYPSYRSQNQPQAEHAPHRPSRPPAEPYKPYNPLSS
FT                   SEEPISLANKIASAIGGAIGWVERFMRGRR"
FT   CDS_pept        join(complement(576035..576335),complement(575800..575979),
FT                   complement(575617..575746),complement(575506..575560),
FT                   complement(575382..575441),complement(573958..575316))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942100"
FT                   /locus_tag="CNC02050"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42665.1"
FT                   /db_xref="HOGENOM:HBG067636"
FT                   /db_xref="HOGENOM:HBG175965"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniParc:UPI00004B4408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR9"
FT                   /transl_table=1
FT                   /translation="MRHRFYLPTIVRDQTFLSFVRQRHHSHHHPYLTPSLPSLTPKHEP
FT                   DLSSDAPPGSSSAASEKDITSVLSLLREDYVAVKEHIKVMDYKQVLKRAAQRHMYKWYA
FT                   ILIIAGTLTALITAKHDAVVDFCRPITEKIRSWPAGWLVPIAILVIVSFPPLVGHEIIG
FT                   ILCGLVWGLWVGFAILAAGTFVGEIATWVAFKWCCQTRAAKFEKKNRLYAALTQLIREK
FT                   SFMFVLILRFSAVPGHITTAVSASAGANFWSYLLAAFLTLPKQWTIVYLGKAFGTTNRT
FT                   NTIISVLTTVLTILATAVAAVYIYYQMRLVMRRWTLALPAHVESSSTSNITLSEWADEK
FT                   GQDGLYTRRRWMASNGSDEYVNRCEGRTLTRSWSMPEHMSEEELKEWVKSLENEEYASS
FT                   ASAQLSAETGDDSASESAANIKINIQMELGSLLPTSWPPVTPRFPEPSNNVMKSPGLGI
FT                   PQSVSRDSNCSSPSPPLLELDNAYTPTLASRRPSYSRRIPSSSSISFDVPCTIPGTTCP
FT                   HRVGGREVADEADAYAIAHGARRPEFRRMRGDSRAALLGRPVDDAALHQCGSSWRREYS
FT                   HSYGRSRGSSNATLSRSDIDELGRARGDSVSTAGTGYSYGPPTLADLGVVRGEGGYVRM
FT                   DQPQRGKGESSAAVLGGLIDEGLRTEISRDRNDMESYQREGSTILKGNEGKNQLGDENV
FT                   "
FT   CDS_pept        join(complement(579030..579335),complement(578825..578942),
FT                   complement(578684..578758),complement(578490..578628),
FT                   complement(578300..578441),complement(578151..578243),
FT                   complement(577985..578093),complement(577858..577933),
FT                   complement(577717..577800),complement(577577..577666),
FT                   complement(577370..577521),complement(576723..577318))
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805529"
FT                   /locus_tag="CNC02060"
FT                   /product="Histone deacetylase 1-1 (Hd1), putative "
FT                   /protein_id="AAW42664.1"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="HOGENOM:HBG460465"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI00004B4409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR8"
FT                   /transl_table=1
FT                   /translation="MSSAAIHPPLDFSPVRPDGRRVAYYYDHDVGNYHFGLGHPMKPHR
FT                   IRMTHNLVVNYGLADDYEAMEEEGRRKVNARMGMENDEARWVNAEMRGSRAKRMQIFRP
FT                   RRATKTDMTRFHTDEYIELLESVLPENADALTGNRSRGLTGSDCPAVEGIFEFSSISAG
FT                   GSIGAAEKLNEGIADIAINWAGGLHHAKKTEASGFCYVNDIVLGILELLRVNSRVLYID
FT                   IDVHHGDGVEEAFYSTDRVMTCSFHLFGNFFPGTGTLKDVGLGKGKGYAVNVPLREGIT
FT                   DEGFHSIFKPVIAEIMEHYRPCVVVLQGGADSMSGDKLGRLNLSDKGHAECAKFLRTFS
FT                   VPLMLLGGGGYTTKNVARAWTRETAIACGQELSEDLPSNQYMEYYGPRYKLEVLPSNVE
FT                   DFNTPEYLEDLKRQISNHLKNLPFAPSAQMRQITGSNVSQAVGLSNEWETDDPEDQIDQ
FT                   RLKKLFASKNLNGTYTQESDALLSDLTSISRIRRQGGPKKLPRSSGTCGRARKRYLEDI
FT                   AMGEDPCCLLPAMTSKKNERKTIAKSGSSAPPTSAPEWHAHLTVHEMKSRPSLGEILQQ
FT                   PSPGSEDECDRNRCITEGSQLHMIAQGRGKRSFFSRKGLPPSIISPQAIIGGSTVKVDR
FT                   LIRARMAAATNNSPVVVEWDRQQE"
FT   CDS_pept        join(complement(583395..583631),complement(583156..583323),
FT                   complement(583031..583110),complement(582494..582977),
FT                   complement(582310..582439),complement(582196..582264),
FT                   complement(581944..582146),complement(581748..581894),
FT                   complement(581561..581694),complement(581389..581504),
FT                   complement(581089..581337),complement(580740..581043),
FT                   complement(580518..580691),complement(580078..580462),
FT                   complement(579939..580018),complement(579872..579887))
FT                   /codon_start=1
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942101"
FT                   /locus_tag="CNC02070"
FT                   /product="Importin-alpha export receptor, putative "
FT                   /function="importin-alpha export receptor activity "
FT                   /function="receptor activity"
FT                   /biological_process="cell proliferation"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42163.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008262"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG022680"
FT                   /db_xref="HOGENOM:HBG327833"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00004B440A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR7"
FT                   /transl_table=1
FT                   /translation="MQATPETLSLLTNYLSSTVSPDAHTRRSAEESLRQAEGQQGFLLL
FT                   VLELVKADSVNMIVRQAGGVYFKNTVKRLWSGDEETQIDPADKAAIKSQLVPMMIALGT
FT                   PQTSRLQSQIGEGLSHIASLDFPGEWEGLCDELVNSLTPDNFVINNGVLATAHSIFKRW
FT                   RSQFRTNELYSEINFVLSRFCEPYYRLFQHVDQLLQTPPASLPTNSSILLLGQSLLLLI
FT                   QLFHDLSSQDLPPFFEDHMTEFMGGDQPGWLRKYLDWEVKELKGDDDDEAPGPLQKIRS
FT                   SICEIAELYAQKYSDVFTQLGSFVDGVWNMLTRVGTSTREDVLVSRALRFLSVVVKMGN
FT                   HRAMFAASETLNAFCEKIILPNMAIREHEEEMFEDDPMEYIRRDLEPSTESDTRRQAAT
FT                   DFTRALMELFEKEVTGIIKGYISVFLQEYNKNPVGNWKSKDTAIYLLTSIASRGSTQQL
FT                   GVTSTNVLVDVVDFFGQNVFSDLQAAPGSVHPILTVDAIKFLYTFRNQLTKDQLVSVLP
FT                   LLVQHLASDNYVISSYAAITIERILFIKVERQALFTQADIRPFAENILMALFANIEKGG
FT                   TPEKIAENDYLMKCVMRVIITARTSLTPSHEGILTRLVNIMGEISKNPSNPKFNQYCFE
FT                   SVSALIRFVCEGTPAALPTFENALFGPAQHILTNDVAEFIPYIFQILAQLLELHSPSEL
FT                   PPAYQALTGPLLSAALWEQRGNIPALVRIWKALLLRGAPSIVAAGQVQGLLGIFQRLAG
FT                   SKVNDVWAFELVQALYEFVPIEVMRPFSQTVFVLLLNRLQGKPSTQFNHCFVYFFAFLA
FT                   NLDSVGADFLVGVLEGIQTGLFGNLLTGVILSNSQKITARNRKLVEVGLTKTLSRSDSL
FT                   LVEPNRQFWPPIFLALLDMFTLPQDITYANPEGSGDITELDPEEAGFQSSFSKLGASEK
FT                   TVSDPTAGVEDSKVFAAKELAKRSNEKPGMLGPLIEAAQKEEQVTVTNFVQFMATSGNT
FT                   IS"
FT   CDS_pept        join(585021..585142,585217..585305,585363..585473,
FT                   585529..585690,585742..585901,585955..586077,5
FT                   86132..586429)
FT                   /codon_start=1
FT                   /gene_family="HOG000138315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805530"
FT                   /locus_tag="CNC02080"
FT                   /product="Expressed protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42165.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG067635"
FT                   /db_xref="HOGENOM:HBG175966"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI00004B440B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR6"
FT                   /transl_table=1
FT                   /translation="MIRVNSPLQGLIAFSLLSTSVFARSDRICPEDPYASPSTDTCNPM
FT                   RYIPNKGINIAAAVLYFIVAAILTFHSFRQKANYFLALVIGAWCEGIGLVLRVAFRTNP
FT                   HSTGLYIVCYLFVVLSPCAFLAGDYILLGRLVQYLDAHHYLRPLRAQLVSWIFIVSDVI
FT                   TFLIQAAGGGLSTATDVQTAQNGGHIFLAGIAAQMASFIFFTIAWLIFGIRAWREDKEL
FT                   WRRPGWKPLFFALGFTCICFLIRSFYRTVELSQGYVGYLAIHERYFLGLDCLPLLLGIA
FT                   TYVFFWPGKYLRFAPKPKKSKESKESKKSKKSKKSKKSKNGVAEDVEEGLPMHDLNGEG
FT                   LGDMVKGDENYQMR"
FT   CDS_pept        join(588276..588394,588444..588532,588587..588735,
FT                   588797..588920,588970..589129,589190..589577)
FT                   /codon_start=1
FT                   /gene_family="HOG000138315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942102"
FT                   /locus_tag="CNC02100"
FT                   /product="Integral to membrane protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42168.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG067635"
FT                   /db_xref="HOGENOM:HBG175966"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000042FF13"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR5"
FT                   /transl_table=1
FT                   /translation="MRRSTLFEVLILSSLVSSAYALGGDRDCPADPYADPANDTCNPLR
FT                   YIPNMALNCLGAALFLIVAAILTFYSFRRKANYFLCLVIGAWFEGIGFVLRVLMRDNLH
FT                   NLNLYIVANLFIVLAPCAFLAGDYILFGRLVQFLEAHHHIRPFKARQVSWIFISSDILT
FT                   FLIQGSGGGLSASSSIDSAELGAHLFLAGIVIQMVSFIFFSCVWVLFGIRVFTGDKQLW
FT                   HREGWKPLYFALGFTCICFIVRSIYRTAELSGGYISYLSTHEGYFLGLDSLPLLLGIAT
FT                   YIFFWPGNYLQFDGNPFKKSKTRRIEEGAQMYPLKAGDSYETQPGLDAKMTPTYTNHYE
FT                   RR"
FT   CDS_pept        join(complement(591670..591748),complement(591571..591606),
FT                   complement(591329..591502),complement(590916..591245),
FT                   complement(590030..590879),complement(589936..589978))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805531"
FT                   /locus_tag="CNC02110"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42170.1"
FT                   /db_xref="HOGENOM:HBG067633"
FT                   /db_xref="HOGENOM:HBG175967"
FT                   /db_xref="UniParc:UPI00004B440C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR4"
FT                   /transl_table=1
FT                   /translation="MPPIVELLVPVGLFLLHSPACLPLAELPSSSSVDMPLEVTPAPFA
FT                   ASQRLPYVPAVPRPADSGGGMFPSGASSLDGAGPAMAAASAIIPPAPGGVAGPHRAIPA
FT                   LPDAGYTSVNPPWFSMRSQGPPSIYSSSYAGPCSLYDSELREPPHYQGHIYSHHPVIRN
FT                   ENWASSSLPAPRRGPPSPDSVMIHHRHHHHHHRRHHDHDDDLDHKQRSRAGSVSSVPDT
FT                   EGLNESQAYRRRSRSISQGQTYKRHRSPSLPPGNVHHLHTSISPSPLAVNDGELPGNVG
FT                   HSVLPPLDAARRPQRMSLPPEEEHRPRPQLFVPPGYEAPELRKGKKQDIRGGFEATDER
FT                   RGRHSSAASEDSVRSHLHRNNSTFIPGGFQTHSRHRSGSYLLPESGYDRSASPPLVMHG
FT                   PASAVSGPHYPPDIEGNYRRRTASMQGLERPEQTSSEYQIPSMAGGQVVYDDSASVASD
FT                   SRMTLEDGAVSGRTSQYGLPRYPHQPKMDYRRFCVQRGNADVFLD"
FT   CDS_pept        join(complement(595755..595793),complement(595565..595698),
FT                   complement(595343..595434),complement(594841..595226),
FT                   complement(594643..594789),complement(593925..594593),
FT                   complement(593803..593876),complement(593376..593753),
FT                   complement(593212..593327),complement(592892..593162),
FT                   complement(592754..592833),complement(592404..592705))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636336"
FT                   /locus_tag="CNC02120"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42172.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG067632"
FT                   /db_xref="HOGENOM:HBG175968"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR016688"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00004B440D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR3"
FT                   /transl_table=1
FT                   /translation="MSDGRSTGRQDNLHYPVQAGHTVSLVPRSQTQERETHPELQGITR
FT                   NYLGSDPNSGHIRDQSLDMPEGEGYGMTDIPHNSSKSHLTPADGNAPYTGASTPNRVHY
FT                   PPSPLMPRGQPQGDAYTTIPLQDGHSNASVSGATTPHSESMNKRKWSFLPGNRSSASLE
FT                   KSGVDEKGTKRRPKNQRGTSWDLLGDRGEWEEFSPKNASVENLRFAEGDVGTNKFSRLY
FT                   YWALNKGIIVRWAMYIIPVLILFWIPGIIFYAGLRDAKVWSVTLNWWSIWLTIIWLTFW
FT                   GATAAFMMLPHVWRNTVAVIVPSAKPLTDIIAALGRYAKLTIWCLAIWVSFTPLIVNHY
FT                   TGDESATSRSDLSTVANLLFGLFLCSIVYCVEKLIIQLIALQFHRDSYEDRLQEQKFCL
FT                   KALTYLYTNSHDIPGRTDTLTDAMSTKTKGSQMPKVALRKALKGLKEAAQTTTTALGNV
FT                   ASEMAGQSVLQTNSPSNRVTMALNSANKSKALARRLFYSFRAPGAAHLDIQDIVQYFPN
FT                   LETAQAAFAIFDKDGNGDATRDEIESAVLGIHRERLALEASMRDLDGAVRRLDDIFMVV
FT                   VIAIVVLIMASMITNKLTTFVTSAGTFILGLSWLIGTTMQEVLGACIFLFVKHPYDVGD
FT                   RVDIDGVQYTVAKMQLLSSSFKGVDGKYVWIGHNVLTTKVIENIRRSGAISEEFSFEVA
FT                   FDTSFEALQALRSRMIVFLKENSRDFLPVFDVTVDDMPAQGKLVLKADIRYKSNWQQVS
FT                   LKIQRRNKWICALKMALADLKIFGPDGAGNPNPEEAGPTQYTLVPWEECRPNTTEGSTA
FT                   PPPPFTSAAPSPPPLMDARAAVDDPYGDIWNEGDELLGFRSADPSRPGTPGPGPATRQR
FT                   QPQVPQHQDTLGMSEVAVDAKRQP"
FT   CDS_pept        join(complement(602287..603492),complement(600109..602238),
FT                   complement(599592..600055),complement(599353..599534),
FT                   complement(599188..599303),complement(599076..599126))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093119"
FT                   /locus_tag="CNC02130"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphatidylinositol binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="cell communication"
FT                   /protein_id="AAW42174.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG067631"
FT                   /db_xref="HOGENOM:HBG175969"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00004B440E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR2"
FT                   /transl_table=1
FT                   /translation="MPSAALSPPTAAALAALALVLLPHIPRLLSCATLCLSILALALAA
FT                   LFCAALTTDYARTPQLLRQRSVLYRLRLSPAPSRSPTKSPISSFSSQVNAAISAFLDLV
FT                   VQHFVIPWYSRISPSPDFPDALEELIQNAIAQVAEKSDKVDWPSFVVSKILPIVTDHLR
FT                   HYRAIEHLPVGPQALPLPLPPHPHKALTDPHLAAQAIEEHLRQTLSRILPDLLPKSEQT
FT                   PVVFTLVQEILLGSVVLPGFQMVCESDFWNRQIDERVGQYLHEQKQVDQFLSALSSFPA
FT                   TSPSVRSPTVSRVRRKSHSKNPSIDANSSSSQFDVFLKSIRKLWTLGEARRLKADVERE
FT                   LRSARLALDEENKELDDAGPTHQSTDKAPSKGTRKSQKYVERLVRAKSAIDSRIVELSG
FT                   GSKPSNSGPTFVSLDTSQPISLYSILSNPSSLAYWLEFMDRRHRSRLVQYWLTIEGFKD
FT                   PLEATGTDVSEDSKSTERNIHDTTIEDAQSLYATYFSAPQSASVFISPQHQHMIETAAS
FT                   SSHNLSPQDIARVRRAVFASQREVYEQMEDEDWSAFSKSELYLKAVGDLQRTHSALKSA
FT                   SAVNADVQTPDNRRATLSRTPSPMAQVHHSLPRHQTPALLHRPLQQITPQTPKVINFLK
FT                   PHSPASVSSPSLPPGPSSVQQKRQSLPPAILTAPTTPAGPSISVSEFVRVASPPPFGRS
FT                   VSDSRDSLNSSSNDSAGRRKGSANEMNSPSPSLSPSYASTPLILSPKLVSPPPPSAKHS
FT                   SQLNFLIGNEENGESHGRDRLFGDEPDDSREWERGEEARRIEAIQAALSEIIADDNGKR
FT                   SNDGTPSDSLMSEREKPRERGNDMSSSLILGSATDKKERKRKSRSLEDLKSASLLSSTT
FT                   FSSAANLSQEPGRNSSKLLFEDDLPEDDLSSTPSVEEDSDIPHNVPLPVPGDLQLTAQI
FT                   SELDANLLELDKQNELLSTLVRQAELTGNQKELKILRKSQSSVQRETRAKQWQKQEYER
FT                   VQDESRLVPGRTRVSIPSAAVTEDTENTSASTLGVVGPKQVVRYTIHVCQIDDGHPAAK
FT                   WAVSRRYNEFWELDKNLKEWASEHGDLETTETLRKVEIPGKSLVGGISANFVESRRTGL
FT                   EKYLQGLMTSPTICDSTHLRSFLSRSNSLVPSAIRTQPAVTQLTKLPHNLMKSFYKSIS
FT                   LGPPSEDMFNANTADVMYSGLTRQINDLGGFVGLGLGSPEVEVKEGHVQVTRDVSVEGM
FT                   TSFTGPICDLFIELFDLKEKNWLRRQAVIVILQQFLGGTIERKVRDYFRSVTSQSSFLR
FT                   IIQNLQDTLFPSGKRRTSTASRSEEEKAETRARAGKKLGLLIPDVAANMIGRGNARRAA
FT                   RRVFGVLQDERLNQQLMLRILDTVLDTIFPSMEGSGVTY"
FT   CDS_pept        join(603714..603832,603884..606585,606657..607033)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805532"
FT                   /locus_tag="CNC02140"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAW42176.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG067630"
FT                   /db_xref="HOGENOM:HBG175970"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00004B440F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR1"
FT                   /transl_table=1
FT                   /translation="MASVKALLRTPAYNPLPLPTLPSPEPHGRDAEQLPPLAESLVLPY
FT                   SLIQTRHHHLTSLLPLAFSHPPIPSHNKPRAKPLPKGVFVFPTPPPPVHPLPTREYHGP
FT                   RDLLNEASPSATPPANPASTPVPPQPKGRKRSGEPEPPAHEIECIARVTLALGPMSFHG
FT                   TELWVGRFVEPRANKPKKERAKPGERREREKKRREGIEKERQRTHSGPSATPKPAASVA
FT                   RPTVATAGPSAPRMRPPAPGPAVTNRTAASPQLIQLVNQAASRHPWLSSLIYKAAGSTA
FT                   NQDELERLGRAVARLSKGEAIDDLAPQRVNIASSEVLKGKGKETAASTSHASKTSVPAV
FT                   PGPSSLSEKPTSAPAPLLSQNTSSSTLTPVVPAEKDKEDKKDDAESDWDSEVEMKGPKQ
FT                   VGGGPIGPSTLDSAAAASTIPLTSTATQPSYAPSSVPASQAANPSVPSPVPGIVPSPIP
FT                   VSASTSSAVPLSPHAPPPKPNLPNPPPFLLIAFKEHPTDKFLIPLGSRSFVSRVGGDWV
FT                   TSKPPHLAPDTTLPLGQSLETSGNTNPTVAPQPAAQAAISRELQALQSSAKSSSFELEA
FT                   QSHSKRRGRTHVRPTNANSPSPAPPKVKTKPIEEPSLTTTTTTPEFPPLPQLPGQNPPP
FT                   GTVLISTLVPANKWNKVDWASLGKKVPWSEDWNSKVKAGTNENVREEEPLPLPLSDASS
FT                   QNHVQLLNLAAEDFLPENGPLKAITIRLGQVDDQIWGRMKDVMTLVDRAEIMALSAMGV
FT                   LPPAPDSITHPADDPEIREAYLLHKTSLFSSLMGRTRQPRRFLHTRPSSPPAALVDATV
FT                   DKMAPRPYPISTKPLYHVEEGDNEMEGRRDSVRQWSPDVEFDDGLGRRKKKKTAQETVG
FT                   FEMPVSLEALDERVEASAQKALLGKRGRAGGGEGARKEKQRRGIEKGICEGCAREGIKI
FT                   WRRGPSGKGTLCNSCGDLFTEGKLQYSDLKAPGAMKTLLAANQDVSGADAMHNQVEEKN
FT                   DSVPVKAEQGRTTEEALGDGTAINSEEQKETSTQVVQAERPPEHSPQHHAVESQPATQS
FT                   LPETIEPGVDMQNQKSL"
FT   CDS_pept        join(complement(608694..608738),complement(607765..608640),
FT                   complement(607470..607712),complement(607368..607412))
FT                   /codon_start=1
FT                   /gene_family="HOG000214327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805533"
FT                   /locus_tag="CNC02150"
FT                   /product="Putative uncharacterized protein "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="AAW42178.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG141771"
FT                   /db_xref="HOGENOM:HBG559646"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI000042C106"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKR0"
FT                   /transl_table=1
FT                   /translation="MATVNIRRDVDDKFYRYKMPLLQIKIEGRGNGIKTVVPNMEDIAR
FT                   ALNRPPTYPTKFFGFELGAQTSMANDRYIVNGAHTADRLRELLDVFIEKFVLCPSCKNP
FT                   ETEIVITGRSGHEDMHRDCKACGRQNPIDMRHKLSVFIIKNPPKKKDKGGKKGKKSGGM
FT                   TAEANLGGPMVFEKTEDGSGEDDSSPDAGIAGVPTTGTEIDAVLGRGDPILGDPDAAEA
FT                   ASKKLAKLDVNGGGDEEEDEDADSPYAALGSWLENNKEADDASIIAQIKDLGIAGKHKV
FT                   LVEIGQHLFSDDICDEIAGRTALLQALVTSEKHQKSLLGGIERLIGLSPSLESLIAAGT
FT                   TSKILMVLYQADIIEEDVVQQWGTHVSKKYVDKDKSKKVRKNAEAFLKWLEEAEDESDS
FT                   DEE"
FT   CDS_pept        join(complement(614472..614490),complement(614341..614398),
FT                   complement(614143..614290),complement(614016..614064),
FT                   complement(613250..613956),complement(612851..613199),
FT                   complement(612539..612785),complement(612377..612483),
FT                   complement(611736..612319))
FT                   /codon_start=1
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805534"
FT                   /locus_tag="CNC02160"
FT                   /product="Glycerol-3-phosphate O-acyltransferase, putative "
FT                   /function="acyltransferase activity"
FT                   /protein_id="AAW42180.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG175971"
FT                   /db_xref="HOGENOM:HBG324690"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI00004B4410"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ9"
FT                   /transl_table=1
FT                   /translation="MAAGLAYDLVLIFWRIVINIFFREIRPRGAFNIPREGPVLFICGP
FT                   HANQFLDPLLLFSEARKEAGRRVSVLTAAKSMNRKFIGAVARIMDSIPVARAADYAAAG
FT                   KGRIILSESDPLIVTGIGTSFIEQVKPRSQLMLPKSAGYASAPVAEVISDTEIRLKSEF
FT                   VVPSKDGSANVKASHRVRNESELKEGLQFKVLPHVEQEDTYGACFQRLYEGGCIGVFPE
FT                   GGSHDRTDFLPLKAGFSIMALGAIAAHPGLDVKLVPVGLSYFHAHKFRSRAVIEFGSPI
FT                   SVDPELVELYKQGGAKKREACGKLLEQVHDGLRAVTLRAPDWETMQVIQAARRLYRVPG
FT                   QHLTLGQVVELSKRMMEGYLTYKDEPKIIDLRQKVIAYNRLLRDMGIADHQVERASSRS
FT                   IKSLLLLVYRVGLLLWWSILALPGALLHAPVFILAKLISIQKAKEALAASTVKIQGRDV
FT                   LATWKVLVSLAVTPLLYIFYSVLATFLAYKYDLAPEWRHWTPVVIFCWLPGWAMASLKF
FT                   GEAGVDVAKSLRPLFLSVWPYNQREVNRLREMREGLTNEISEVIDEFGPQLYDNFQKGR
FT                   ILPSASVPQTGRNPGLLSRKSQTADSSVLSHPMLWLDERIFGWSRSASVGQSVWSSSAA
FT                   NKQQESEAAPASPYDSEGEEEEEADVDYDDVLAIIDTRRSSGGGVGLASPKGKKRRYTG
FT                   QARSEGSVASPKSDIEGVPLPRADDNGVVRLHKRPGAAKDGISETKGEEGLGLDTGREK
FT                   GQ"
FT   CDS_pept        join(615052..615543,615592..617463)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805535"
FT                   /locus_tag="CNC02170"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42182.1"
FT                   /db_xref="HOGENOM:HBG067628"
FT                   /db_xref="HOGENOM:HBG175972"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI00004B4411"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ8"
FT                   /transl_table=1
FT                   /translation="MWALRTSAPLVRPPALTLLRSVPRLLLERGYSRPAGRAGSRGGHS
FT                   RTSLATAPGNTPRQPKRFELPPHHTPHTGKAKVPSDNTRSSSRPSRPIQNDDNPWTTSV
FT                   RLRRWIERHKLPLSPGQVDEVTKLVTEAPQHMLNAPVWNMLIGYMGRLRKLDRVWNLYN
FT                   QMKKRNFTPTARTYSTILNAYAGVAHSGQIPDFSFREPQKRTMSRVTIVYNNSQEYMKK
FT                   LIEAQEAEEDLGVATPGVQLREDRHQEPMESLQSDIDIAPTNAYLKFLSRHGLFSEMQR
FT                   TFLSLPQSGPLAPDTVTYSLMFTALYHVHRSLERDPNGKANAMMIGPTAKALWDHCLKQ
FT                   YSKEEGQAGQVDNGLVAMYVRCLLRGRPEDQRLAVSVIEQVWNLPSPGNSNPTSTSIYL
FT                   PPPLLTTYPIPKLDIDVKSATALISSLHTAKLPVLATHYTHLILSSSSLIPLFDLEFFK
FT                   AAILALSVTGEVQSIVDIMDTYQPPSSGKEGWPRDTYRAALTAARWAGDYVSALSIFRR
FT                   ATHLSSNVGCISTDPSTLPKKIEPYRWVTPNGLAHDKRGVFWVKPTKIDADAQLLGLLV
FT                   KTAMQKSNKEIRSALDVYARTGGESKFLALPSSVQAGNVSTGRKLLRDGRPDEIDSSVI
FT                   RKQVASSVDLARDIQRAAERLGKGYEKMAAEAGEVVTKWAWVERETRKKTSDVKGDTKK
FT                   VEMDIEGSAEDEELDWEDERSVDQRESRVRGNNQDRHHPTERRRWEQRGTSKSRHDSPS
FT                   HRRYGHEQDSNKVKPREREATMHEGKVSSFGLRR"
FT   CDS_pept        join(complement(620420..620495),complement(620260..620357),
FT                   complement(620083..620186),complement(619934..620029),
FT                   complement(619680..619862),complement(619294..619627),
FT                   complement(619153..619229),complement(619086..619096),
FT                   complement(618841..619028))
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805536"
FT                   /locus_tag="CNC02180"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42184.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG176915"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000042EB25"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ7"
FT                   /transl_table=1
FT                   /translation="MPIAVNDNVDKDTLGRPFSLAKSTRERLVQAGIDLSKGYPEYPIR
FT                   PKTIELASDIRKEGWEHKDPGARADKEKKALFGAAKEVIHLSPHLGTEIVGLQLNQLSD
FT                   QQKDELALLIAERTVVFFRDQDLTPQTQLELGKYFGTPEIHPSAARVPGLPGVSIITDE
FT                   VLRSTGRVPDYKNPFATQKWHTDLTHEPQPPGVTHLHLDHLPGVGGDTLWSSGYAAYDK
FT                   LSPAFQKVLDGLEGLYRSAHSYPNPVTGELEPIINAHPIVRVHPATGWKALFVNSRYTI
FT                   GIKGFEQSEAQAILQKLFQVYEQNPDTQVRFRWTPRSSALWDNRVSIHSAVYDYLDEGS
FT                   AEPRHGTRVSSLAEKPIPVSEGVGKSRREALGLNTGVVHELPIDTHAY"
FT   CDS_pept        join(complement(625226..625336),complement(624805..625173),
FT                   complement(624099..624717),complement(622275..624038),
FT                   complement(621657..622219))
FT                   /codon_start=1
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093120"
FT                   /locus_tag="CNC02190"
FT                   /product="GTP binding protein, putative "
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42186.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG330916"
FT                   /db_xref="HOGENOM:HBG350173"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI00004B4412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ6"
FT                   /transl_table=1
FT                   /translation="MEAPHKAHHKPSAGAKHAKKDAAKGVDRSGGKNFNPKAFTNTSFR
FT                   AADRAARRTAEKNQQRLHVPLVNRNPEERKVTNEKGKGMDEGALPPPPIVVGIVGPPGV
FT                   GKTTLLRSLVRRFTKHNLSQPQGPVTVVSGKTRRITFIECGNDLNSMIDLGKVVDLETF
FT                   EFLNILQSHGFPKVIGVLTHVDLIKKASTLKDTKKRLKHRFWTEIYQGAKLFSLSGVMN
FT                   GRYPDAEINLLSRFISVMKFRPLVFRNQHPYLVADRIQDLTPREAIRENAKIDRTITLY
FT                   GYVRGPNLPPRNAKIHIPGAGDLEVKEVERLADPCPLPTLESERRRKMGEKAKLIHAPM
FT                   SDVGGVMYDKDAVYINVPGNFTKGGDTPQGEGEKMVMDLQDAEKTFADNIQASEIRLFG
FT                   HSSAPLQVTEERKDRVRRKAEPRSGGPMLGKADEDEFDESEDDEFDDRSDTEEGGVLNG
FT                   ESDEDDDQDERDVAYAESESDHDDLAFATGFEQEGGRINFDDEDDDDFPSDEDDEDVPG
FT                   WKRNLASRASSTLADRLRKKRNLMTLIYDTPLSPEEIVNGKTRPSSADASSSFAELQNE
FT                   GLFRISHEENKGDDGDQVKEEVDRDQLKNKWADEEMLESLRGLFISGPVAGEGVDEDGE
FT                   AYEEEGEDFEDLEGGSDGRGDGEDDVPYVGVKPSQVSVEDARAAALAKKKEALKIKFDE
FT                   QYDDSDDEASKMDFYDQQKAEMARQKQINEEEFGNLDLDARTQIEGYRSGMYVRLEIEA
FT                   VPYELIENFDPRFPIIVGGLLAAEERFGFITVRIKRHRWFTKTLKTNDPLIFSLGWRRF
FT                   QTLPLYHLDDHSIRNRYLKYTPEHMHCFATFYGPVSAPNTGFCAFNSLQGDAPGFRVSA
FT                   TGVVLDVDRSTKIVKKLKLTGAPYKIFKNTAFIKDMFNTGLEVAKFEGANIKTVSGIRG
FT                   QVKKALSKPDGAFRATFEDKILLRDIVFLRAWYSIEPKKLYNPVCSLLLSNKESWQGMR
FT                   LTGQIRREEGLKTPLDPNSAYRPIERTTRRFNPLKVPRKLAASLPFASKTPELSKQRKP
FT                   TYMQSRAVVLGEDEKKAVTLLQQIQTLKKDKAERRKAKQDERKGAYRKKVGEKDEKREE
FT                   KIREERRERFKKEGLKRKREEMSEGKGRGKKSRA"
FT   CDS_pept        join(625562..626285,626341..626462,626529..628172)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805537"
FT                   /locus_tag="CNC02200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42188.1"
FT                   /db_xref="HOGENOM:HBG067626"
FT                   /db_xref="HOGENOM:HBG175973"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI00004B4413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ5"
FT                   /transl_table=1
FT                   /translation="MVNSPPQGLPPIKLKLSLTNIHQPSTPTPTHNKKGKRAAPPIDAH
FT                   DANSSSLLPRPKLKPNAAGPSAFRISLPAVGSSTADLSTVATPVPSTASSPANPITPSG
FT                   SASKAQTSPGKKSSIKKSAKPLASKKKTGPRRPPSAIPQRLLSSTSTTPSKPSAAIPET
FT                   PTQVKAEPEDISPASSSIPPAEEVTGISTPSQNGGEETPGTGKRPTKWMRVKKPLKELL
FT                   QKIMVEIRKKDDYALFEEPVDLEAFPDYLDVIGGEDNMMDMGTMQAKVDRNEYRNIEQI
FT                   EADLRTLASAAQKFNPPGSVPHKSAGIILAHGLKHIERSRPLVLTPPSSPRDSATPARA
FT                   TSVLSTRELTAALEERKARDDVPPHLYIPEEMLSFPPNSVMARAVGWNLNGGKRMYNKR
FT                   ISRAREKFGGKWRNWTTDGSRDIAEADDIHLLFDPWRVRTGEEWRKVPDWQALRNETNW
FT                   WELEMPPPPPQSAAQQAPLPFNPGEPRLDKVPLHDFVPYDFGQYPSISSEISFLRQRIP
FT                   NLSEEEDILSEHIRPVYPRLKKGESAPPPNLVNIYDGPLRRTAGDWVREMATGGVIGEA
FT                   YIDSLNRFVKGAMKEGAEKDLSGEQDTKPNLGSEQLPLDEYVMTSYHTPFLQTSTRQTI
FT                   HDTLGHLSPLSARPDYILPLAKAAYARVALRLLTGPSNPMDIKPLLREEGDFMYQGVGG
FT                   KSGVNVGLEWTGEELRRLVEKMSVQKQYLAGKRKREEGNGVEGETKRIKMEADSAAAIT
FT                   DKPSLISESVTSHPPQPRDAAVSEEPEKINDEELKRLRLELVALSKFYPLPALKKMSKE
FT                   EAAKLLPVNVRGLMCRP"
FT   CDS_pept        join(complement(629635..630265),complement(629433..629588),
FT                   complement(629278..629384),complement(628937..629226),
FT                   complement(628731..628878))
FT                   /codon_start=1
FT                   /gene_family="HOG000192069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805538"
FT                   /locus_tag="CNC02210"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="AAW42190.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG028784"
FT                   /db_xref="HOGENOM:HBG316388"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000042D590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ4"
FT                   /transl_table=1
FT                   /translation="MFSHAPPHLPHQHQHHPLQHQSLHRPPTAPSTPDTEHSTHTWAPT
FT                   PSFPQHMSQQLQPASNIPAYLFDRRQFPYSAPSADATRQNAAHTPQIAAAQSTTPGASA
FT                   SGPLLPQNLAQHLNNPPPPTGSQQSINPPMQTQAGPGTGSVAGAAAGGKVLLMPNGAPP
FT                   PAGSDEEKIYILITELLEPETREAALLELSKKRELYEDLALVLWGGFGIMSSLLLEIVA
FT                   VYPALSPPSLTAHASNRVCNALALLQCVASHSDTRALFLNAHIPLFLYPFLNTTSKTRP
FT                   FEYLRLTSLGVIGALVKQNDNSDVINFLLSTEIIPLCLRIMETGSELSKTVAIFIVQKI
FT                   LADDLGLQYICQTYERFYAVGTVLANMVDALVESQAVRLLKHVVRCYLRMSDNPRAREA
FT                   LRACLPKALQDNTFNPLLKGDMVTKRCLQTLLMNLNERPSSDIQ"
FT   CDS_pept        join(630416..630432,630478..630510,630561..630606,
FT                   630659..630686,630754..630761,630816..631066,
FT                   631120..631153,631213..631227,631277..631306,
FT                   631363..631526,631582..631754,631811..631973,
FT                   632033..632646,632723..632781)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805539"
FT                   /locus_tag="CNC02220"
FT                   /product="Expressed protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42666.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067625"
FT                   /db_xref="HOGENOM:HBG175974"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI00004B4414"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ3"
FT                   /transl_table=1
FT                   /translation="MQAPQIRLNERQANPNPYVVFIRSLQNKADHTDAEDILRAVAAQM
FT                   RTIMKDRFMQIGTLEEAEFNRVVSQPRQATGESEKADATKFAGRNWNHGQVGMIWHVQA
FT                   VVVYSLTFQSIELVLRGPSGRFLPMPYIISVMCHEMAHIEQMNHGPKFQKLMREIKADV
FT                   AKLQARGYYGDGFWSDGKRLADSVRMGGEGLRPSDFPEYICGVSSSDAKKARRGPRRQA
FT                   NRTTGLVKGEASHRSGRQTEYRKKAGRRNNADMGDNGLRLDGIRVITKQDREERKAFVD
FT                   DKIQMLTRGGMPLARARKQAGEMWEQENPWWAESNTRSKVAKSKSAAALRAEAAEARLR
FT                   ALAGPSRDTKHKLEPMSSNSEDEDESSDDGIEEIPDPHLSVEDRKKEMDEMDEEEKDGL
FT                   RGGWEDYITPPNVYRPITSTNSSDSSETKPSVKRPPPESSGPSKIRKLQHQAPLPFTTK
FT                   SIKKERSSFPGESTSALGGRPSIISPATPQMSKELGRGEDAFPREDGQPGWRCRLCTFI
FT                   NLMDHGRCDICQARPDGTLPEDVQSII"
FT   CDS_pept        join(633446..633656,633728..633950,634015..634184,
FT                   634251..634497,634556..634739,634803..635030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805540"
FT                   /locus_tag="CNC02230"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42667.1"
FT                   /db_xref="HOGENOM:HBG067624"
FT                   /db_xref="HOGENOM:HBG175975"
FT                   /db_xref="UniParc:UPI00004B4415"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ2"
FT                   /transl_table=1
FT                   /translation="MSQLLWISDASPLFFYSPAEAYFAGQGLNSWVGSAGLNSTTTVAA
FT                   ANGGGGTTTYHSTTGMAGVIIPAIYATSFVPIFSAPDSYDVTMQQNSNDPQDWKSGQNW
FT                   TSSGGDFSAQTFTIEVSCQGDCDDDFIFEGAWVETELAPEGSDTESVSLDDSSLLIQYT
FT                   GFTSVEANSQPVQVSSSDYNSSLSMTSTAGATAQVMFTGASVMVSGVSCPFCSTFSVSL
FT                   DSKTAATLDSANNATVHGTLLYFATNLDTSDTHTLILEAEGGGTLVIDEFTVNGPKGRV
FT                   GFIGTVDGLTTTVGPSSTGVISSDGSSSNTASNSGATALSAATEGGAPNVGVIIGAILG
FT                   SLAGVAILYFLCRKAVPAAKSSEKKKMDPWDEANLLQNMKNEGVHVTTVANQRYVYRGY
FT                   HQLSNPSYQILNDPQSRINRP"
FT   CDS_pept        join(complement(636812..636947),complement(636524..636762),
FT                   complement(636269..636469),complement(635338..636221),
FT                   complement(635090..635282))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942103"
FT                   /locus_tag="CNC02240"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="protein modification process "
FT                   /biological_process="protein transport"
FT                   /protein_id="AAW42192.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG067623"
FT                   /db_xref="HOGENOM:HBG175976"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI00004B4416"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ1"
FT                   /transl_table=1
FT                   /translation="MSSLSLTRDWLHSVLRPFPARETITQEVLYVLQQRRTLAVKTDAF
FT                   TFDSGHTALLLLLHGTLPVTYRGAIYQIPIHLWVPHEYPRAPPLIFVMPTKDMGVRKSR
FT                   EVEPSGRVREEVVEGWWRAWEVKNLDMLLKHLADVFSAAPPVYAKPSTPSQSQGLPPGA
FT                   RTSTPEGQTGAPQPPIPVTRPTFGHPNPEILPVYRSAPTPPPHPYSHNPTRQLSPPTSS
FT                   APQHVQTPRESQYMSNQPRQTQSPSPSASAPPVPQRPYSGVGPLPQVAGSLQQHYTGPQ
FT                   QVWQGVPASRPPPPAGMMSSQSTAAGQPWPIPSGENGNNAVHPSQQINHPPSHPHQAQK
FT                   SQSLPVPRQPPQDLLSSPGTQPTVLSNESDGASGPPPIPPSKPPPPSLLHLHSILLPHL
FT                   NASLPPLMNSLHSSVEHLRARQEDLVTGEPAIRDEMARLEAVKKVCDSVGKKMEEVVAK
FT                   GGERVADLESKGEVAVDELVCGISIVHNQLVDLVAEDNAIEDTIYHMTRALDAERVDLD
FT                   RYLKSIRSLAREQYMKRALIERILQGMGQKQGW"
FT   CDS_pept        join(637746..638375,638434..639249)
FT                   /codon_start=1
FT                   /gene_family="HOG000228587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093121"
FT                   /locus_tag="CNC02250"
FT                   /product="Hydroxymethylbilane synthase, putative "
FT                   /function="hormone activity"
FT                   /function="hydroxymethylbilane synthase activity "
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="AAW42194.1"
FT                   /db_xref="GO:0004418"
FT                   /db_xref="GO:0005179"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="HOGENOM:HBG175977"
FT                   /db_xref="HOGENOM:HBG624842"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR001693"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="UniParc:UPI00004B4417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKQ0"
FT                   /transl_table=1
FT                   /translation="MSCPFHTTTNTSNRSPLPDRALLLAMKSQTNTFILGTRKSNLALV
FT                   QTGHVADDLRRLHSGAGSKFGETREEGDDAEQGDVPFVHPYTFSIESMTTVGDRNQTTP
FT                   LHLLSPYSSTQPAKSLWTDELEARLINGHFDMLVHSLKDVPTVLKDGCEIGCMAKRHDP
FT                   RDALVVKQGLPYKRLEDLPDGAVVGTGSVRRVAQLKRAFPNLVFEDMRGNLNTRFNKLD
FT                   NPQSPFSALILAMSGLERLGMAHRATSPLSSPTLMHAVGQGALAIEIRSTDPRVRNCLR
FT                   GLGHWQTEWSCGAERGCLRVLEGGCSVPVGVESELVELDEDEVAAHPELLEGVEDPFKG
FT                   QEEIPLEGDSPMLWFSGLVDTTSAPTPSTPTFSSHSLPPLRTRLAKLTLHSCVTSTDGS
FT                   KHVLFTPPPVLVRSYRQAEQFGEECARRLRGMGAGEILDEINKLRKERELRDLESAIER
FT                   SRAAQEESEKMGLVQDGTAEVVA"
FT   CDS_pept        join(639838..639940,640005..640420,640471..640680,
FT                   640728..640784,640833..642077,642129..642181,
FT                   642234..642423,642471..642932,642983..644784,
FT                   644835..645612,645666..645782,645836..645934,
FT                   645985..646302,646351..646705,646751..647110,
FT                   647164..647281,647331..647476,647618..647688,
FT                   647744..647851,647902..648098,648147..648373,
FT                   648422..648630,648681..649173,649221..649356,
FT                   649408..649551,649602..649926,649975..650202,
FT                   650268..650486,650547..650595,650647..650911,6
FT                   50961..651006)
FT                   /codon_start=1
FT                   /gene_family="HOG000191432" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805541"
FT                   /locus_tag="CNC02260"
FT                   /product="Late endosome to vacuole transport-related
FT                   protein, putative"
FT                   /biological_process="protein localization"
FT                   /protein_id="AAW42196.1"
FT                   /db_xref="GO:0008104"
FT                   /db_xref="HOGENOM:HBG058337"
FT                   /db_xref="HOGENOM:HBG324674"
FT                   /db_xref="InterPro:IPR009543"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="InterPro:IPR017148"
FT                   /db_xref="UniParc:UPI00004B4418"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP9"
FT                   /transl_table=1
FT                   /translation="MQALKNAALGLLNVYVSPYVENLNAQDLSLSLFSGNLQFHGLHLK
FT                   KSLLERFGLPVEIVAGDIGTLSISIPWTALKTQPVKIVIDDIYVLARARPPGKVDPEED
FT                   ERVEQATKQEKLKSAEAVDSAASQMGPQGGNEETKQTYVGAIVSKVVDNVQIHIKGIHI
FT                   RYEDGTSTPDHPFAAGVTLNEFKAVSTDANWMEAFIHDSLHGVHKLVQLEALAIYFDTD
FT                   TESLEKGPEERSETIQALKDMLDGPHNHQYILKPVTGEARAIINKHMSNDTPKFDAQVI
FT                   FDEIGVVIDRDQYRDVLSVIDVFHFYRRTHQYHKFRPSEEQFKANPAQARLKFALEAIR
FT                   SEVHERNRRWSWDYLQERRDTRKQYVDLFVKKLALPEGKQLPVDEATALSGIEVRSSYE
FT                   DIRFFRSVARAKAKKDAATRRKMELERQKNQPQTQTWGQWLWGPSARSSDIDGGISEEE
FT                   KKELDDIIDYDSSAAQETIEATPRDFMKARVSAKLNKGSFSLRTDPHGKCTDVMALVFD
FT                   SFSADAVQLTDSMKGKFALGGFRVYDGTTPDSLYPQIVHVKDLVKNAGGQARQAGLNEQ
FT                   GIQAAMDAVEEHLTDDKDPFFLMEVEHNPLDGRADNAVTVKMRHLEIIYHRGYVEAVVR
FT                   FFRPPESQLESIGALLDAAGQTLDGIRKETRAGLEYALEQHKTIDLRVDMNAPIIIIPM
FT                   DVKVKQSQTLVLDAGHIFVGSKLADKEQLQEVQSKRGRQYNEDDYKQLEDLMYDRLDLR
FT                   LESTQLLMGDDVEACMRALEDTHSSSSYEFHILERIGMSFTVQNAIVNAPNLTRFKVAG
FT                   ELPELHVNFSDRKYQALMKFIDVSIPKFESDQTQQEHVTPTTAAQGRRHFGQREIEEYN
FT                   FEDDRSIISARTTEERDTLDDGSSNGDKGDRFYEAHDQQTESQKSALRQVTFEFSFSVG
FT                   KLQASLFKSVSPTTERPLADAVLEGFGLTFALRKWDMSVDLFLRSVTLAMIEQGSARRP
FT                   LLSSASEGGNSPSDLKLVQVKYLKAQKDSPEFMTKHEGVDTSIDTELSTFKFTISPEPI
FT                   LYLYDFIMTTFVPNNQSSVNQPSQGVETQVLGVDQEEAQPSTDKMRIRVKLTSAQVALE
FT                   NNGNKFALLALPSADVAILLRNGGLRVGARLGNLSLEDLSPEPVADTSFKKLLSIEGGE
FT                   LADFSYETFDPTDKETFPGYNSSVNLRAGSFKFTFMEKPISDLYAFATKFARMKAVYDA
FT                   AQQAAVQRASEVTRMHFDVVIKTPIIILPRDGITSPDRLILRLGEIIAKNEYFNDPDDT
FT                   SAIDASLRGINVASEIMVGDKKAILQMIDDVAITASIRQAGGTAHRSDPHHADTEITTN
FT                   MSDVKLSLTQRQYVLLMCVLEALPRALNDVSDAETPAESLEDTPETSTPSTPDSVEIRE
FT                   ATGVSLEPELVVSQDQRQLDVKLWTAFDFVFSVDTIALEIYSVDAITEDDLKSNSIARF
FT                   ALVKSHLGFKKLSDGATEAEFSLKTLSFSNTRTGNSVFRDIIPPASHEGNQIMLQYTMT
FT                   GGTDPSALAIVTVDSPQLILAVDPLAALLEFAVSPFKKHADAELQPQENVEQADEFEEG
FT                   PKQGASLSFRVEVVKATVVVIADDTNPKTQAIQLNIKEVLLSQQSILALKVDRIGMSFG
FT                   RMDRPNDRVKFLDDLSMALSLDTRRKGSQQMTSFEVEIPDPVIFRASYTNIMLIIDIVN
FT                   KATTVAAKALAPAEGTGRAEKDSKSLTKDSAYGTSSAAVMDPRRSRRRSSVTRRTSISK
FT                   RRRSLEGPQVIISKEQLEARVNGFQFVLVGDLQEMPMAHLSTDAFNVSIQDWSGDLKLA
FT                   TSITTSVRYFNLANSYFEPLVDPWNFDLTVNRVSAGPQNSPLNVKLSARERLEVNLTSA
FT                   FIELAITSMTIWSKEGERAMAGRGSDAPFRVRNLTGLSILIWPEATDLGKAVTGVKRLD
FT                   DGADVPWRFEDRKHTRENISAVRHNSLGIQLQDTPWDPLRDISVDRAGDHILTLRPRLD
FT                   RVSHQIACEIKLVNNIKVITFRSTLNVENKTSLPVEMIVVDSHGKAASAALKINPGESC
FT                   PLPLEAAFEKRFRLRPLRGFGFDFSWSAPLHWKTLLAKPIRPISCKHQTPKEPAFYFQA
FT                   QANFDPKDPAARIYPRMALVLRAPVELENLLPYDLKFRVHDKNSGLSSSSFLVKGGSSP
FT                   IHTVELSHMFLLNVTPEETSFKQSEYAIINTDDPELPIEDNFQLTDQQGLKTTLKLHYT
FT                   TYPNSGGAFKVQIYSPFIFMNKTGLPFDLAAKTWAGGQRPIAGRDQFEIFSFPNEDRRS
FT                   RLHIRVNNSKWSQPVSFEPVSADMQIVVPSASGDNDNYVGLSYAEGIGKYKLTKVITIA
FT                   PRFLVKNIYSRPIKIRQYGTRHEYSVGVGERIAIHQLQRGAPPQLAMAFDEPNVTWSAP
FT                   FNIADLGRTNITVRRQSGSNSKTYLMRVETHLEGSSIFLYVSKEKDDAWPLRLRNDTNL
FT                   SLAFQQIVSVLGFPLTDRERARPVHFLPPRSVQNYAWDWPTAGNKRIKLYVDPGNTSSG
FT                   EKGVELPNAIDMMAIGIQPPMKVPSTTANKRSTTVSIDVRADGGSQLLTISPYNEETSV
FT                   YKPTRPGAGIRRSESTTSLSSSTVAFETISVSEKPTMNITVELEGIGISVISRRPDELL
FT                   YFSLRGLKLGYSDYPQYYDVFVDCKWIQIDNQLFGGLFPIIFYPTVVPKDGKELESHPT
FT                   LQSSVTVLKDQSHGVIFVKYATILLQSMTIEMDEDFLFALLDFVKFKNASWKEEGQDVL
FT                   IEHPKDIPEPDISTTKADVFFEALQLQPVALELSFMRTDRVNVDEKVSTRNPFYYALNA
FT                   LTMTIGNVNAAPLAFRALFLENVRLSIPSLQERVILHYQEQFISQIYRVLGSADFLGNP
FT                   VGLFNNISSGFSDIFYEPYHGMVMHGNKDIGLGIARGATSFAKKTVFGISDSVTKFTGS
FT                   IGKGLSAATLDAEFQSKRRMTQRRNKPKHALYGVAAGASAFADSVTSAFEGVASKPMEG
FT                   AEKGGAAGFAKGVGKGFVGLFTKPAVGVMDFLSASTEGIRNTTTVFDQAELDRVRLPRY
FT                   IASDGVLRPFSAREALGQSWLKDLDAGAFFHDSYIAHIDLPGDDAISILSNNRILQVQL
FT                   RKLRVIWQVPFEELQSLSLEANGINLVNRDGRGGPFLPIPDQKAREWYFKQIGKVVVAY
FT                   NKAHSQRED"
FT   CDS_pept        join(complement(653091..653418),complement(652894..653035),
FT                   complement(652024..652840),complement(651674..651977),
FT                   complement(651519..651613))
FT                   /codon_start=1
FT                   /gene_family="HOG000138314" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636337"
FT                   /locus_tag="CNC02270"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42198.1"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG175480"
FT                   /db_xref="UniParc:UPI00004B4419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP8"
FT                   /transl_table=1
FT                   /translation="MASFHPTRREIVLVLTMTVILGLFFQFGSMGFTDPDSSDSLLRFR
FT                   MGFGHRCQDDWGENSRGEERGKWIEDVDTEVGFPKAAKIAGMAETKVKWGEQGPPRTQV
FT                   LAHAPGWTVFDDVYLFNGTWFIVTDHPSSIPLLRLMASTGNEIWNDEESIRGREPTEKD
FT                   MRIIFPSEAKKLWGQSASLVSGASFVVNDPPQFLDHYYHFAAELLLGLWRTYSSLDPTI
FT                   SAQGVTHLPSPSRMIFPHVSAGKWNDYAKMNSYLSRAIFPSMSYEYQNDFLDRVDTGRA
FT                   FLLERVVFADRAAAFRGPEFSKTWRTASEAVTLQASKYWWSPIRKNLLEFVGDGYGGDI
FT                   DLGEMGIGVGVEIPDIEEDIEAFEAEEGAMEEEKEEVREKIMKEKEAEASKPVITYVSR
FT                   QDWGRRMLKKESHDSLVKELHDLEEKYGWEVNIVSMDKLTREEQIRLSARTTIMMGVHG
FT                   NGLTHLLWMNGQNPRATVIEFFFPGGFAEDYEFTSRALGIKHYGVWDGQTFTAPDTPQV
FT                   AYPEGFQGNEIPLDGKAVSDLIVKRLLVDRPSRHLNDSDGVHDQ"
FT   CDS_pept        join(complement(654895..654908),complement(654682..654830),
FT                   complement(654545..654618),complement(654460..654492))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805542"
FT                   /locus_tag="CNC02280"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42730.1"
FT                   /db_xref="HOGENOM:HBG175978"
FT                   /db_xref="UniParc:UPI00004B441A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP7"
FT                   /transl_table=1
FT                   /translation="MRIPLIIHHFLTIIAISFTVAVFEYTMSTTYLNSACIWLFQATLE
FT                   QPTFLGLLGYRLGWNPKQVARLLKFAAVQTFLFKSASALTLIIY"
FT   CDS_pept        join(complement(656863..657020),complement(656761..656798),
FT                   complement(656700..656709),complement(656613..656636),
FT                   complement(656561..656567),complement(656421..656495),
FT                   complement(656303..656357),complement(656208..656250),
FT                   complement(656137..656152))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789013"
FT                   /locus_tag="CNC02290"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42729.1"
FT                   /db_xref="HOGENOM:HBG175979"
FT                   /db_xref="UniParc:UPI00004B441B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP6"
FT                   /transl_table=1
FT                   /translation="MMVVQQSTVIFLLCFSLPIVNALSEYQYLSSVNNFATSFLSPYNV
FT                   EVVKSINSTLFSEDVTGTADVSTNFDGRELSTEYLFGLFVKTADDSHDPSPFGSPISYN
FT                   VTGLLIENEFVSASIKFEFYYPVLNKTFPIQVELTYP"
FT   CDS_pept        join(659545..659613,659666..659773,659833..659923,
FT                   659980..660063,660122..660218,660275..660359,
FT                   660409..660524,660574..660652,660704..661057,
FT                   661113..661243,661296..661398,661450..661944,
FT                   661994..662892,662953..663082,663136..663235,
FT                   663284..663370,663436..663515)
FT                   /codon_start=1
FT                   /gene_family="HOG000209079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942104"
FT                   /gene_name="SPT16"
FT                   /locus_tag="CNC02310"
FT                   /product="FACT complex subunit SPT16 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42200.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG024439"
FT                   /db_xref="HOGENOM:HBG589021"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="InterPro:IPR013953"
FT                   /db_xref="UniParc:UPI00004B441C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55VJ3"
FT                   /transl_table=1
FT                   /translation="MSDIRLDSATFFKRAAKIFDSWEKPSGDTQALEDINSIAIILGDP
FT                   NDEVASYTKTTALQLWLLGYEFPSTLMVFEKSPRKVTFVCGSSKAKLIRQLQPSDGIEI
FT                   DVKVRSKDATAAKETMEEVVASLNGKFGSLPKDRPIGKLVDEWNSAVESKGDLEVVDVA
FT                   IPISAVLAEKDGEELKTIITSAKLTSTVMINYFKSKMESIIDRGTKMSHEALAQLVEEK
FT                   IGNEEKGPDMKLWNKNPSLGEIDFASSEFVYSPVIQSGGKYDLKVTAASNNDNLKPGII
FT                   LANMGIRYKNYCSNMGRTFLISPSKKQETQYTTLLEVRKEALALLKTGAVASDVYNSVH
FT                   QSLETKNATLADSFLKNLGFATGMEYRDSSFLLNAKNNRELKENMVLVLTIGVADLPDA
FT                   KNKGKTYSLLLSDTVKIGQNGAVVLTEGCTRLSDVVMDMEEEEEEDVKPQIDKKPKINN
FT                   SPKKPRSSTVGGRVLNAKTRGANREQATQTTAEKIKTNQQRLHAQLNADGVKRWEADAG
FT                   GKNGAQQKVVKRYESYRREEQLPRAVEDRRIYVDEQRQSVVLPINGYAVPYHISTIKNV
FT                   TKTEESNHMVLRINFQSPGQIAGKKEDMPFEDPDANFIRSVSFRSQDQRHMLKVYEAIT
FT                   ALKKAAVKRETERKELADVIEQEKLIEVKGRHPYVLKNVFPRPGPEGKKTDGNVEIHQN
FT                   GIRFRPDGPASKIDILFSNIKHLFFQPSEKELIVIIHVHLKAPIMLGKKKTSDVQFYRE
FT                   VADMSFDETGGKKRRARYGDEDEIEQEQEDRKRRAELDKLFHDFARRIETAAQAQQFEL
FT                   EVDVPFRELGFNGVPHKSIVALLPTTNCLIHISELPFTVITLSEVEIVHLERVQFGLKN
FT                   FDMVFVLQDLKKPPVHINSIPVAHLDNVKEWLDSCDVPISEGPVNLSWPAIMKTVNEDP
FT                   HAFYAEGGWNFLTGSGSDDGSEESEEGSEFEGDSDVFDESSGSDEDSESAFEGDSDSAS
FT                   AESLSDEGEDWDELERKAKRADEKHRTDRGGDSDDDGKKKKKGSRR"
FT   CDS_pept        join(663989..664015,664070..664124,664186..664439,
FT                   664493..664904,664964..665760,665814..666080,6
FT                   66136..666246)
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789014"
FT                   /locus_tag="CNC02320"
FT                   /product="Heat shock protein 70, putative "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /protein_id="AAW42202.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000042EB24"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP4"
FT                   /transl_table=1
FT                   /translation="MVKAVGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFNDS
FT                   ERLIGDAAKNQVAMNPYNTVFDAKRLIGRKFEDAEVQADMKHWPFKVIDRAGKPAIQVE
FT                   YRGEEKVFTPEEISSMVLIKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAGAIA
FT                   GLDVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAG
FT                   DTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAAQTSIE
FT                   IDSLFDGIDFYTSITRARFEELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVLVGGSTR
FT                   IPKIQKLVSDMFSGREPNRSINPDEAVAYGAAVQAAILTGDTSEATQDLLLLDVAPLSM
FT                   GIETAGGIMTPLIKRNTTVPTKKSEVFSTYSDNQPGVLIQVFEGERAKTKDCNLLGKFD
FT                   LSGIPPAPRGVPQIEVSFDVDANGILNVNAADKSTGKSSKITITNDKGRLSKEEIERML
FT                   AEAEKFKAEDEAAAATVQAKNGLESYSYSLKTTLSDNQDKFDAADHETLSKKVDEVISS
FT                   LDTMQSASKEEFESLQKELEAVANPIMTKFYGAQGGAPGGAPGGFPGAGGAPAQEEGPS
FT                   VEEVD"
FT   CDS_pept        join(666537..666566,666615..667070,667120..667189,
FT                   667256..667461,667517..667583,667723..668294)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636338"
FT                   /locus_tag="CNC02330"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42205.1"
FT                   /db_xref="HOGENOM:HBG067620"
FT                   /db_xref="HOGENOM:HBG175980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI00004B441D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP3"
FT                   /transl_table=1
FT                   /translation="MFTNLSPEDKDAFFSLLDEYFASRPHNLPSPPAIDSSSHPARSNA
FT                   ALSPSPSAGYASPSYSSARHPMPPPERTEQPDSAQRFISSSIKYGTAGTKSSMNAVSKN
FT                   KDAMDLLGKVGMSSMVGRANERMNKPAEAGVKEEAGRKAAPPPIAAKKGGVSGLVSSRS
FT                   FGHVDTSNKMSAFTSMWRDPQKSKPPAVEQTISPTLSYSNTALPPPIRRDGSGSYQSSS
FT                   PNPASSAAAEVGPELANGDEGQAQALYDYTGNDKGDLSVQANQVVNIIEKTSSDYSDRS
FT                   NLPSCRCCHRHQFTLLVSPRSGPAIRGVYCKLYAMLLKLSSLPGLMTPFILIDIPSRKK
FT                   GTSLPLLLHQAQNRHISSSPMMMRIWQTSCRSPTLSPLRSLRSSQVKLPQVPPDLHVLH
FT                   NPYINFTSCDPSTGCQVSNGNRISSMRFQLAMTWKASLMRKSSPQQPTTMMNGLVLTCR
FT                   VSLIPVED"
FT   CDS_pept        join(668793..669002,669049..669480,669537..670461,
FT                   670511..671188,671247..671396,671447..672267,
FT                   672320..672436,672493..673047)
FT                   /codon_start=1
FT                   /gene_family="HOG000201240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805543"
FT                   /locus_tag="CNC02340"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW42668.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG175981"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00004B441E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP2"
FT                   /transl_table=1
FT                   /translation="MAGPPVRQRYNAKARGSVAGGSSHKKRKNLSKERTEEDAQDNETD
FT                   QHAAVFEDPTAGMSSKKRKRFESYMHSTQAKKLKSEQRLETFKLLQSLAPSSSTSASLL
FT                   SASTLGQNPMNPTSAKERQEKREDRLVRRGIDRLSRRFGEGDDHSGESENDASSRKGKG
FT                   KAKEVTVEVIRDGQAEETEEVKTTVIPSKGERKAEIKAAEKGKGKGKLPKKAGWNPNLL
FT                   STQAPNSSSSEFDSSDSGNDNSDDEEPKKAAEPSPRLEVGPEPVSETIKPPVSAPSAPT
FT                   VLGGALKKSTDGQVVKPRVEVRRKKGFVYGMFGRRGIEHREDSDDEDEDDEDEDDADDD
FT                   DEEEEDDDEMDSDEEASDEEDGEDSEEEGSEEDEEEEVAPPKKKRSLGFKDWALKQMGQ
FT                   TSQPSAPDLLAAEPTTTLYKSQPLLAARVGEYIGPLGQELVIPTTSLLDQSKDSDKSKV
FT                   RPNISRRPSVSETRMGLPILAEEQSIIESILMHPVVIICGETGSGKTTQVPQMLYEAGF
FT                   GYKGSDNPGMVAVTQPRRVAAVSLAERVRSELNLPPNSSLVAHQIRYSSTTSPDTAIKF
FT                   MTDGVLLRELASDFLLSRYSVVVVDEAHERGVNTDVLVGVLSRVAKLREKLWREGKQDV
FT                   KPLRIVVMSATLRVSDFAENPTLFSKPPPVIHIAARQHPVTVHFSRRTVSDYVTEAYKK
FT                   VSKIHARLPPGGILVFMTGQGEIQALCRKLEKKYGAKKSSQKTQVINDNSLPPEEREAE
FT                   EVEFGKDEDLAADVDDGAAESDPEALDTDDEIEGIPGLEFDEPADAPLHVLPLYSLLPN
FT                   DQQMLVFKPPPEGHRLVIISTNVAETSLTIPGIRYVVDSGRAKERHYDPINGVQSFQVS
FT                   WISKASASQRAGRAGRTGPGHCYRLYSSALFEDHFEQFSKPEILRMPIEGVVLQMKSMN
FT                   IDAVINFPFPTPPDRAALRRAENLLTNLGALSLPTLTKMINGVQHKGSGGGQITDLGKA
FT                   MAGFPVSPRFAKMLAIGTQHDCMSYIIAIVAGMSVGDPFIHEQSLEVDEEEDKVAEISH
FT                   IKSEDIREKEQRKETRRRFFKAQQQFLALGQGTSDMFKLLAAIGAYEFDPSPAFCAKTF
FT                   IRLKAMQEIHQLRAQISSIAKVPLSKLLPPSDTQLKVLRQILAAGFIDQVAVREDLVLK
FT                   KGVSYESTRGVAYRAVGLGSEPVFIHPSSALFHCAPPDFVVFSEIVRTSKPWMKGVTKI
FT                   NPIWLPSLGKGLCTFSKPMEMPTKGFARKSGLKDDEREVFVTPHFKDLGIDLPVMKKKQ
FT                   RREGTRWILVD"
FT   CDS_pept        join(complement(674494..675000),complement(674289..674443),
FT                   complement(674117..674238),complement(673902..674026),
FT                   complement(673456..673848),complement(673333..673398),
FT                   complement(673131..673292))
FT                   /codon_start=1
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806557"
FT                   /locus_tag="CNC02350"
FT                   /product="MAP kinase kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW42207.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00004B441F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP1"
FT                   /transl_table=1
FT                   /translation="MHPQNSSTPSTNSPSTFSLPKSSISRKKPPGLDISKSILRPTRTA
FT                   PVLPANGSSPSNFVSEADRLRDDIANLQLSSRSTGSNHSPEALDSPRAFQSDSSVASGL
FT                   AKKEKSRDGKERGDKEKRKKKHKDKDGEDLVKDEDLEILHDLGAGNGGTVTKVWNKKRK
FT                   CVMARKLILVDAKPSIRKQILRELQIMNDCDSPYIVGYYGCFPVDVHVGIVMEFMDAGS
FT                   LDYIYRHHGAIDIDIVGKVAQAVLEGLIYLYDKHRIIHRDIKPSNVLANTRGEIKICDF
FT                   GVSGELINSIANTFVGTSTYMSPERIQGAPYTIKSDIWSLGISLIELAVGRFPFSDSPD
FT                   SEELSPSVSDFDPDPTLPRSVRRPKIESNSRHNGVSQSGGPHAMSILDLLQHIVNEPAP
FT                   RLASRRRRFPQEAVAFVEGCLIKDPDQRRSPKELLSSSWITNLKTTKEDLQTWAQSMII
FT                   FRLRIFFNVDTLLCISLITISHIPVHHMPCVYLLLMTISSADEEMMHVWLM"
FT   CDS_pept        join(complement(678778..678873),complement(678596..678730),
FT                   complement(676743..678542))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806558"
FT                   /locus_tag="CNC02360"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="AAW42209.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG067619"
FT                   /db_xref="HOGENOM:HBG175982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI00004B4420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKP0"
FT                   /transl_table=1
FT                   /translation="MNNQQLVQQHYDIALKFMQAANYLDAWKNFDKAINFGGKNPVLLD
FT                   CKAAAMSKLPEWRNHALEVTKDMIAKWPKDFRGYYRQASVLYAMKAYDHAFKVISKAVD
FT                   IGPTRSQDERKYKAIQQLRATIIIQKTEADRLRAANDETEAQRQAIARQAAKKARINYT
FT                   HLLSRDILLIIAEQGMADHPGFIFRMAGVCKSWRETLLSQPSLWDTIVLGRKRKDQKVT
FT                   LFIERSRGRIKEVKIACHLDQFLAGKIGLSLAPYMPNVERLTVHAPYRINLNLLTQWRG
FT                   LLRNVEYLSLSHDDGGATLRKNFTHDLLPPGPSRLRHLAIANFQTGPESDSTYTPLKQV
FT                   ETVSIRSTDLFLPLDSAEETLLSTFPAATSIELINNRYFDSSRGALPIVAELPNLRSYT
FT                   NNKASSNVFKTIRVPSLQDLSVDSLRASSLKTWLSAPGLATCLTTLRSLSISCTSFTDT
FT                   DVLSALAFLPGLQFLNVSACPLTNTFLEGLVRRPADSDQENLCPKLTALSISINDNITG
FT                   GPLTRFVRSRVASSAGLASSSSDLDLNTQAQGKSTQTELKKNMSSSFRPSARSAFGRPT
FT                   KPPSVRTDSDQSISSTLPQSQTCAPSQPSSSSSSTLPEITWLNLFHCGGIDPSAISYIR
FT                   QYVKFVGHSLAAHGGDRNEGKGRWKWNVEWKDVVEGRAGLD"
FT   CDS_pept        join(679108..679110,679154..679371,679415..679712,
FT                   679761..680702,680756..681007,681087..681216,6
FT                   81306..681544)
FT                   /codon_start=1
FT                   /gene_family="HOG000008139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789269"
FT                   /gene_name="NPL4"
FT                   /locus_tag="CNC02370"
FT                   /product="Nuclear protein localization protein 4 "
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="perinuclear region of cytoplasm "
FT                   /protein_id="AAW42211.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0048471"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051418"
FT                   /db_xref="HOGENOM:HBG330015"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007716"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR016563"
FT                   /db_xref="UniParc:UPI00004B4421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKN9"
FT                   /transl_table=1
FT                   /translation="MLLRIRSPAGTARLTVQPETTGEDFAEAILNTIPAADPQPDPATL
FT                   ALSNQPGAAGESVPFHALSGRTVGDMGFSHGDLLFLSYKPRAADPDSHPAMQATAPHPQ
FT                   PAQPDPSHPKTHTDPPMPNTIPLRDLSSVQEPEIDQYWEKQTGKIERKRDPAFCRHGDK
FT                   AMCDYCMPLEPYDPKFQSEHQIKHLSYHAYLRKLLSSRPPTASSATDLPPLSPTSLSVI
FT                   TPCPTGAHPSFPDGICSTCQPSAVTLQSQPFRMVDHIEFASPSIIEGLLSAWRRTGTQR
FT                   IAFLIGREDKYEKVPMGIKVIVEAVWEPKQEGELDGLTVETPWSDESRVQEIAKWCDKG
FT                   LSVVGMIYTDLTPSPDDITKTLYKRHAQSYTASSLEMLLSAAYQLSHPLSTRMSPTGHY
FT                   SSRFVTCCLTGDKDGGVDILAWQASEHAEAMVKAGIVEASVDPAVVRVRKPGEGEYVPE
FT                   VFYSYKNEYGLQVKMPAKPTFPVEYLYVNITHGFPLAPSPLFLSNAFPTENRPGLHDQS
FT                   MQVVITQLAAILKTSDAEIGDAGTWPGRIKKDVEKWLSDWHLVTFLCMQGLFSLKEQQI
FT                   LCRAATAHAHPNDTHALEELFASGGWQTLLTIVDSEASANARSNPPPTSSFNNLGIDSP
FT                   AFAGPSTESSAPPSGPDSVGAGAGAGAGGGRERVCPHCTFVNEHGGSDCEICGLPLDG"
FT   CDS_pept        join(complement(683709..683724),complement(683585..683668),
FT                   complement(683470..683538),complement(683289..683418),
FT                   complement(683150..683236),complement(682939..683076),
FT                   complement(681886..682885))
FT                   /codon_start=1
FT                   /gene_family="HOG000177308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806559"
FT                   /locus_tag="CNC02380"
FT                   /product="Nuclear matrix protein NMP200, putative "
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="AAW42213.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG022238"
FT                   /db_xref="HOGENOM:HBG315290"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00004B4422"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN8"
FT                   /transl_table=1
FT                   /translation="MFFCAISGSPPTVPVVSKTSGAVYEKALIERYIEENGTDPISGEA
FT                   LTKDDLVDVKAKPSTIPPRPANQTSIPALLTALQSEYDSIMLESLEIKKAFQSSRQELA
FT                   NALYREDAATRVIARLMKERDEARQALSSIQSTIGFQPPAAAEEPAADVEMAQEGALPA
FT                   DVEAKVMETNQALSSVRKKRKPAPGYKKVDDIKSYTQINHVPSLHATKPAGITALDLAQ
FT                   DGNTVVTGGADKAVQVFDLEASKVLGTLKGHTKAVTHVAFREHEGEPRLAISASADKTV
FT                   RVWGEDDGKWGARATLSGHKGEINGLAVHPSGSYVAAGSADSTWSLYDLSTAKEVTKYT
FT                   AIPGIDGSFAYTSFAVHPDGVLHGGGTKDGAVRVWDARQSNSLAATLSSHAKDLSTLSF
FT                   SENGYYLATSSISGPPTVKIFDLRKLDILSSWTLPEENTIREVKFDPSAQFLSVVGTDA
FT                   RVYANKTWQELVTFEENAGDLVGARFGKLGSEIVLAGMDRTLRVLGKKE"
FT   CDS_pept        join(683911..683949,683998..684046,684097..685248,
FT                   685318..685763,685829..685931,686015..686307,
FT                   686381..686890,686978..687313,687369..687555,6
FT                   87621..687733)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093365"
FT                   /locus_tag="CNC02390"
FT                   /product="Pre-mRNA splicing factor, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW42215.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00004B4423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN7"
FT                   /transl_table=1
FT                   /translation="MDLKNFISDNVVRILGSSDSATVDYVQSLAISSKTPGDLYNSLLS
FT                   TGMASTPETQAFAAQVHSLVPRKNKTKAPKADKAASGQRFTLLMDEDAESSGSRKEKKK
FT                   KKEKEKEKEGSRERDVVGVKKARHSRKRDTEGNWDSDEEDKEIKRLRTRSPLPDGDDQA
FT                   ELPLEPEETEEERLERERLEDLRQRDEFAERMKEKDRDRTKRIVEDRTSKALGGVDASR
FT                   RANLMDDPAAREAAIADLRNRSRQEYLSKRELQQLDLLKMEVEDEKILFRNQKLSRKEE
FT                   RELERKKELIKLMEERKKIDDGTNGYMLPDDYITEQGRLDQKKKKDALYKRYEESKPVE
FT                   GQFVTDVDQWEAAQQERTDLTTGALDKEILVEDYDYVFDESQEIKFLKEGKMDGTLTAE
FT                   AQALLDQVDKLEKNAQSIQETRNSLPIYEFRDELLEAIAEHQVLVVVAETGSGKTTQLP
FT                   QYLYEAGYCKNGMKVGCTQPRRVAAMSVAARVAEEMGVRLGQEVGYSIRFEDMTSDKTA
FT                   LKYMTDGMLLREFLTDPELSTYSALVIDEAHERTLSTDILFGLVKDIARFRPDLRLLIS
FT                   SATLNAQKFADFFDQAPIFDVPGRRFPVDMFYTQQPEANYMHAAVTTILQIHTTQPKGD
FT                   ILLFLTGQDEIEAAEESLKETMYALGDKVPELIIAPIYANLPSEMQSKIFEPTPEGARK
FT                   VVLATNIAETSITIDGVVYVIDPGFVKQNNYNPKTGMSSLVVEPISRASAQQRAGRAGR
FT                   VGPGKAFRLYTKWAFKNELLQDTIPEIQRTNLSMVVLMLKSLGINDVLNFDFLDKPPAD
FT                   TIIRSFELLYALGALNHKGELTRLGRRMAEFPVDPMLSKAIINSENYKCTHEVLTIISM
FT                   LQESGSLLYRPKDKRVHADKAHKNFIKSGGDHFTLLNIFEQWAESNYSQQFCYENFVQF
FT                   KSLCRVRDIRDQLAQLCDRVEVVIESTPNDVVPVQKAITAGYFYNTARIDRGGGYRTTK
FT                   NNHSVYLHPSSCLIGMQPPPRFILYYELVLTSKEYMRQCMPIEGSWLSELAPHYFNKSE
FT                   IDQLMGSASKVKMPKRIEPPKVGPVNS"
FT   CDS_pept        join(complement(688254..688326),complement(688105..688189),
FT                   complement(687994..688045))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942379"
FT                   /locus_tag="CNC02400"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42217.1"
FT                   /db_xref="HOGENOM:HBG175983"
FT                   /db_xref="HOGENOM:HBG736897"
FT                   /db_xref="UniParc:UPI00004B4424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN6"
FT                   /transl_table=1
FT                   /translation="MAEQTQGQPGGTGIAGSTGQQDYLDKGVDTALNKAGHGQSHSTTE
FT                   KISDGIRNVFKKATGKDVPIKDKQ"
FT   CDS_pept        join(690116..690331,690386..690463,690514..690804,
FT                   690859..691158,691228..691374)
FT                   /codon_start=1
FT                   /gene_family="HOG000162289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806560"
FT                   /locus_tag="CNC02410"
FT                   /product="C-4 methyl sterol oxidase, putative "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42219.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG069422"
FT                   /db_xref="HOGENOM:HBG325679"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI00004301CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN5"
FT                   /transl_table=1
FT                   /translation="MAAAAAFDLLDKYIPGASDSLTIVNATTAQNTLYPGVDFAALNWL
FT                   ERLWASYYVWVGNPIIATGLMSFLLHEIVYFGRCIPWLIIDAMPYFQKWKLQPNKHVSR
FT                   AQILKCTKVVLLTHFTCEAPLILAFHPICCLFGMKTYEIPFSSIGLMAAQIAFFFVFED
FT                   TFHYWAHRALHYGPLYKHIHKLHHEFSAPIGIAAEYAHPLEVLILAQGTISGPFLYAVF
FT                   RNDLHILTVYVWITLRLWQAVDAHSGYDFPWSLRHFLPFWAGADHHDFHHATFTSCFST
FT                   SFRWWDYYFGTDVKYHAYKARVAAAGVKERAAVEKREMEKLEKEGIIEERAAASHSKRG
FT                   KKE"
FT   CDS_pept        join(complement(693701..695002),complement(692203..693645),
FT                   complement(692091..692138))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636602"
FT                   /locus_tag="CNC02420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42221.1"
FT                   /db_xref="HOGENOM:HBG067618"
FT                   /db_xref="HOGENOM:HBG175984"
FT                   /db_xref="UniParc:UPI00004B4425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN4"
FT                   /transl_table=1
FT                   /translation="MWVFTTYFAGGGKRTTTDFLAHSMEHPPLPLDVLSNVAALIPPPY
FT                   YPWPHPAAQTTATTPAPDVIRNLDPAPAPLQTDLQAISAITRASSRLLEAARPWLWEDV
FT                   DVKTGRGWLAIVNALTEEVIEQDVESLTPIAGSAPASDGTGSGRATPVPPQEPPRQPGT
FT                   IPQATHAYTSSSSSALPFPIASGPGHVASGSSAYPQMSTSPPQPTHIHQLLTPPTSRNT
FT                   SPRARTSPALPPILTNPQPRAEQSPSPGPPAPPGPSAPPGPPGPSTGPGPSNGVSPSAV
FT                   ARTKLRGRSRSPRRSVGFDTEGIQAVLERSRSASSHRSNGPSGSVRGAFMHRRTSLSRS
FT                   RTWHDGPRDEEEDEDEDEVMPLTGPPARYKAGVITPRLLPAERETANADLLPPPGPYIR
FT                   HLNFTNFRTIGSRRSQEEAVRGRFVTAGRLEGVIKNAPNLVSLCMTEYVDSSLSYPVIE
FT                   EIFFRGSRRPRYRSPSLTRTRSLSIGQPPSVTSTAHDQLDPPRPEYVPYEDETEDQKWN
FT                   RRAMFTPLEALDLTGCVSQAFTEAMQKFYNTWLAPDDETEDEEEERGRGRWRGRGKRAH
FT                   SPDATEDDSDTHSHSVSRDRQSHRRPPRFRAMRRLCLRMCTSLDSQIIASLVWSFPCLT
FT                   HLDLSNTRVPDELLNYLTDYCPRAFRLTSLSLARCPRLNSYAVVDFLCRSPAVRDLVDL
FT                   NLYVNPTQGKAIESDALMRLITEAPCMRSGRLRYLDLSSAKFTPAHLAADVFPPQASLI
FT                   SLGLSHIPTLGLTPIADFLLSVAFNVEILTLVGTATTSSLDPSRSPLQITLELHSRLIN
FT                   PLTTIPFSLSSLYLSPGSGTPANLNPGPTRLRVIELIGPVRRSIAPDGNGEWKVVKSKG
FT                   SRGWYVDQSAGWRRVQPPLSPSPLSPASESGAMDEGDTEAQWEFEESEVTLGGIRGKWK
FT                   "
FT   CDS_pept        join(695158..695361,695413..695807,695871..695904,
FT                   695962..696087,696144..696299,696383..697704,
FT                   697811..697897,697952..697985)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806561"
FT                   /locus_tag="CNC02430"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW42223.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067617"
FT                   /db_xref="HOGENOM:HBG175986"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00004B4426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN3"
FT                   /transl_table=1
FT                   /translation="MPLLAQLGNRASLLLHRLVYAFPAAPPPSHSPTPASDASPNFDPA
FT                   PAPEPTPALSFVGSGYGVTLILMGILLNRIHHTVRRPRQPPPDDHPRPINPSYFYRLRA
FT                   SVSDFFTSPDAARYIRLPGIVCLLRAWILFTVLLIQVIGLWPEFQHDRTTAMWRRATSR
FT                   LGNWAGEMEMNDICWQVFVSVCVGLLCSGIANGLDTIRRRDVAASFNLTGYSFMMHLYS
FT                   SPLTHQHTERAVAHGRPDAHALFQLWLSLTELTWLQILELSLTLRDNVLLPTSVCGIVG
FT                   VVHFAYVLFSSPLRFPSFTFLTHMLALFLSVVILSTVILRAITFIFSYGYIPSLTSLLP
FT                   HEGVIPDRRDDFGVTLLKIGTACIEATSLSGLRNELANIDKPEAPWVEITSDGSEFHHG
FT                   LLQHSPTPGFCTEISNIKVSEAEDSERLNPQWREVRAFARALFTAILSALIRFIMSTRV
FT                   GRSMFRLGAKIWRARWWYGPRSWKFWRRDAWREPPENIRARERARLRARASAIIEQISG
FT                   SGESSHQLAHTANLHRTGYTRGTSTSVSLRDHGGSTATIQRNRQPRREMWTYADYLLKD
FT                   VDGEIEDDEEWIQEMSDDSDSEQMSIADANEEEEEEEDLFDEGMDVEEEEMKQRGMLYG
FT                   DLVSQTTESDGRQSSDDFQPVLLAHLTSRTAAPLTRQRYTSLMTLYSSDSLHTPALPSL
FT                   VSMHNENVLGLRDVMHERRQAMKGYEEEDEETKRTCVVCMVSMRDTILWPCRCLAVCND
FT                   CRESLAARLPAQNHMCPCCRKKVEGYSRIYIP"
FT   CDS_pept        join(complement(699931..699956),complement(699854..699866),
FT                   complement(699748..699799),complement(699585..699666),
FT                   complement(699266..699532),complement(699095..699212),
FT                   complement(698850..699045),complement(698541..698800),
FT                   complement(698425..698493),complement(698315..698374))
FT                   /codon_start=1
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806562"
FT                   /locus_tag="CNC02440"
FT                   /product="Cytokinesis-related protein, putative "
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="AAW42225.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00004B4427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN2"
FT                   /transl_table=1
FT                   /translation="MSDGIGIANLPNQRHKITSQRGAHFTIMVVGQSGLGKTTLINTLF
FT                   ATEICSPRNYRQRFAKQLDKTTEVEILKADLEERGFNIKLTVIDTPGFGDYVNNRDSWG
FT                   PIVDFIDDQHESYMRQEQQPFRKEKQDLRIHACLYFIKPTGTTLKPLDVEIMKKLGTRV
FT                   NLIPVIAKADTMTPEDLHNFKTIVRETVIAQNISVYTPPVDLDDEAAAEHARAMQAVMP
FT                   FSIIGSTQDVTTPDGRVVKGREYLWGVAEVENEDHCDFKKLRSLLIRTYMLDLITSTEE
FT                   KHYEAYRLAQMETRKFGEPKVKKLDNPKYREEEETLRKRFTEQVKLEEARFRQWEQHLI
FT                   AERDRLNKDLEQAHSAIKALEAELDQVAAYHRQGGTVGRR"
FT   CDS_pept        join(complement(703166..703247),complement(703036..703105),
FT                   complement(702906..702971),complement(702679..702853),
FT                   complement(702514..702626),complement(702364..702448),
FT                   complement(702221..702317),complement(701830..702155),
FT                   complement(701670..701771))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093366"
FT                   /locus_tag="CNC02450"
FT                   /product="Water channel, putative "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42227.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG175987"
FT                   /db_xref="HOGENOM:HBG705794"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI00004B4428"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN1"
FT                   /transl_table=1
FT                   /translation="MPDLVVTTQELRPSSPVYGHARTIIKNNFVAMAGEYVGTTLFMLC
FT                   CLGGTHVALLPEKSVTGDLSQPLNTSSLFYISLSIGLSLTVNVWIFFRVSGGLFNPAVS
FT                   LGMVLAGCLPPMKGALLTVAQVLGGITGAAIINVLLPGELNAGTTLGGGASIAQGLFIE
FT                   AILTALLMLTVFFTAAEKNEATFLSPLAIGMALFIAEMVGVPYSGGALNPVRSLGPAVV
FT                   THNFPGYHWIYWVGPALGSVLATCFYSLLKYLEYESVPGPGEAPHVPPFWRLPARGYLS
FT                   TLSHPFAKRASTGTYSHEDDPEKGLRSGKDSQANTDNPTRVNRRGSGDAEIQSPVEDTT
FT                   MANARLDRIEMLLTQLMQVRTSEGTQKSPAV"
FT   CDS_pept        join(704756..704855,704925..705031,705104..705142)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636603"
FT                   /locus_tag="CNC02460"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42229.1"
FT                   /db_xref="HOGENOM:HBG175988"
FT                   /db_xref="HOGENOM:HBG736897"
FT                   /db_xref="UniParc:UPI000042F783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKN0"
FT                   /transl_table=1
FT                   /translation="MDVNENIHATEQPDSAPSVNTRVQQVGTQQDTLDKGVAQVIKEFI
FT                   SPSQAQDPSVVEKASDAVRSGFKQSTGKDFPVQDKQ"
FT   CDS_pept        join(complement(707159..707438),complement(706862..707104),
FT                   complement(706662..706811),complement(706047..706609))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636604"
FT                   /locus_tag="CNC02470"
FT                   /product="Phosphatase, putative"
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42231.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG175989"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000042E795"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM9"
FT                   /transl_table=1
FT                   /translation="MSVFTKSAFTMSALPSPNTSQPPSAAPSRRGSFANGLASGQLTPV
FT                   TDPHIVSINVESVLFDMDGTLINSSPAVVKAWELFAEKYPLDLDDILRSAHGMRTIDVL
FT                   KKWCKITDPELLASEVIRFETAILNAAEDIAKNSGKAGIEVLPGVAKLLADLGEEADKR
FT                   DGEEKWAICTSSTYFYAGKAIPIAGLPTPKVFVTADSVTRGKPFPDPYLLGASGCNASP
FT                   FESLVVEDAPTGIRSGKASGALVLATCTSHEREELERERPDFLVDDLSHVKATWDAATN
FT                   TFNLIIEQPIDRYTPRPTPDVTPVITPAMSRSNSFSGVGQDRPSVRTSQAIMKGSDDLT
FT                   GNDSVVGSPAASRPGSPGADDSIEKRAEMEFHRRASQSGQAGVTLDAFRRALAGNAAKR
FT                   RAQSQGEMSQDE"
FT   CDS_pept        join(708508..708595,708659..708849,708938..709277,
FT                   709325..709607,709657..709936)
FT                   /codon_start=1
FT                   /gene_family="HOG000246855" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093367"
FT                   /locus_tag="CNC02480"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD+),
FT                   putative"
FT                   /function="NAD or NADH binding"
FT                   /function="glycerol-3-phosphate dehydrogenase [NAD+]
FT                   activity"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="glycerol-3-phosphate catabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="AAW42235.1"
FT                   /db_xref="GO:0004367"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0046168"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289569"
FT                   /db_xref="HOGENOM:HBG586392"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="UniParc:UPI000042C6DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM8"
FT                   /transl_table=1
FT                   /translation="MSAASTAPSSPEVVQQFSDLDIGSTVTTPAVTRPSSPSPPSLPPS
FT                   PLSSGKHKIAVIGSGSWGTALAKIAAENAWRRKEDFHSEVRMWVREKIVNGKPLTHVIN
FT                   KTHLNSRYLPDVVLPRNLVAVPHLKDVVKDATLIVFVVPHQFLHTVLNELARPGVLLRG
FT                   AKAVTAIKGVEVNGTDIQTFASLIEAKVGLPCSALSGANIALEVAMGQFCETTIGCPTP
FT                   DQSLLWHAVFNSPSFRVNTVEDVSGVSLAGALKNVVALAAGMVDGLGLGGNTKAAIMRI
FT                   GLKEMTQFCLEFFEGVRPETFSNESAGVADLTVTCFSGRNRKCAEEFVRSGQPFDVVEK
FT                   KLLNGQKLQGTATAEEVNAFLFARKRAHAYPLFEKVYKIAFEGMPPKNLVVGL"
FT   CDS_pept        join(complement(712365..712442),complement(711845..712296),
FT                   complement(711621..711791),complement(710861..711571),
FT                   complement(710567..710801))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806563"
FT                   /locus_tag="CNC02490"
FT                   /product="Regulation of translational termination-related
FT                   protein, putative"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW42631.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067615"
FT                   /db_xref="HOGENOM:HBG175990"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00004B4429"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM7"
FT                   /transl_table=1
FT                   /translation="MYHDMDHHEIRQQCESMQEDELTVLESIYPGQIKIHPNPNNRPGR
FT                   ILTLTLPVKLSSPTKVSISTASNNGESSIPSLTLSHLPALSLCVALPETYPLLVPPAPI
FT                   SLRAPLFKGHDDKLGSWLFQNDLREIESRLRRMWDDDKEAWDQGQGVLWRWWDWVVNGD
FT                   FLRETQRLIHDSLTLTVPPPLSPATFFTALKSYDSYQIQNEFEQTAFPCSICWENRKGG
FT                   RCVEMPGCGCVFCTECLGECWTLAISEGTLEAVACPSVACVKQRATNEKASRLDQGVTA
FT                   PLVEKVVGKELRERWEVFKDRRIVEIDPSFCICPQPKCQAAVPPPTPSGTCGNSSAPKA
FT                   IRLADLTKPSSGSLHVPADVPRGSGQSVPLTEDRWAAYRLCPKCNFSFCLYCSSTWHGP
FT                   HTVCSLPQASQLVLEYLKYPEGSEGRLAMERQRGKANLERMVSKWREDEMNTQWLHSRT
FT                   KACPSCSVRVEKSVGCNHMQCGRCSAHFCYLCGQSIKPTDPYKHFNTPGQPCYGKLFEA
FT                   MDFEDVLDPVLNLEQFTEDDLLDWDFGAARI"
FT   CDS_pept        join(713055..713073,713128..713241,713291..713377,
FT                   713426..713640,713694..713899,713950..714111,
FT                   714169..714368,714418..714505,714798..716045,
FT                   716097..716272,716325..716476,716536..716571,7
FT                   16628..716744)
FT                   /codon_start=1
FT                   /gene_family="HOG000165474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789270"
FT                   /locus_tag="CNC02500"
FT                   /product="ATPase, putative"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="AAW42236.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG052105"
FT                   /db_xref="HOGENOM:HBG067614"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR015434"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00004B442A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM6"
FT                   /transl_table=1
FT                   /translation="MIGGIKAIDTSLIHRIHSGQVVLDLQSAIKELLENSLDAGATAID
FT                   VRIKDNGLDSIEVVDNGSGIAEADWESIALRHHTSKLPSLEDLHKVTTFGFRGEALSAL
FT                   AALCDSITVVTATKETAPMGAVIKLGKDGRTIETSGRVARPRGTTVTLSGLFNPLPVRR
FT                   KEFERNAKKEVSKALVLLTAYALVPASASVQDARNGVRLKVELTAGGGRASKRSIHLMT
FT                   DGRGQLRSSVGAVWGPSALDNVEDINLRLEVEIDRVMARREGITERKQTVEVKGLISSA
FT                   QWGCGFSTSSRQFFYINGRPCNLTKVARAINEVYKSFNTNQLPLAILDFKIPTESVDIN
FT                   VSPDKRTIFVHSEDCLIDSLKVLMCSQTTGSIPSSPHEEQMKGSITSAATLTSSLCELN
FT                   EARLSSPSSQASLRQRSLSTSKPSLNPAQTVSAIQALNNCEAVSKDRMSKLRENSQGST
FT                   SQKATAKHESDDETQISVVEEQEVMEDMPEDANQDEGRNTEIVSPNHETPKISEGEAAV
FT                   EAIEIEDQTIETASGVQDHTIKHSTHANRPILEIESSTDENLLLSTRHSASAVWCGVDQ
FT                   QLSEQTSASPQHILSGSGRDLSIRTDPPPENRKIDFSTSCDPQRTSASSSSSPIVKPRV
FT                   SQRLKPDKAYRDEIISTAPQGEVIMRFDLSRLRKRFANAGNRQAGAQSKRVSQLVKQGD
FT                   LEEAAGIKNKDSELAEETLSRVISKADFEKMEVKGQFNKGFIIARLQSTDNGTDDLFII
FT                   DQHASDEKYNFETLQQTTKIKAQALIKPRALHLTAGDEIVAMENIDILNANGFDVHVDE
FT                   SKPAGKGERISLLAMPVSKETVFDFKDLEQLLHLLSDDSRPSGQMVRCMKARAMFASRA
FT                   CRKSVMIGKTLTKGQMSQLLRNMGTIDQPWNCPHGRPTMRHLTKLNPAPESSKIKGRFD
FT                   WTRWKEALA"
FT   CDS_pept        join(717880..718358,718413..718625,718675..719202,
FT                   719256..720173,720224..720545)
FT                   /codon_start=1
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942380"
FT                   /locus_tag="CNC02510"
FT                   /product="Beta-glucosidase, putative "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAW42237.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG390192"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00004B442B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM5"
FT                   /transl_table=1
FT                   /translation="MLALPVTLLWLSTGFPLLTYASPVTSDADNHTISATEANSSSSTS
FT                   FLPHNTSRHHESSSQSPITYISPQIAAPINATYVNPSHKWEKAYRKAKKYLDDWTLEEK
FT                   VQLTTGVGWENGRCVGNIGAIPSRNFSGLCLQDSPLGVRLADFVSAFPAGINAAATFDK
FT                   DLIYARGYALGQEFKGKGVHVALGPMTNMGRVAAGGRNWEGFGGDPYLSGWATEMTVRG
FT                   IQDAGVQACVKHYVGNEQERNRTTESSNIDDRTLREIYTHPFLRAVQADVASVMCSYNL
FT                   INGSWACENPKTLNGVLKTDFGFQGYVLSDWGAQHSGVVSANNGLDMSMPGDIVLGSLT
FT                   SYWGSNLTESVKNGSVSEERLDDMAERIMAAYFLVDQDKDYPEVNFDSFRLSGSNNSHV
FT                   DVRGDHWKIIRQMGAASTVLLKNVDHALPLRKPRSMTLIGSDLGPSLRGPNGFSDRGGL
FT                   SGTLAMGWGSGTAEFPYLVDPLSSISLQAREDGTILNWWLDDWNLSNASYWASVAEVAI
FT                   VGINSDSGEGYITVDDNEGDRNNLTAWNNGDELVKAVASANNNTIVIVHSVGPMIIEDW
FT                   IDHPNITAVLWAGLPGQESGNSLVDVLYGAYNPSARLPYTIAKKREDYSADIDYVTSDI
FT                   PAITQVNYTEGLFIDYRHFLAKDITPRYEFGFGMSYTSFEFGDVSLEEIKEEGAGDDIY
FT                   NFQEVDDGTVKAGRFLLDYLHKAQWTVTIDITNTGGVNGCEVPQLYLAYPADSGEPPKV
FT                   MRDFARINLDPGASQTVTFNLSRYDVSIWDVESQKWTIPDGTFVVEVGKSSMDKDAKTA
FT                   SFCPGSC"
FT   CDS_pept        join(complement(724691..724772),complement(724383..724636),
FT                   complement(723912..724323),complement(723057..723853),
FT                   complement(722730..722996),complement(722546..722668))
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942381"
FT                   /locus_tag="CNC02520"
FT                   /product="Chaperone, putative"
FT                   /function="ATP binding"
FT                   /protein_id="AAW42238.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00004B442C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM4"
FT                   /transl_table=1
FT                   /translation="MTKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFNDS
FT                   ERLIGDAAKNQVAMNPYNTVFDAKRLIGRKFNDAEVQADMKHWPFKVVEKGGKPVIKVE
FT                   YKGEEKTFTPEEISSMVLTKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAGAIA
FT                   GLDVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAG
FT                   DTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAAQTSIE
FT                   IDSLFDGIDFYTSITRARFEELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVLVGGSTR
FT                   IPKIQKLVSDMFSGREPNRSINPDEAVAYGAAVQAAILTGDTSEATQDLLLLDVAPLSM
FT                   GIETAGGIMTPLIKRNTTVPTKKSEVFSTYSDNQPGVLIQVFEGERAKTKDCNLLGKFE
FT                   LSGIPPAPRGVPQIEVSFDIDANGILNVNAADKSTGKTSKITITNDKGRLSKEEIERML
FT                   AEAERFKAEDEAAAATVQAKNGLESYAYSLKTTLSDNKDKFDSADHETLSKKVEEVINA
FT                   LDTMQSASKEEFESLQKELEGIANPIMTKFYGASGGMPGGAGAPGGFPGGGAGGGAAQE
FT                   EGPSVEEVD"
FT   CDS_pept        join(727267..727434,727490..727511,727572..727652,
FT                   727712..727725,727807..727854)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806564"
FT                   /locus_tag="CNC02530"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42239.1"
FT                   /db_xref="HOGENOM:HBG067612"
FT                   /db_xref="HOGENOM:HBG175992"
FT                   /db_xref="UniParc:UPI00004B442D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM3"
FT                   /transl_table=1
FT                   /translation="MYTTAFLRSTVTGLRPALHRPASVVDSSQTLLTSSRLGRVAKRFN
FT                   SSGPRTDKPKLVFRFGLRDIPVELYPILFVTGAACVGGGVALGRQLYLGDLRFKPTGPA
FT                   SAQGQQ"
FT   CDS_pept        join(complement(729638..729665),complement(729483..729524),
FT                   complement(729413..729429),complement(729250..729353),
FT                   complement(729135..729202),complement(728816..729080),
FT                   complement(728704..728761),complement(728572..728650),
FT                   complement(728472..728517),complement(728311..728423),
FT                   complement(728205..728260))
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806565"
FT                   /locus_tag="CNC02540"
FT                   /product="Organic acid transporter, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAW42240.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000042C6D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM2"
FT                   /transl_table=1
FT                   /translation="MSTELKTPLPLPFIYTFASGAIAGCTELLLLYPLDVVKTRQQLDT
FT                   GKQGANMVQVFKNIVAQEGPRRLYRGILPPLMLEAPKRAVKFAANGSWGAFFTNNGQRK
FT                   NTQAIAILTGCFAGATESVVVTPFELVKIRMQDKSSTFKGPMDVVKQALAKSGPLGLYQ
FT                   GMESTFWRHWWWNGGYFGAIFAVRNLLPKATSKKQELSNNLIAGTVGGFIGTSLNTPFD
FT                   VVKSRIQLHGTGEWAYPALLKVAKQEGMAGLYKGFAPKVLRLAPGGGVLLLVVEALSTV
FT                   FRNYLGPPYV"
FT   CDS_pept        join(730215..730272,730326..730429,730486..730549,
FT                   730605..730732,730807..731253)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942382"
FT                   /locus_tag="CNC02550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42241.1"
FT                   /db_xref="HOGENOM:HBG175993"
FT                   /db_xref="UniParc:UPI000042E2A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM1"
FT                   /transl_table=1
FT                   /translation="MGIFGTSDPVKQTEKALAKEAKAEEKNIKQNVKSLSHAEKAESKA
FT                   AKAEQKAEKHHLKASKFEEKTAGVLNKATNKHEEAYHKENVAASEVVQKQHAHGTLSNA
FT                   VEQKKAQLEALQKKHEVNEQSRESKLHEVSGPAASNDNKVGAASQHHPSSQAGSQPAGT
FT                   TVGGQNSGAGAPATSGAGGNVGTADYQQQGNGAGGAFSQSQQGVPAGNLAAQSDSYGAA
FT                   QGVTSQGNASQSTANANRGYGGITAGDNQRMGQEEKVTEAVRRM"
FT   CDS_pept        join(complement(735225..735246),complement(734999..735168),
FT                   complement(734914..734943),complement(734338..734850),
FT                   complement(734137..734289),complement(733849..733971),
FT                   complement(733714..733795),complement(733554..733674),
FT                   complement(733231..733504),complement(733012..733179),
FT                   complement(732723..732961),complement(732455..732673),
FT                   complement(732095..732404))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942383"
FT                   /locus_tag="CNC02560"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42242.1"
FT                   /db_xref="HOGENOM:HBG067611"
FT                   /db_xref="HOGENOM:HBG175994"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniParc:UPI00004B442E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKM0"
FT                   /transl_table=1
FT                   /translation="MPTDIFLDHKPFLSDSFDVHSYTNAILQGRQYTPDQSQQNNNKED
FT                   NDKADLDVGAELARLNYGIEDVTKQLRQEITASHLLLLNHLTTSLSLSSHLSPIRSSLI
FT                   SLSASIDRLHSKIHTPYTNLSTLVRRQQNLRQIKDIARRASRFVIVARRLENQLERMGN
FT                   APEEDGEKGKTERRAELAKAALSCAELDSLLRDESNERGDDTTSIALLDIDFVKAYSPL
FT                   ISRARDTVIEEMETMVFAGLQELNQTVLSSALQTAHNLRLLPDLVSNLLDDLNDAVTLR
FT                   VTKAFDVTAIGKEVARLERVIDDVANCCIKVYTLEKVLRIKRDTLTQVEFFDEVMKRLD
FT                   EKPSFTYWTTLAKAFETQTKEAAKTSSWLQQALSVGYPRLLRLFHDFFSRIAVHTDTVY
FT                   TQEHQSPEAVLVLRSISSFETLYLTRSTNRMSDVVASAVEQYLSARGNPPGPSDGVSIA
FT                   RTVINELDSARFDPLLVRTVARNAAKILDGFIQTVDGMLIEDFTATSLIGPNATSAQQV
FT                   NAQLVGCLYHCWLNLAYVEHDLTGKVWDILSPSVNSLETTYRRITKSLDAAFRKEITST
FT                   LSRIHRVNFDTPVDPLAMGMDARGGSPYMQDLVDKIGFVRNQILGRMSLGEYMKAWVLD
FT                   LSKFIVRTFLLHASIARPMGESGALKLTGDMTELEMGVTNLLSTGKVQGAKDSVKVEQV
FT                   GDDYFALRTFRTLLFANLESLVNPVETVHIPPLIVLHHIIVRSPLRLPHEVHGWSESEY
FT                   VLWIDKHKDAKEQWELVEKTVEDQDVTNSEEETKVDIYVKLIKEVLAHARHDEQ"
FT   CDS_pept        join(735520..735886,735953..736191,736259..737075,
FT                   737142..737167)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806566"
FT                   /locus_tag="CNC02570"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="AAW42243.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG067610"
FT                   /db_xref="HOGENOM:HBG175995"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00004B442F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL9"
FT                   /transl_table=1
FT                   /translation="MPKEHIRKRGKRKTKANDDPPLQPTTDVSEPEPSVSTGIHPARAA
FT                   MLAGQSIPVQTHSPSQDTQLEDSEREEADQTQWIRGPRMESEFPFGVLDPDVKAYFKSI
FT                   EEQIKDWEGVSSAGEEREDRQNFLSSVLSELRGHELSAATDPETSIILERIMPSLSDWG
FT                   RRVIGDSFGDKWEELIRHRFGSHVVQTWMTLAADTLDRESKDIWPPQQAKQDPLAGRLP
FT                   TMTLLFSSVITTLLPSVHLLISSPYASPPIRLLLLILTPRRVLPALGSERSANEGLIRS
FT                   KKSDKWRKNQEVKGKSILGDDQSTAQSSNRALPEDLRLCRKEIRQALMEGLGEAEWKAM
FT                   GVDAVGSPTVQLILEFEVDEGDAEKQGSLFDVLTEGIVTQICSNDQSVFEARPYLLSLI
FT                   TTQTGTRLSECILSLAPQKVFDAIWSTYFEGKLGKLAGHPYANFVVAKGVSRLELDKIE
FT                   KLIEEVLGNSGGRGLIKQALYKPL"
FT   CDS_pept        join(complement(738895..739081),complement(738636..738841),
FT                   complement(738423..738583),complement(738359..738368))
FT                   /codon_start=1
FT                   /gene_family="HOG000161169" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789271"
FT                   /gene_name="TIM22"
FT                   /locus_tag="CNC02580"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM22"
FT                   /function="protein transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAW42244.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG113205"
FT                   /db_xref="HOGENOM:HBG594005"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000042E2A1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKL8"
FT                   /transl_table=1
FT                   /translation="MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRYM
FT                   GMVMESCPLKVTIAGVGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFKEM
FT                   GRNMWSSGRGFAKVGMVYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTAMLG
FT                   GGVAFAAFSGAIDWWLRSAPADEI"
FT   CDS_pept        join(complement(741361..741668),complement(741054..741302),
FT                   complement(740797..740984),complement(740695..740733),
FT                   complement(740505..740638),complement(740343..740440),
FT                   complement(740173..740289),complement(740044..740097),
FT                   complement(739743..739992))
FT                   /codon_start=1
FT                   /gene_family="HOG000217083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806567"
FT                   /locus_tag="CNC02590"
FT                   /product="Polygalacturonase, putative "
FT                   /function="polygalacturonase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="AAW42245.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="HOGENOM:HBG175996"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000042DA5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL7"
FT                   /transl_table=1
FT                   /translation="MRFLCLFACVLSSAVVQGSLFVLSESQDQKIIPEILEKDNSIWPY
FT                   HHEVFEFHPEHKDLSTGLVRPLCVLHTLGEGADDSYNFEKAVHQCGRGGIVRLPDANYT
FT                   ISRPLDIYLSNSVLDLHGWLSFSANVSSWIENRMPLGFQNQSLAFVVRGNDYILEGNDK
FT                   GGINGNGQAWYDYAKDYGNKFGRPMSLAIKNSKNVIIKNFSIVQPQFWASLIWGSENVY
FT                   IKDFYVNATSFNPESSSDQKNWLQNTDGSDTYQSHNVTYENMIYQGGDDCVALKPNSTS
FT                   ITLRNVTCYGGTGIAFGSIAQYAGVKDVIEDVFMEDIRLYPSNQCPAYQGVYFKSWLGY
FT                   SIGQPPNGGGGGYGYCRNVTVKDVYMEDIWHPLVVQSDLTYLTLDREKFTDSGLFEWYD
FT                   IHLKNFTGKALGNRIAWMSCSKLTPCHDWTFEGMDIMPGKQDHPEIHYTCNNFVLGGND
FT                   GLNQCHPSNSKLETENGGTL"
FT   CDS_pept        join(742464..742670,742729..742913,742965..743447,
FT                   743520..743632,743789..744102)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636605"
FT                   /locus_tag="CNC02600"
FT                   /product="Vacuolar membrane protein, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42626.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG067609"
FT                   /db_xref="HOGENOM:HBG175997"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4430"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL6"
FT                   /transl_table=1
FT                   /translation="MVLPRFLNTGVLCPMVLSTCWAVLHIMQYGFAITSLNGIQQSVTC
FT                   QKAENHTGILQIPIATPVDCIPMTTSSFGLVVSIFTLGGLLGSLAASTTTLRYGQVATL
FT                   RLSAAMVLAGSTCIGFAGGTSSMLIGRVFVGIGCGLSTVTVPVFVAQLAPPSMKRSLGI
FT                   SNQISIVIGMLAAQSLSFPFAHPDRWRFVFIAPAMLALIQLAGSLLVNNPVVESQEAPE
FT                   IEALLETSQEAETLTIKDLFLSREPDVIKGCEYSVALYLKSFVLMFDVRLRSPCRSCNT
FT                   DVAAIMRCCTSDVLFNTDFNSSISGRLSADGSHRGLDQASHHCTSNIFGLSIVGIILFV
FT                   VAFSVGLGPVTWVVLPEVMPSHAVNAAGSVGLALNWVLNFAMGATFLPIQQTLSGGVES
FT                   KEGNVFFILSVTCAIAAFAIRLTFKRYDRRITLA"
FT   CDS_pept        join(complement(749012..749087),complement(748636..748943),
FT                   complement(748505..748577),complement(748208..748455),
FT                   complement(748058..748151),complement(747758..748000),
FT                   complement(746774..747696))
FT                   /codon_start=1
FT                   /gene_family="HOG000182122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636606"
FT                   /locus_tag="CNC02610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42630.1"
FT                   /db_xref="HOGENOM:HBG212229"
FT                   /db_xref="HOGENOM:HBG325400"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniParc:UPI00004B4431"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL5"
FT                   /transl_table=1
FT                   /translation="MVALASNFLGNPFITRDDVERGCIALLDPLSHHTSPGGAIIDIGN
FT                   TATHYDQKAVALETFARPLWGLAPLLLGGGKYIGVERWIKGLASGTDPNSFEYWGASAD
FT                   KDQRMVEMSPLSFAVAIAPEVFYAGHTDAVKENICHFLRSCIGKQMPDTNWLWFRVFAN
FT                   LALRTVGSAFYNPVQMEKDLERLEEFQLTGHPACGHESSSAGWSRDGPEEVKQLDYYSS
FT                   SFAIQVAQMIYAKLAIETDPERCKRYKQRARDFIQDFYYYFSDEGAAIPFGRSMVYRFA
FT                   AIATASAMPFADVEPPKPLQWGHIKGLVLRHLRYWNDAKDIFRSDGTLNIGYRFDCMNM
FT                   TENYNAPGSPYWCMKAFLCLGVPPDHPFWTSEELCWPSDLFPPIKSLPDPMHIMCRQGG
FT                   HTFLLSSGQKPHYAMRHGVAKYCKFSYSSAFGFSCPTGDMDLGQLAGDSMIALYDNSDS
FT                   AKGGDGETWRVRREPFDCSIVGRGTAQVHLRSKWKPWNDVLVETWLIPPQATSPNWYLR
FT                   VHKITSERKLKSAEGGWTNYGQGINGRALIQSFSGLTSPGGDQEVGWARAVTEGGAVGI
FT                   LDLSNCSSSGRRLGQLVQIDPNANVIFSRGILPSLVGDIAKGETWLATAVFGLPSLTGK
FT                   PLDWQKGWDEPPQIPSWIS"
FT   CDS_pept        join(complement(750835..750856),complement(750315..750767),
FT                   complement(750138..750256))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093368"
FT                   /locus_tag="CNC02620"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42247.1"
FT                   /db_xref="HOGENOM:HBG175998"
FT                   /db_xref="UniParc:UPI000042C104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL4"
FT                   /transl_table=1
FT                   /translation="MSPPTDPEATAPHRRFSVRTLFSSTRHIFYVVLFTLWICIDIALL
FT                   GLVSEQIHKYGRYRENYPTAQYQNALGLLLFSTIIGLLFGIFHWALGLTMYLPIFLAFG
FT                   VWFGTGAGILEPTPFGHGFQCRHTWDLSRFPANWQPYVGECSRVTAIEGLAWAMFALSV
FT                   FGLFWVIADKYNFTSKRSSVYELAEQGEPIAEKH"
FT   CDS_pept        join(752466..752595,752701..752718,752803..752810,
FT                   752880..753010,753064..753167,753214..753384,
FT                   754309..754463,754521..754540,754590..754729,
FT                   754782..754916,754970..755011,755059..755083,
FT                   755136..755277,755329..755350,755399..755413,
FT                   755454..755573,755626..755969,756014..756101,7
FT                   56153..756199)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093369"
FT                   /locus_tag="CNC02630"
FT                   /product="Expressed protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42249.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067608"
FT                   /db_xref="HOGENOM:HBG176000"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00004B4432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL3"
FT                   /transl_table=1
FT                   /translation="MEKRNFNDLPLFENGRQSSTCTPDPSQPSRSNENYEPVQSDANRS
FT                   VTVNRACDECHRLKMRCTKDKDSQSCTRCLQGSRPCTFEGPRKSKTSKVEDRLRVVEGQ
FT                   ITSIQGSIEELLRLQRDAACKSSSVENSHPFVQKPHGQEFETKYFQKSSSHTQQDPLHC
FT                   QSEASTLALSRTQNHPHRKAWTTEKLFIGHAVRMAMDLGLHHCLPYLTDRDTDIHKSHE
FT                   ELAQERHIVVGARIWLTLFKIDTEMSFAYCRPAIFSPEGAINNARRFLEHPLSIPTDIR
FT                   LVSTCENLTFRMPLHQHFALSLGRRQSVGAAVDVDQLLRRCNCALKDWFQYWDRYCAQR
FT                   GISADHFLRETLVTGRAGTFLNANSHVLHDVRNRRDLMRLSEERRRWFQEAGEMAHQLV
FT                   NTCLRGQQYTENFQYANRLTHYNMVYAARFMIRMASLLPEACDLHQVGRDVEQVAVMLT
FT                   QVPGFQLAHFLREIMSKARQDHVLPPSLSVSRAPSPCAAANSAWSAADHSGSQNYHLNE
FT                   LGYKSRDCSTNFIPNWEMMTTGTEQTPYGDDVSYLNFLYADQLFSHYENPADIGQSFAL
FT                   LQGNSRTETTSNSVFNFDTTWFPFPPLDDDMQTGQAVGTNFE"
FT   CDS_pept        join(complement(758744..758790),complement(758430..758687),
FT                   complement(758288..758373),complement(758233..758239),
FT                   complement(757874..758179),complement(757747..757816),
FT                   complement(757536..757693),complement(757266..757469),
FT                   complement(757062..757206),complement(756964..757000),
FT                   complement(756482..756912))
FT                   /codon_start=1
FT                   /gene_family="HOG000251476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581878"
FT                   /locus_tag="CNC02640"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42251.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG301772"
FT                   /db_xref="HOGENOM:HBG305043"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniParc:UPI00004B4433"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL2"
FT                   /transl_table=1
FT                   /translation="MQTTPKGYDPITLSLFSNRFMCIAEAMGRSLKQTAISTNIKERLD
FT                   FSCAVFSPTGDLVANAPFVPVHLGSMSWSVKYQLELHGKSLKDGDVLLTNSPLAGGSHL
FT                   PDLTVITPCFDENDPNKIIFFTASRGHHSDIGGILPGSMPPTSTNINEEGANILSLKIV
FT                   SDGVYDHEGLYRVMVEEPSKYPGCSGCRNFRDVESDIKAQIAANNKGSSLLRALVEEYD
FT                   LKTVHEYMDHIRNNAEQAVRNMLRKAAANAKTNILHGIDYLDDGSPIALEITIDTDSGS
FT                   AIFDFEGTGPELRGNLNAPICVVHAAVIYCLRSMIGEDIPLNAGCLVPIEVRIPEGSLL
FT                   SPSPESAVCGGNVMTSQRITDVVLLAFRACAASQGCCNNLTFGAGGKDFETGEVIDGWG
FT                   YYETIAGGSGAGDGWHGTSGVHCHMTNTRITDPEILERRYPVILREFGLRSNSGGSGKY
FT                   NGGEGCVRSLQFLQPLQVSILSERRARGPYGLNGGACGAPGLNLWIKQAHGGSAKGKPR
FT                   VINIGGKGTMQFETGDLIVLHTPGGGGWGKLEDTDSKLKQEDEPLLQAIKWEARGSWAD
FT                   MAKVDF"
FT   CDS_pept        join(complement(758744..758790),complement(758430..758687),
FT                   complement(758284..758373),complement(757874..758179),
FT                   complement(757747..757816),complement(757536..757693),
FT                   complement(757266..757469),complement(757062..757206),
FT                   complement(756964..757000),complement(756482..756912))
FT                   /codon_start=1
FT                   /gene_family="HOG000251476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581878"
FT                   /locus_tag="CNC02640"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42252.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG301772"
FT                   /db_xref="HOGENOM:HBG305043"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniParc:UPI00004B4434"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL2"
FT                   /transl_table=1
FT                   /translation="MQTTPKGYDPITLSLFSNRFMCIAEAMGRSLKQTAISTNIKERLD
FT                   FSCAVFSPTGDLVANAPFVPVHLGSMSWSVKYQLELHGKSLKDGDVLLTNSPLAGGSHL
FT                   PDLTVITPCFDENDPNKIIFFTASRGRDDIGGILPGSMPPTSTNINEEGANILSLKIVS
FT                   DGVYDHEGLYRVMVEEPSKYPGCSGCRNFRDVESDIKAQIAANNKGSSLLRALVEEYDL
FT                   KTVHEYMDHIRNNAEQAVRNMLRKAAANAKTNILHGIDYLDDGSPIALEITIDTDSGSA
FT                   IFDFEGTGPELRGNLNAPICVVHAAVIYCLRSMIGEDIPLNAGCLVPIEVRIPEGSLLS
FT                   PSPESAVCGGNVMTSQRITDVVLLAFRACAASQGCCNNLTFGAGGKDFETGEVIDGWGY
FT                   YETIAGGSGAGDGWHGTSGVHCHMTNTRITDPEILERRYPVILREFGLRSNSGGSGKYN
FT                   GGEGCVRSLQFLQPLQVSILSERRARGPYGLNGGACGAPGLNLWIKQAHGGSAKGKPRV
FT                   INIGGKGTMQFETGDLIVLHTPGGGGWGKLEDTDSKLKQEDEPLLQAIKWEARGSWADM
FT                   AKVDF"
FT   CDS_pept        join(759099..759146,759224..759422,759478..759681,
FT                   759744..759914,759964..760298,760349..760449,
FT                   760508..760625,760681..760841,760905..761031,
FT                   761091..761234,761285..761361,761419..761713,
FT                   761768..762012,762069..762135)
FT                   /codon_start=1
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942384"
FT                   /locus_tag="CNC02650"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW42254.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG115978"
FT                   /db_xref="HOGENOM:HBG658426"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI00004B4435"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKL0"
FT                   /transl_table=1
FT                   /translation="MSRSIPDHSIRISIDRGGTFTDVHASIPAANHSETREEFIFKLLS
FT                   QDPSNYKDAPTEGIRRVLEKVTGQGIERGKPLPVDKLEYVRLSTTVATNALLERKGQKH
FT                   ALMITKGFKDLLEIGNQARPNIFDLNIKRAKPLYSRTVEVDERVTLVGFSSDPNYEKHA
FT                   VKFNDDGSIGESYSGVGADEQKIVIPGRIVRGLSGEAVNILREPNLEAIKVDLQNLYDD
FT                   GYSSIAVCLAHSYTFPDHELAIGKIATEVGFPHVSLSSQLLPMIKMTPRGQSTTADAYL
FT                   TPILRDYLEGFYSGFEGGKNGSLHVEFMGSDGGLVDLKNFSGLKSILSGPAGGVVGCAL
FT                   TSWDKDEKIPIIGLDVGGTSTDVSRYAGHYESVYETTTAGISINTLQLDINTVAAGGGS
FT                   CLTYKNGLFRAGPESAGAHPGPACYRKGGPLALTDGNLFLGRLIPKYFPRCFGPNEDQD
FT                   LDPEASHKKFEQLAEMIRKESGTEKSLDEIVYGFVKVANETMARPIRTLTEARGFKTEK
FT                   HILASFGGAGGQHACEIAELLGIQRVLIHKYSSILSAYGLALADRVFELQEPAAVIFSQ
FT                   ENKAGLNARLDKLERDVFKTLLDAGFADDKIGINRILNMRYDGSDTALMISNEGSGDYE
FT                   KEFKRAYKEEFGFLLNKNIVVDDVKVRGVGKTFDSLGPPPTQEVKSLELSVVSPEHADC
FT                   SQNCYVWYGKSGKREEVPVFKIESLSVGNMVIGPAMVIDETQTIFVNQGWKAISTNSHL
FT                   LMVQEKKKGD"
FT   CDS_pept        join(complement(764399..765055),complement(764218..764353),
FT                   complement(763102..763565))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806569"
FT                   /locus_tag="CNC02660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42731.1"
FT                   /db_xref="HOGENOM:HBG067607"
FT                   /db_xref="HOGENOM:HBG176001"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI00004B4436"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK9"
FT                   /transl_table=1
FT                   /translation="MSCPSPGSSPSTSATVPLAVHRQNDYQTASPISLPPSLSPSASPV
FT                   AIFRRAIVLHDHSDAEKNFPGESNTQENVGPIMSSVPFAASPLIAATTFSLAPNLEQQR
FT                   GKRKRRRSGSDSDYSPPYSLRGGGRPQKSKTRRNANNGSHSGQCQNVRSSRRTTRSKAR
FT                   RANSPSSLIITSLEDIKLEDAAVKSEISRLGLTLRDVQGDGNCLFRCLSDQLYGTEKRH
FT                   AEIRKIVCDYLDSHKETMEGFVVPFMKEGERYEGYVQRMRQSTDKESESSSDQRVEELL
FT                   HELAPSNTACPSDSSAIEHCSLSSEGVSYRPRSPALSSTTGTRSRSESVSERSSNGSVT
FT                   SDLAQSQSSRSTTVSSGQDAPRVTPEIISDSKLRTKSDKLGKDLQGMVLRSRESSREPK
FT                   RSHDEPQKRRASLRLKNRL"
FT   CDS_pept        767897..768775
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806570"
FT                   /locus_tag="CNC02670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42627.1"
FT                   /db_xref="HOGENOM:HBG067606"
FT                   /db_xref="HOGENOM:HBG176002"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="UniParc:UPI00004B4437"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK8"
FT                   /transl_table=1
FT                   /translation="MVLMCKDAGDWTKRLFDYSRALEASTTEPESGAGRNVKIIIEGPY
FT                   GGTGNTMLSSFSSLVLIAGGSGITHALAVAHDLVMRAPTGAVRARIVDLVWIVKTEQEA
FT                   KPLMATLLELVSDAKSWEAASIEGQRRQANYASPTALRIQIFVTRCPASSPLALIPDAT
FT                   ALSSFNVETSAEKSGMVGHMSGTNTEKVAYLSRNLSAASTMSTMRDKYVQLSGITARPA
FT                   RPNLNIIISKIVDETIAHHRQNLTEANGMYITACGPEGLVYSTMQAVKALQAYKRTAVG
FT                   GVEFEEERFGF"
FT   CDS_pept        join(770575..770647,770750..770813,770872..770883,
FT                   770968..771037,771101..771174,771241..771360,
FT                   771424..771653,771709..771835,771887..771932,
FT                   771989..772114,772176..772450,772506..772725)
FT                   /codon_start=1
FT                   /gene_family="HOG000199845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789272"
FT                   /locus_tag="CNC02680"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW42256.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053581"
FT                   /db_xref="HOGENOM:HBG333792"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000042E2A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK7"
FT                   /transl_table=1
FT                   /translation="MATSVIPPQTACSLTDSNPVRKYSFFRSVTFQIAIACAVSFTAPG
FT                   MWDALGGLGAGGAAEPYAVSAANALVYGLFAIVCVAAGAINNRIGLKWGLALGSIGYPL
FT                   YGAGLYVNNHTSHTAFMLWGSAMCGISAGFFWAAEAAIIIGYPSPKDRGFYLAVWQTAK
FT                   AVGPIVGGAINLGLNANRETAGSVGSATYIVFIVIMCLGLPFAICLSPAQKVHRKDGTR
FT                   VIVHKQPSWTKEFKAVLDLALTRRIALLLPSFFISYFYNGFLSTWLTTYFTVRSRAFSS
FT                   FFTNFAGIFSSFIVGTLLDSQKINIKTRGKIAFASIVIILTGTWIWAIILQKQFYDADV
FT                   APVYDWFKGGFGKAYGVVFFWTFAGQAYQQFLYWVVGQYATDISSLSHHTGILRGVEAL
FT                   GQTVAWAMQSEGNANHFVSIGINFGITLLSIVPTWIVLSELEGSHEIVVVESDQESNNE
FT                   GKESTEGPSAKSSVKDLPLA"
FT   CDS_pept        join(complement(777169..777329),complement(776996..777081),
FT                   complement(776875..776943),complement(776799..776809),
FT                   complement(776700..776740),complement(776579..776652),
FT                   complement(776457..776525),complement(776168..776401),
FT                   complement(776096..776104),complement(775921..776048),
FT                   complement(775780..775872),complement(775609..775734),
FT                   complement(775526..775557),complement(775207..775471),
FT                   complement(775127..775145),complement(775049..775074),
FT                   complement(774904..774996),complement(774829..774851),
FT                   complement(774755..774767),complement(774680..774699),
FT                   complement(774614..774629),complement(774451..774545),
FT                   complement(774277..774395),complement(774191..774215),
FT                   complement(773904..774153))
FT                   /codon_start=1
FT                   /gene_family="HOG000180633" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806571"
FT                   /locus_tag="CNC02690"
FT                   /product="Mitochondrial inner membrane protein, putative "
FT                   /function="calcium ion binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAW42258.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG190505"
FT                   /db_xref="HOGENOM:HBG357440"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00004B4438"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK6"
FT                   /transl_table=1
FT                   /translation="MAQNPQEPLSSRLSSTLKATAGSLTSSVKPAESELGRWRRTFDKF
FT                   AKEEVDGQKFLNPSQFIDAIAPTDEGFSKIKREQYANLFRVADSARRGLVSFEDFVVFE
FT                   TLLKRPDADYQLAFQVFDVDASGTIDFDEFKAVLSANTAASGIPFDFDCAWMKLYVGKR
FT                   GDRHVLGYHEFTQLIKGYQGERLRQAFHFFDADGDGYINPEEFQRIIVEIAGHKLSDSV
FT                   LGRLPTLCTLNPGRRISYSEVIAFHNIIREMDTVERIIEHAVKKSKDGRIDISDFLDEA
FT                   AGSMRYGMFTPMEANIIWHFASRGNAGTGQRLALADFQALLDAKWQPPETASIKQPSTV
FT                   SGGFLAEAAQSTYNFVQGGIAGGLGAYAVYPIDLVKTRLQNQRSTVVGEVLYRNAFDCV
FT                   KKVYTNEGGIRAFYRGVLPQLVGVAPEKAIKLTVNELVRKKATDPETGRIPLLMEIVAG
FT                   GSAGGCQVVVTNPLEIIKIRLQMAGEITRAEGGTAAPRGAFHVIKQLGLIGLYKGATAC
FT                   FARDIPFSMIYFTSYAHLKKDVFHEGHHGKVLSFGELLAAAGIAGMPAAYLTTPADVVK
FT                   TRLQSQARAGQTVYKGIIDGLSKIFREEGLRTLFKGGLARVIRSSPQFAVTLACYELLH
FT                   KHFPYPYAPTPVVHRPVLQVHQEISRIRARNALRILLDCSSRFGMVDSSTASKRMQLIP
FT                   KSFR"
FT   CDS_pept        join(complement(779814..780374),complement(779615..779758),
FT                   complement(779433..779564),complement(779181..779384),
FT                   complement(778875..779129),complement(778703..778810),
FT                   complement(778348..778650),complement(778083..778295))
FT                   /codon_start=1
FT                   /gene_family="HOG000195427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093370"
FT                   /locus_tag="CNC02700"
FT                   /product="Mitochondrion organization and biogenesis-related
FT                   protein, putative"
FT                   /protein_id="AAW42259.1"
FT                   /db_xref="HOGENOM:HBG176003"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI000042F029"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK5"
FT                   /transl_table=1
FT                   /translation="MSAGTTVTYARLPPPHALLRGAPLPLRAYIRSPQAFTASAPIPLA
FT                   TRARLPQLIPLASLRFVSTQPQPSSPPPPYPPPVHSPAPAAHRINSAEPAIGTPPPLPP
FT                   APQGSLPPKVTDLAAAHEKALEKKDEKKKPTGPLPARVWASVKKEAAHYWAGTKLLGQE
FT                   IKISGKLQWKVLNGGTLTRRERRQLRRTTIDLLRLLPFSVFLVVPFMELLLPVALKLFP
FT                   NMLPSTFEGEFAANEKQRKLLRVRIEMAKFLQETVRESGLKADSVVRSDEFKEFFRKVR
FT                   STGETPNQTDVVRVAKLFHDDITLDNLSRSQLVSMCRYMNINAFGTDNFLKHQIRSKLE
FT                   KFRVDDMMIHAEGVDSLSTKELQHACQSRGIRFLGVSPARLREELEKWIELHYINGISG
FT                   VLLVLSRAFNFEQKGDDIMESLVITLSSLPENLLNEAELHVLDEASYKQKLEVLQQQQE
FT                   LIEDEAEQEKEEQDALKEEQEKKEAEETARREQEEADKAVEVSPAAKEEETSKEQVEES
FT                   VQPAPDQKDARMSEEQLSEIAEALSVLTARSSIMKERDELKSLLEDNLLSEAESKERQE
FT                   GASPTVAVSKRVRAMIKKIDTQLEKYDERVDSSLNVIKTTPLGQIPLEDLKKALKEMKH
FT                   RPAD"
FT   CDS_pept        join(780546..780843,780933..781001,781064..781124,
FT                   781201..781273)
FT                   /codon_start=1
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806572"
FT                   /locus_tag="CNC02710"
FT                   /product="Putative uncharacterized protein "
FT                   /function="heme binding"
FT                   /protein_id="AAW42260.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG265461"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI000042C5ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK3"
FT                   /transl_table=1
FT                   /translation="MSLSNPLNLLLVPPLLFLAYRILVPPPPHTPPEYNSLPAEHPHVI
FT                   CHSTFTPAQLAQYDGTNGDRILLAIMRVAPDGKIDPNGERTVFDVTAGRTFYGPDGVYG
FT                   NFAGRDASRGMAKQSFEPEVLTSIDEPLDDLSDLTPSEIENMRGWHQHFEGKYIVCGEL
FT                   VNG"
FT   CDS_pept        join(780546..780843,780933..781007,781067..781124,
FT                   781201..781273)
FT                   /codon_start=1
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942385"
FT                   /locus_tag="CNC02710"
FT                   /product="Sterol metabolism-related protein, putative "
FT                   /function="heme binding"
FT                   /protein_id="AAW42261.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG265461"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI00004B4439"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK4"
FT                   /transl_table=1
FT                   /translation="MSLSNPLNLLLVPPLLFLAYRILVPPPPHTPPEYNSLPAEHPHVI
FT                   CHSTFTPAQLAQYDGTNGDRILLAIMRVAPDGKIDPNGERTVFDVTAGRTFYGPDGVYG
FT                   NFAGRDASRGMAKQSFEPGKFLTSIDEPLDDLSDLTPSEIENMRGWHQHFEGKYIVCGE
FT                   LVNG"
FT   CDS_pept        join(complement(783173..783237),complement(783014..783108),
FT                   complement(782862..782953),complement(782731..782798),
FT                   complement(782518..782671),complement(782422..782444),
FT                   complement(782287..782371),complement(782115..782201),
FT                   complement(781961..782045),complement(781831..781899),
FT                   complement(781548..781762))
FT                   /codon_start=1
FT                   /gene_family="HOG000276736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806573"
FT                   /locus_tag="CNC02720"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42262.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG387265"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI00004B443A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK2"
FT                   /transl_table=1
FT                   /translation="MVNLADLSNSLASQDFTSIPVIDLSDAQSPSLQKRKAVAAEIRNA
FT                   CLNAGFFYVKNHGVPLQVVDRTFEQSKEFFNQPDGLKKSVDISKSGGNFRGYMGLLSEN
FT                   NDPKNKGDMHEAFNMGLDPSVDASAFIQDVKEGELRHSENLWPDKKDWQGADVFKQANL
FT                   DYYKEVLGLGQSLFPLFALALDLPEDFFSDKIEHPAAIMRILFYPALGERQVDELMPGI
FT                   GAHTDFECFTILRQDDVPSALQVQNRKGQWIDAPYMPDTFVINIGDQFARWTNDIFVST
FT                   RHRVLPALSKDRYSIPFFFGCDHDVPLIPPDTCVTADRPAKYETMTAGAYVHMRLSDIY
FT                   KVKET"
FT   CDS_pept        join(783542..783577,783622..784367,784421..784738,
FT                   784792..785007,785061..785343)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806574"
FT                   /locus_tag="CNC02730"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="autophagy"
FT                   /protein_id="AAW42263.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="HOGENOM:HBG067605"
FT                   /db_xref="HOGENOM:HBG176004"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="UniParc:UPI00004B443B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK1"
FT                   /transl_table=1
FT                   /translation="MPPAQLCQRCNQPMQLDPSVAEITPAQYSLIVSSLPPPSPATSSS
FT                   SSTPRDLTHKLADLPPFTREAAKIWRDANDPPLSGDSSIQTGLRSVAESFILLSDSALH
FT                   PKSSKSPSKSLPPHDLDLSAQLHQILSSNTPVSHPLCTECTALLTAEFQRMAEELGKER
FT                   DAYIWFEQAIRKNKELLETAESSRRTVSTRHVDGLAKYDVEGTEEEWGALLKRKEQLEI
FT                   EEEQLKRLLELTEKELEAVLEEERLVELEAKAVEQEENDFLTSHSALSIHLTQLASTLN
FT                   TAHTSLLLSRSLLAHLESTNVYNDAFHIGHVPLLPLASSSITVGTINGLRLGGRPVVEW
FT                   DEINAAWGLAALCLHRIAEKVGCVFETYKIVPLGSYSRVEELPPSKSTYELYASSDMTP
FT                   ARLLQNRRFNHAMVAFLECLRQLLEFGKKHGKQWAQANIDICKDKISNHSIRLPGISSM
FT                   PLGLPSMAIMSLAGNGPNHPGTNGSNGKSQSGSSTGDSTAEEGWTRACRTVLGVLKRVL
FT                   IMESETDRGNINEQS"
FT   CDS_pept        join(complement(788963..789574),complement(787313..788303),
FT                   complement(785427..787264))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093371"
FT                   /locus_tag="CNC02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42264.1"
FT                   /db_xref="HOGENOM:HBG067604"
FT                   /db_xref="HOGENOM:HBG176005"
FT                   /db_xref="UniParc:UPI00004B443C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKK0"
FT                   /transl_table=1
FT                   /translation="MGPLSLLKGQAAISQAENWDDDFEFSLSFPIDYNNSTATLKENKY
FT                   QNMYDRNGDIPSSVRPKSLSLSPTKPGRSGAPSCPKITAPLHTPCPQSPRHSPSYPSDF
FT                   TSFPSKTKPSSSNPDPVSPPLLSTRSNAYLPQRHGRGFRSRAGSTTAINGDVAPKKLTK
FT                   RCPSASFIPIPSSHSSRSLRRNDSATSLSCSLHRSATCPDLSYSRGFHLPSPSLGSPYR
FT                   RARKSLHIPEHPLPESSSLHIMAPGQTPGGNASICFSMRSESPSEAKIIDVKAPRKRVK
FT                   EPHSFFPASSVEMAEKLRNDNEAVAMANTRPYTTGDCPTAGSPDNLNAVTAHPTLVRFG
FT                   RKTSGNGHTGAGSSGASFTSTVRRLGSISKKHGRRISGGWKFGAQPSSSSASLTLQEVK
FT                   PTGAVFDQSRAEEEARLGTVMGSPVKEDVTKLADDELVKQAMGSECTKNCGTRQDRRSP
FT                   PSEQWDQDFPLESEFQHIGPSINGSSLIRPESKRREDKNRRRQSWNDFVIPRNVMEKQR
FT                   EVKEGIGAIKMFARGVESLKSLIAAHASLSNQLHSHKSSSPDSLRFDALHAEFAQWWEM
FT                   AIVLVEVGSTGRDDNSHGPIDGSKRERRVTLATEEARIAEDAPRHVSGSITSTEMSSVP
FT                   SEGGLMASGHRNISLPETVEHLPSLRSPPRASPPPEHWRASTGRQNLSKRQLEVLRTML
FT                   RTPVSESSKGVDMTGHQESTQRADYEAVNATKTKKGGNASKAITSMAPKSQNDLPIGVD
FT                   LLQERRAEPLNATIKSRRRYTSKVGLAGLKEFLRSLRMERSTGKADEQNLSLTTIKSQA
FT                   HGVEDIAAVIRSRSSATNPSTATEGSALLEHPSSFRSASPTGHSCEVSHNSISVRNLQI
FT                   EPSSSKQVLMPDKSRSKSSSRVRQIPSTASPSVLSKSTQNPRLEPKRPSIRNIFRTSSG
FT                   NWSELISLNSGSPAPSSTKNSSPALRKSDSMRRTFGQVSEAKDRPERGEKVDNDSAEAK
FT                   AAKMGSFKGHDELSVDGRGLILIGDPPPGTYIRSKPPTETSATVKQLGVEEEMTLKPSK
FT                   KTRATGLGWPERKAEGGDIKDFISPVFSGISNTTQVSSTPMMGQREDSEGNVVVALTPD
FT                   NLPTLLEYMKQCEVKLHEWKKKVQMEGLDKELIMNSVKA"
FT   CDS_pept        join(792864..792931,793001..793106,793175..793303,
FT                   793374..793593,793642..793758,793822..793973)
FT                   /codon_start=1
FT                   /gene_family="HOG000179751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806575"
FT                   /locus_tag="CNC02750"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbon-carbon lyase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="AAW42265.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016830"
FT                   /db_xref="HOGENOM:HBG297963"
FT                   /db_xref="HOGENOM:HBG747616"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI000042D58E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ9"
FT                   /transl_table=1
FT                   /translation="MESKTFLKNALAQKKPGLGFWCTLPGAATVATALSAGGFNWTLID
FT                   AEHGMITDKDYFELVTTVTSLGASPIIRIPWNEEWMIKRALDAGAQGVMTPMCHSAEDA
FT                   KRIVSYSKYPPTGSRGYGPMFCPPVFGCKGSDYDAGADKNLLVIVQIESRKGVENVEEI
FT                   AKVEGLDCLFIGPFDLSKQMNVPFGGEEHEAAIEKTLQAAHSAGKIAAIFCSNGEIARK
FT                   RLAQGFDMVSIAVDSSCLAAEMERQLSLVTGEAGKGDRSYS"
FT   CDS_pept        join(complement(795727..795743),complement(795388..795623),
FT                   complement(795261..795335),complement(795116..795195),
FT                   complement(794675..795049),complement(794490..794619),
FT                   complement(794369..794431),complement(794256..794317))
FT                   /codon_start=1
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806576"
FT                   /locus_tag="CNC02760"
FT                   /product="Glyoxylate reductase, putative "
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="AAW42266.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG453194"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B443D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ8"
FT                   /transl_table=1
FT                   /translation="MPKILVTRNLGEHAMTILRQSGYDLIVNPDDAPPSREWVLNHLAD
FT                   PQVYAACIMHSQPSDKVDKELIATANDNLRCISSFSVGYDHIDVKAANARGIKIGHTPG
FT                   VLSDAVADIAVILVLSTLRRIGEGINLVKSGNWKQQPWAPFVNCGLSIGHPSLTIGFLG
FT                   FGRISQATVQRLLAFTNKEQPPRILYTSSYRRDNQDEIDAGFSKTFGVEVRREERETLA
FT                   SQADILIVLCDLNPSTKDLVNKNFLQKMKKSAILVNVARGPIVNSEDLHEALVSGQIFG
FT                   AGLDVLTGEPDIPADHPLLTLDNCLVLPHLGSADYDTRNAMAERCVRNAIAAANGEPLV
FT                   AEVKV"
FT   CDS_pept        join(796250..796404,796466..796545,796599..796719,
FT                   796786..796848,796916..797456)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636607"
FT                   /locus_tag="CNC02770"
FT                   /product="Expressed protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42628.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176006"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000042E29F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ7"
FT                   /transl_table=1
FT                   /translation="MFDFIFTFFLATAILAAVMALSVAITLPFAGALVRWRANYNPLAV
FT                   GLDQESRVGPTLTTLFGTMKRIKRLEGWQGLWKGMYPTLMYSTLLSVLSIVFVGGSATK
FT                   GPKNAYSVPEAGGVLMAIFTILLTIISLPMTILINRAIITPYKLPNSVKGSLRILLTPL
FT                   ELSKPYTLYLTPGLLATTMTHVVCATLLARTTRIFFLGVSSVTNDETVGNIAWWRWILY
FT                   LAWQCLSTLWFTPLEVIATRLSVQPNNSGDALSTEEEAPEGVSFCGAGEDVIGLRPSTE
FT                   PYLGMADCAKKIIEEEGWASLYRGFLFTMLGSVFGSTV"
FT   CDS_pept        join(complement(798558..799026),complement(798256..798509),
FT                   complement(797681..798199))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806577"
FT                   /locus_tag="CNC02780"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42629.1"
FT                   /db_xref="HOGENOM:HBG067603"
FT                   /db_xref="HOGENOM:HBG176007"
FT                   /db_xref="UniParc:UPI00004B443E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ6"
FT                   /transl_table=1
FT                   /translation="MAHPLTQQPSSSLPFPFAARPSPLTFGFGLPSTAPSETCTQTSNA
FT                   HSPYRMAGPAHSSPPKNSFARPRPNQAFTPPTGSLKRTRRSRSPSTSPTGSIQSPRSRS
FT                   PTPMASRLGHLPPPKNMRTDPSYASKTVKRSKLQNSTSDERSAEGMDVGIMLAALPPSA
FT                   HLPILLQLLQRDPSLSSTVLGIMPKLEFRSCLKEMEKLFAEIEKLAGPVVNVSFYPGAL
FT                   AESRRWDRVSNNIEVYCRTVATYIKCFTSANQQPAIDCPTLFLFLESHTRHLLTILSYI
FT                   PSSSQLDGSSPPPASLVLDLAKLSLTIWTSWVSDLSSDVNDRGGMYPHSAVAHWNDTLE
FT                   QLVGGIPSPSIPSASNAPGTGSHWSSSTPLTAGNPSPAKLLVSSFQEAFIPIRDQFVSQ
FT                   VGWLIGRQPAMEYH"
FT   CDS_pept        join(799601..799618,799696..799731,799799..799815,
FT                   799870..799892,799947..800074,800127..800155,
FT                   800209..800312,800372..800577,800638..800789,
FT                   800838..800913,800967..801058,801119..801243,
FT                   801303..801357,801411..801431,801483..801507)
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806578"
FT                   /locus_tag="CNC02790"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42267.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG020894"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="UniParc:UPI000042CBE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ5"
FT                   /transl_table=1
FT                   /translation="MTTIQKIKDIEDEMARTQRNKNTEYHLGQLKAKLAKLRRELIAPS
FT                   GGGGGGPGIGFDVARSGQATVTVIGFPSVGKSTFMSKLTGTHSEAASYEFTTLTTVPGQ
FT                   MTYNGARIQILDLPGIIEGAKDGKGRGRQVIAVARTCNLIFIVLDVLKPLNDLAILTNE
FT                   LEGFGIRLNKKPPAITVKKKESGGVAITNTVPLTKIDAQEIRAVLQEYRMSNAAVSIHQ
FT                   PDATIEDFIDVVEGNRVYIPAIFVLNKIDAISIEELDLLYKIPNSVPISSKLWLNIDEL
FT                   LEVMWDKLNLVRIYTKPRGQQPDYSSPVVLQRGKCTVEDFCNAIHKEIVKQFKNAMVWG
FT                   TSAKHARGQKVGLDHVLEDEDIICIFKK"
FT   CDS_pept        join(complement(912926..913029),complement(912738..912869),
FT                   complement(912643..912687),complement(912408..912577),
FT                   complement(912263..912348),complement(911882..912202))
FT                   /codon_start=1
FT                   /gene_family="HOG000204890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806579"
FT                   /locus_tag="CNC02800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="AAW42632.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG029648"
FT                   /db_xref="HOGENOM:HBG329601"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR016904"
FT                   /db_xref="UniParc:UPI000042D0AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ4"
FT                   /transl_table=1
FT                   /translation="MAKSRFEYVKKFELPDPLVPNTYIIVRIDGKGFHKFSDVHSFDKP
FT                   NDIRALKLMNTAAKAVLNEYKDVVMAFGESDEYSFLLRRTTTLYNRRRSKINSSIVSLF
FT                   TSAYVFHWASFFPNTPLLYPPSFDARVVLYPNVKEVRDYFSWRQADTHINNLYNTTFWA
FT                   LVHDGLTTAEANKALQGTNSKDKNEILFTKFGINYNTLPEMFRKGSVCVRSLSLEEPQG
FT                   SLAEQQAAHGIMTLSIVPSTSGNSNTILSQKEKVYQGTEGSPMVLHMDIINDIFWSERP
FT                   WLLS"
FT   CDS_pept        join(complement(915403..915414),complement(915274..915335),
FT                   complement(915114..915201),complement(914688..915058),
FT                   complement(914445..914618),complement(914332..914383))
FT                   /codon_start=1
FT                   /gene_family="HOG000213060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942386"
FT                   /locus_tag="CNC02810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42268.1"
FT                   /db_xref="HOGENOM:HBG058151"
FT                   /db_xref="HOGENOM:HBG323848"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniParc:UPI00004B443F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ3"
FT                   /transl_table=1
FT                   /translation="MAKQLVQRLSPLIEELLQASDLSTVSAKAIRKELIARGADKYEIK
FT                   NFRAEIDDKITEIYNSLGSKEAPAPKIEGSVSPSAKAPSSPHSLIEPKTVTRKRKAPTS
FT                   ENEETDEQMARRLQGEYGGSRTRKQRSSRSARPAKKTRPKSHAHIDNETEKNGDKKDDT
FT                   KTKRGGAFNKELLLSDSLAELVGSHSLSRPQVVKHIWAYVKERNLQDSNDRRYILCDDK
FT                   LREVFHTDRLHMFTMNKILVNHLRDPDDIA"
FT   CDS_pept        join(complement(917919..918020),complement(917279..917864),
FT                   complement(917144..917226),complement(917056..917083),
FT                   complement(916848..916998),complement(916481..916796),
FT                   complement(916381..916419))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789273"
FT                   /locus_tag="CNC02820"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="AAW42269.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG176008"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI00004B4440"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ2"
FT                   /transl_table=1
FT                   /translation="MPKDKKIQNAFKRSEVHRKTKREKEQAKLQRRLEIKKAEKDKVTG
FT                   AALRAERLSKNIPVTLDNTRVYDSSSYLTANPASLQNLAQEAKEASALINENDLMGKQP
FT                   SKELSNREDSAVLTSGPSSDQEEDADGSSEMSDKEIEEKLDGEDQEASAMRDITTQSPP
FT                   RILITTSPSPCKQTYQFCDDLKNVFPGGEFFKRPKGRGFEIGRVSRWASKRGYRALIVV
FT                   NEDHKIPNAITLINLPSGPTAYFKLSSITLSSNIYGHARPTPHSPELILNNFTTLLGNS
FT                   VGRLFGSLFPPQPQFRGRQVVTLHNQRDFLFFRRHRYMFPSATSAKLQEIGPRFTLKLR
FT                   WLRKGLPSVTAPDGHASIGGDPADEIYGTEVGPSKEEIAQDELDEEDEALKEIGQPAQK
FT                   KNVYEGTEVPPLDEEQEYEWKWKPKMEVSRRTFFL"
FT   CDS_pept        join(918605..918756,918807..919148,919199..919374,
FT                   919419..919670,919725..919958,920008..920627,
FT                   920694..920864,920919..920981)
FT                   /codon_start=1
FT                   /gene_family="HOG000132960" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806580"
FT                   /locus_tag="CNC02830"
FT                   /product="DNA repair and recombination protein pif1,
FT                   mitochondrial, putative"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW42270.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG055752"
FT                   /db_xref="HOGENOM:HBG398055"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI00004B4441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ1"
FT                   /transl_table=1
FT                   /translation="MPILTARTLSSSNPNNTSKGTLSRVTSFKRSWGEEDGPESSQLDW
FT                   SPSPEIVQRKGNILPSSGPLQSTTTSPSLPESAAKEIASQRRRKAILAALNQNKETVYA
FT                   SPVLDWRSGQTSSTFASPQDINCDISVPSVATHCPGSSIRHVNQTLPSLPKRPLPWEGD
FT                   QKARKKVYTQTSLTPKENAQPKSTSSALNIKQRVTLSEEQQKVLSLVVQQQKNVFFTGS
FT                   AGTGKSVLLREIIHSLRNKYARNPDAVAVTASTGIAACNIGGVTLHSFGGVGLATDTPE
FT                   ILLRKLKMNKKASGRWTKTKVLIIDEVSMVDGAMFDKFCKLGQLIRKNSKPWGGIQIIV
FT                   TGDFFQLPPVTKNGGMPKFAFEAEMWDETIHLSVNLTKVFRQKDQRFVDMLNEMRFGRL
FT                   SNESIIAFKSLARPLKFNDGIEPTALFPRREDVDRANLSRLNQLDSVGFTYHSIDGGSA
FT                   EANQREKLLSNFMAPKIIELKENAQVMLVKNLDETLVNGSMGKVIGFTYKNMFQCDDLG
FT                   KWTPDADLKDLEEEDKMKSLAVRQALRDKYQAKGANPLPVVRFKVPGGGTRDVLMEMDV
FT                   FKAELPNGEVQASRSQLPLILAWAMSIHKSQGQTLDRVRVDLGKVFEKGQAYVALSRAT
FT                   SLEGLQVTGFTAEKVMAHKKVAVWSSTLKDLNLV"
FT   CDS_pept        join(923396..924762,924819..925084,925144..925523)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789274"
FT                   /locus_tag="CNC02840"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42271.1"
FT                   /db_xref="HOGENOM:HBG176009"
FT                   /db_xref="UniParc:UPI000042CFEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKJ0"
FT                   /transl_table=1
FT                   /translation="MILPEDTKAPISSDDEFDDDFASLPPSPYLPSRLLPAQDANQQYP
FT                   FEYPASPSSAVTQPLFLPESDDIELGPAPPYTPNDPFQSQLQRRNERKSYLRGKAGKRF
FT                   ILGIVWGMGLWVGMMGMGALGWRFLGPGSQPRHRGPRQPQSVFPETPPAKDPWLRQSIE
FT                   CVPFSSTGWAPFSPSDLVGFSDPLEQIKEEQRSLNATFYLPLDSEVFVEMWQGPAAIGP
FT                   IIFSSYDAHSEEEWKGIDDQGSIVAHDGQGRKPGQGEYVRVIVETIIDVELGARDELDG
FT                   QNSAGWEMLAASSVCLNRRGPTINVTLSEEDLDDTVGDGSQNEEHNRFIWDRPTKNGYG
FT                   VEIVTNHPLESLYPDRKGNPLQFRVHVALPSLATQEHKHDIAPSSSFVRSLDVRAGNSA
FT                   IYVDGLQDVRIGELSLFSEFGEVTLQKPRLENLMVRTTGKVVGEVAVSNDMTIDTPIGE
FT                   IHLNISLAAPPRFNLINCPTSESVHQSASDVPHLLTPGPPPFMSTLPPVNVNVRSGGDR
FT                   VIVHYADWEVPCRDLRMDVFSLIGDVQIFPHPLFQGPFRLMTSKGPINVDLGNALIPDP
FT                   EGLGRWRNITLEERDRMGSHFYLGNVAWQAESVANHLDQSTHEVISVSLPVDGQGIVDR
FT                   KMHPSSAEDHGSRPDSKTERGIHVRTSVGAINVTF"
FT   CDS_pept        join(926472..926499,926570..926643,926707..926896,
FT                   926947..927458,927515..927637,927695..927775)
FT                   /codon_start=1
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636608"
FT                   /locus_tag="CNC02850"
FT                   /product="2-hydroxyacid dehydrogenase, putative "
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="AAW42272.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG453194"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI9"
FT                   /transl_table=1
FT                   /translation="MSKPQVLIAANPKTGIVWSKEEQSSKLGAVAEVLELASASRSEFF
FT                   QDLAPNGKYANIVAIYRHNDSVSAIGLFDEELINKLPASVKYICHNGAGYDQIDVAACT
FT                   ARGIQVSHTPQAVDDATATVGAFLAISAMRQFWRAEVNVRSGKWKAGLSPARDPEGKTL
FT                   GIIGMGGIGSALARRLLAFDMKVIYYNRRPIQPPPNFPCTYVSSIEELLKQADVVSLNL
FT                   PLNEKTKGSFGRQEFGLMKDGSVLINTARGAVIDEEAFIEALESGKLYSAGIDVYPDEP
FT                   NVNPKLLAMDNITLLPHMGTETRDSQKKMELLVLDNMISALAGKGLLNQVPEQK"
FT   CDS_pept        join(complement(931222..931448),complement(930757..931159),
FT                   complement(929730..930699),complement(928323..929665))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806581"
FT                   /locus_tag="CNC02860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42274.1"
FT                   /db_xref="HOGENOM:HBG067600"
FT                   /db_xref="HOGENOM:HBG176010"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00004B4443"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI8"
FT                   /transl_table=1
FT                   /translation="MHRRQATRISPTATPSSLLSPIVSHFPALSVISPFKALRQSPSSD
FT                   HHHPTLASPPRLELTKAVWQEADLGDGKGIVPLLLLTSPTSALQIFSVPTPVASQDPRS
FT                   SESFSDPEEVFAMSTITYDSSLYQCSLSGVNDGDPLPFSAHNETVLDMALMEGGRVALV
FT                   TCHSNKTFIGPLALVVVNLKSGRAEARVDLGAGSTADVHVSHKVIVITVSHPTPSIHFL
FT                   DPASFTPLFPPIVDAAPNALTQLPTIALSGRILAYVTSTPANISTPSDMGSLVTSSSLR
FT                   ASHSRNRQGPSSQVESHQGALISSAVEIGGGVARGVWAGIKLGAKAASAATRARSDRLA
FT                   QSAPDDTTAFGRDQEAAILGDTESRSLDEGSMLDEALPISAANAKSIDKGEWIHVIDLF
FT                   SRHPSSTRQVSPPGNVTSKSTPSFTTVAHFRLPPSSVVPIDTSHSSQYHSLPVQHLSFS
FT                   PSGTALLAAPADGRSFHIMEFHPAGPMKGNTRTGTQSQAWHLYELKRGHTIANVRWTSW
FT                   DRMGNWVGVGTDRGTIHIYPIHPSGGQPSAFTHVAGCRNAQRLFALSIPVSPIARIRPP
FT                   RLAMDTSHLDGSLDSDLTYSENSVFGFLPYRQHQKLDQKHIQDIGIFRWPSGVLELIRM
FT                   AVRGCREDDSEAGVAKYSSRSPPHRTRSALTELMLSRAVRERNSFAAEKAAQARWVLPS
FT                   AVAMSAPTLLSSTIAEKSQPSRVGALAAAEIRTHHFNPHVLPSSIYLSRQIEFFSARPI
FT                   DDYSPLSILDLEARTDKLVFRQEVEARSPPNEDTEAPLSFDRPLLSALHDLIESPSDRQ
FT                   IPGLPNGHGRTGIWTGDPIQTVKYGFNEGVDRVRREYVRAQLVKEHKLTKQNKETSGLS
FT                   LSFEDDAVLAVSSSDLRLDNLSLDQSEPAAVSGRSSSIHTSENLTSPPGSGDLPPTKVD
FT                   SSDGDSQWGEVWEEEYRKAVEDDGGPDDLVLGLLDEEEDERRQWEARQKL"
FT   CDS_pept        join(932118..932144,932856..932990,933046..933240,
FT                   933294..933395,933446..933615,933674..933768,
FT                   933820..934031,934087..934137)
FT                   /codon_start=1
FT                   /gene_family="HOG000138313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581879"
FT                   /locus_tag="CNC02870"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42277.1"
FT                   /db_xref="HOGENOM:HBG176011"
FT                   /db_xref="UniParc:UPI000042DA5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI7"
FT                   /transl_table=1
FT                   /translation="MSATEQVNQAPAETANALVAEATPPSQEAKEIFKAQEPVSEVAAP
FT                   NITEPLVKEQPTVANTEAGTAQPGPELGNKVDNTEADKLVEGTTTGEGAKTTEEVPKPS
FT                   EIKEGKKEVKKSAVKERTEKTKAEGKGFFAKFFGNRDKSPKKEKKKTPKAEKADPVTAA
FT                   APVETEGDDAAPPSVPTTSEPVIGTSAPIEAVEPTVKSPDTGALKGIDTATSADAPAEV
FT                   APAPEENKIEDKKDEAKDATAKSNLKAHRRLSARIGDIFKPKKKEGIPTSTEETSKEEA
FT                   TKPLNEAPVVASEAPKLEQPVATAPLELEEEPKATQPPAAAPVAASA"
FT   CDS_pept        join(932118..932144,932856..932990,933046..933240,
FT                   933294..933395,933446..933615,933674..933764,
FT                   933816..934031,934087..934137)
FT                   /codon_start=1
FT                   /gene_family="HOG000138313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581879"
FT                   /locus_tag="CNC02870"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42276.1"
FT                   /db_xref="HOGENOM:HBG176011"
FT                   /db_xref="UniParc:UPI00004B4444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI7"
FT                   /transl_table=1
FT                   /translation="MSATEQVNQAPAETANALVAEATPPSQEAKEIFKAQEPVSEVAAP
FT                   NITEPLVKEQPTVANTEAGTAQPGPELGNKVDNTEADKLVEGTTTGEGAKTTEEVPKPS
FT                   EIKEGKKEVKKSAVKERTEKTKAEGKGFFAKFFGNRDKSPKKEKKKTPKAEKADPVTAA
FT                   APVETEGDDAAPPSVPTTSEPVIGTSAPIEAVEPTVKSPDTGALKGIDTATSADAPAEV
FT                   APAPEENKIEDKKDEAKDQAAKSNLKAHRRLSARIGDIFKPKKKEGIPTSTEETSKEEA
FT                   TKPLNEAPVVASEAPKLEQPVATAPLELEEEPKATQPPAAAPVAASA"
FT   CDS_pept        join(complement(935130..935388),complement(934717..935054),
FT                   complement(934452..934658))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636609"
FT                   /locus_tag="CNC02880"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42681.1"
FT                   /db_xref="HOGENOM:HBG176012"
FT                   /db_xref="InterPro:IPR017081"
FT                   /db_xref="InterPro:IPR019349"
FT                   /db_xref="UniParc:UPI000042E37A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI5"
FT                   /transl_table=1
FT                   /translation="MSLSAPTRILRKPTLSRQFSTSLPVLASRGSSKPEGLGARSRPWS
FT                   VQNVPKFAFDDATSLGWMRMFRIQEGEGLVRKIEEDREALRTANQTKFTPPTAPIRLTS
FT                   TIDLARPDSRYHTKCVLLVPIAALPLSTPEAVHRFKLLAGPRWTPGKPGRNEFIKDENS
FT                   DGENGWIKVSEERFESARQNRRSASDILERLVNAANDRESPLPADLPIDTRHLLARHRK
FT                   KRSRQNTFKWAPGQEFLSRHQEVGGVRGFPVSWLPEELRERVSKK"
FT   CDS_pept        join(937170..937460,937663..937952,938014..938224)
FT                   /codon_start=1
FT                   /gene_family="HOG000187763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806582"
FT                   /locus_tag="CNC02890"
FT                   /product="Phosphatase activator, putative "
FT                   /protein_id="AAW42279.1"
FT                   /db_xref="HOGENOM:HBG176013"
FT                   /db_xref="HOGENOM:HBG324369"
FT                   /db_xref="UniParc:UPI000042C102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI4"
FT                   /transl_table=1
FT                   /translation="MAIPASSNPITSVSPNSSPITSVSPNNYAASPLYPSATNPQLLSR
FT                   LNLDLRGTIFPVEREMLMLLPESVLLGLFPQGLILSKPASWEGADDGIFTVDRIPTIDA
FT                   LSDHSQNPLLSKQAIIVLREELEYFSITKPGAAARTDIATGLANEDLRVLKRNCGRALE
FT                   EKKAIFAALERNVNNSANLAERHLIDMLCVSGFNRDDEWGYRACEPQRNVISSMALVLL
FT                   KTGINHREDDKEGPPEIDPVQMGTAQKLLLFWRKPAVRMLP"
FT   CDS_pept        join(complement(939633..939676),complement(939322..939376),
FT                   complement(939153..939266),complement(938973..939062))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806583"
FT                   /locus_tag="CNC02900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42680.1"
FT                   /db_xref="HOGENOM:HBG176015"
FT                   /db_xref="UniParc:UPI00004B4445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI3"
FT                   /transl_table=1
FT                   /translation="MRPTAPAHSGMPGRKLVGGVTWEDPSKRVSRHMVSPLTANAPLPV
FT                   CSVPMSSTVPSERCNNFLTSPPLLFSSTASTTGQRPSTTTTTPSRATMTTSSRRV"
FT   CDS_pept        join(939748..939876,939957..940069,940117..940216)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942387"
FT                   /locus_tag="CNC02910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42281.1"
FT                   /db_xref="HOGENOM:HBG067599"
FT                   /db_xref="HOGENOM:HBG176016"
FT                   /db_xref="UniParc:UPI00004B4446"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI2"
FT                   /transl_table=1
FT                   /translation="MRRRRFGKLRVCACGLAHPHIFTLPLPPRLPLPLPPTNHVPPHVS
FT                   HAARTALTPPAFHGHAYAAIGFGVLGAGAYHVDQKQTALLAKKKKAMLEQREIENREWA
FT                   ARKGEAHAV"
FT   CDS_pept        join(complement(942579..942756),complement(941794..942522),
FT                   complement(941667..941725))
FT                   /codon_start=1
FT                   /gene_family="HOG000208969" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093373"
FT                   /gene_name="DRE2"
FT                   /locus_tag="CNC02920"
FT                   /product="Fe-S cluster assembly protein DRE2 "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="metal ion binding"
FT                   /biological_process="apoptosis"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="AAW42283.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG067598"
FT                   /db_xref="HOGENOM:HBG176017"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="UniParc:UPI00004B4447"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKI1"
FT                   /transl_table=1
FT                   /translation="MPAPVPPTAFAQPSGPATQLVLGSMQRAPEYQALLTSLKSAAPPS
FT                   SSVQGEMVDRILDNATTLPPPPLTIHLVLPLPLPSNLLSAIPPSTQIFIHIPADSESQL
FT                   GALHSALASHSFTPVLPTPSPSTLAYTSPSAPSLPAVASEPSPAPSSSTPVTLSGARPL
FT                   QLRRNGDKARKAALWAIDSPLIPDGGKSLLTPADRTRPDCVFPAENGKPVKRRRACKDC
FT                   TCGLKELEQEEEAQTSAAVQEAQKAFFLEGDDDIPENLKKATEGMEGIWPADKRAEAKK
FT                   TSSCGSCYLGDAFRCSSCPYLGLPPFKPGEQVQVSIGDDI"
FT   CDS_pept        944296..944523
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806584"
FT                   /locus_tag="CNC02930"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42633.1"
FT                   /db_xref="HOGENOM:HBG176018"
FT                   /db_xref="UniParc:UPI00004B4448"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKI0"
FT                   /transl_table=1
FT                   /translation="MTSIAQPINFPSRPSYSTTASPSNSPSRSNSYDLSSSPKMGSSPG
FT                   QHPCPHLSEFVQSLYKAWGSKSDIQERRRW"
FT   CDS_pept        join(948350..949306,949361..949466,949529..949728,
FT                   949781..950160,950218..950752)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806585"
FT                   /locus_tag="CNC02950"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42285.1"
FT                   /db_xref="HOGENOM:HBG067596"
FT                   /db_xref="HOGENOM:HBG176019"
FT                   /db_xref="UniParc:UPI00004B4449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH9"
FT                   /transl_table=1
FT                   /translation="MTSMIHTQSFDGGRTQGGLHTSPAASPRSDRPHSQSSLHIAPQST
FT                   YSPPLPTQSPHPISAYPVQAYRPYPQGVSLQLPNLMNSTYPSTAPALPFYPAGPTPMYD
FT                   SRGPQQMIRTISHAHPMNSATEQTISSRYSSSPHSVHEHLGDAPSITGGDQPNPWGHPA
FT                   FHVQTEDDRSINPSMFGPGGDYSMSRSTSGASDSGHDTMRLLTPSLDYRPDRRSPHELD
FT                   LRKVSDSLGDKKHFSQVAFTPHFDLQSHSLGLGPHPQPENMFFGDRGYSNTSFNLSSER
FT                   IAGKDTDLTGETEYERERAEQIVNNRKLLEDVGLGSHSLSFGSRHMSGTKGSDSKKNRK
FT                   VSTPAKKRLQLEGPVRASPRIRSMGRNISYANLDGGSASDNDEYSSEQDPEEEEEFRPS
FT                   KRSRGQMGFRQKSSSYSQSSNKASSKPQLSLWGLLQVYPEIPHLFPLFYYTLNNDLTIN
FT                   SDSVPLIGSIPSNCTPVAKAETLQAYFHRGRRVLSQLDAFTSRCDRKYEGPEVRWPELD
FT                   YHTRIAIRDVRRKVVERCENYKYTRRDILDKHVGKGKWQSIEQGMIEWRAGMTVNDPAN
FT                   DLANVTLTLPTPPPNAYGHQIRQQPTPALYSDRVFKPFPQGRRPTSIAPRTVSVMMAEP
FT                   DEQAPFTYPPTANSAVEFYGYAPQQPPIPPMYGEDQVPMSVQMPESVTAGPTGASLDQA
FT                   NKEASASWGESRGLKRARDDDQVGVSNDNEG"
FT   CDS_pept        join(951379..951411,951489..951709,951764..951800,
FT                   951857..951995,952046..952127,952177..952431,
FT                   952480..952814,952866..953032,953089..953698,
FT                   953755..954464,954533..954677,954787..955325)
FT                   /codon_start=1
FT                   /gene_family="HOG000205990" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942388"
FT                   /locus_tag="CNC02960"
FT                   /product="ATP dependent helicase, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nuclear-transcribed mRNA catabolic
FT                   process, nonsense-mediated decay"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42287.1"
FT                   /db_xref="GO:0000184"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG034953"
FT                   /db_xref="HOGENOM:HBG333519"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="UniParc:UPI00004B444A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH8"
FT                   /transl_table=1
FT                   /translation="MEFSNFEGASQYGPDIDDNTSLYSSIPPSVVTAPTISGDIASQLG
FT                   DLNLGETTSGHAAAGQVYIDDFDEEIERNSFGEGVEHACSYCGIHNPQCVVKCLHCNKW
FT                   FCNSRGNTSASHIVNHLVKAKHKEVILHKESALGDTIPECYNCGSKNVFMLGFIPAKSD
FT                   TVVVLLCRQPCAALTSSRDINWDTSQWSAIIDDRQFLSWLVKVPSEAEQLRARQISLAQ
FT                   ISKLEELWRENPNAKLEDAEAQSGEEEMQPILLKYEDAYQYQNILGPLVKVEADYDKRM
FT                   KESQTENDITIRWDMGLNQKRLAWFCMPKLESGEVRLAVGDELKLKFAGTTSSVGIKGL
FT                   QAFNKAGWGSSGDAVWEGVGSVVKIPNNASDEICLELRRNDGVPFDCTHGFSVDFIWKS
FT                   TSFDRMQAAMKTFAIDEKSVSGYIYHKLLGHEVEPQVLRTQMPKRFAAPNLPELNHSQM
FT                   SAVKAVLQKPLSLIQGPPGTGKTVTSASIVYHLAKMNPGQVLVCAPSNVAVDHLCEKIH
FT                   QTGLKVVRLAAKSREALDSSVDFLSLHSQVANADTHHELQKLIQLRNDQGELSQSDERK
FT                   YKALVKACEKDILNAADVICTTCVGAGDPRLAKFKFRTVLIDEATQSAEPECMIPLVMG
FT                   CKQAVLVGDHQQLGPVIMNKKAARAGLSQSLFERLVILGNHPIRLQVQYRMHPCLSEFS
FT                   SNLFYEGTLQNGVTAPERLRKHVDFPWPVADTPMFFHQNLGTEEISSSGTSFLNRTEAS
FT                   NVEKMVTKFFKSGVLPNQIGVITPYEGQRSYIASYMQLHGSLKKDLYKEVEVASVDAFQ
FT                   GREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGVVILGNPKVLSKHPLWLYLL
FT                   SHYKEKGCFVEGPLSNLQPSMVQFSRPKKSLAAAMDPFKRHMGHGQAQSAAANRFDPAY
FT                   YRTHNPLSFIPSDAQSVVSQAMTSSAFPLFGGVGGGVGGGGGGGKNKTYTGYASSVVSQ
FT                   QPIDGGNASAFAPPRAGQSQFDRFASIVGSAGSAGSAGAGGAGVGAGGGGGGGGGNVMM
FT                   GKGRRLSIGSEAASASMYAYGYKAGEDDTQSIAPSQAGMTEF"
FT   CDS_pept        join(complement(957281..957362),complement(957077..957237),
FT                   complement(957006..957017),complement(956815..956950),
FT                   complement(956579..956760),complement(956370..956519),
FT                   complement(956290..956311),complement(956091..956204),
FT                   complement(955950..956011),complement(955804..955806))
FT                   /codon_start=1
FT                   /gene_family="HOG000165141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806586"
FT                   /locus_tag="CNC02970"
FT                   /product="Oxaloacetate carrier, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42638.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00004B444B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH7"
FT                   /transl_table=1
FT                   /translation="MTQPQQPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGELQ
FT                   RNDPSAPRVYRNVLDVFRKTWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCRRLFN
FT                   RAIGKDPNEGVFITAITAGAVTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYKNSY
FT                   DALRTILKSDGFFGLWRGVSTAILRTAMGSSVQLPSYNLSKYYLVSSAGMASDSFWTFL
FT                   AASSVSGVCVCIAMQPPDTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTFKAEGI
FT                   AGWYKGTTAHFLRITPHTIFTLVFNE"
FT   CDS_pept        join(957390..957413,957497..958213,958261..958775,
FT                   958833..959286)
FT                   /codon_start=1
FT                   /gene_family="HOG000205412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093374"
FT                   /locus_tag="CNC02980"
FT                   /product="Small nuclear ribonucleoprotein hPrp3, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAW42639.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG033530"
FT                   /db_xref="HOGENOM:HBG396175"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="UniParc:UPI00004B444C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH6"
FT                   /transl_table=1
FT                   /translation="MHVEIAMDRPGSPAAPPPAKRPPPAAPLDIAAIRAQLAAKKAALQ
FT                   PPPGPAALPPQPPVHADVAHKLAAAKARIEALNARAANPYLSGAPAPAPAPAAPQPGVT
FT                   SIALHPLLMGGDAQQPAAQADRNEKRAMRDRYKTMAPKFTSVRANASAAASQAPSRASP
FT                   AVTAAPVLNPYASASAANSPAPDEERAPTRKSKKLQFSRAGKYVEQGEQLRNEQKMEAL
FT                   RQRIAEASRKAGLDSEFDTLERSLKRQPPPAVEWWDEAILPKGVTYEDDLESAYNNLST
FT                   SSDSLITHLVLHPIPIPAPMDRRQPERGLMLTKKEQKKMRRQRRQAELEDKRDRQKMGL
FT                   LPPDPPKVRLANLMKVLTSDAVQDPTKVEAKVRKEVAMRAYKHEKDNQERKLTAEERKE
FT                   KEYSQMVARERNGIRGAVFKIKYLTNGRHKFKVRETAKADLLSGICIFHPSFALVMVEG
FT                   VEKSIKHFKRLMLSRIDWTEQARPMADGDGGEDAPGSDEDMDGRTNSKEGEQDLADNKC
FT                   ELIWEGELPERVFKMFRARHVETDSKAKEWLTPRFEAMWDLAKRWQWAGEDL"
FT   CDS_pept        join(complement(959933..960071),complement(959723..959847),
FT                   complement(959540..959635),complement(959436..959474))
FT                   /codon_start=1
FT                   /gene_family="HOG000228133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806587"
FT                   /locus_tag="CNC02990"
FT                   /product="DNA-directed RNA polymerase i 13.7 kDa
FT                   polypeptide, putative"
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW42637.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniParc:UPI000042E379"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH5"
FT                   /transl_table=1
FT                   /translation="MAPTRVSAHRIGSLLFCPACGTLLDLPKDDQNEIACSQCGRLEPA
FT                   SSYENLPTKTYSSPNAFPSSLRSKRALVQNKLDAGEAAKGRDPAQEKCQKCGHIGLSYK
FT                   EMQLRSADEGSTIFYKCLNCGDQTSTNN"
FT   CDS_pept        join(960552..960614,960689..960755,960812..960862,
FT                   960927..961222,961291..961320,961379..961441,
FT                   961503..961572,961637..961740)
FT                   /codon_start=1
FT                   /gene_family="HOG000204343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806588"
FT                   /locus_tag="CNC03000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42289.1"
FT                   /db_xref="HOGENOM:HBG067595"
FT                   /db_xref="HOGENOM:HBG435203"
FT                   /db_xref="InterPro:IPR010422"
FT                   /db_xref="UniParc:UPI00004B444D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH4"
FT                   /transl_table=1
FT                   /translation="MAPKGGNAKKESGRAKKAENEEKKKTAAEKSKEAKEADEWKSGSK
FT                   GASKTDAAAAKAAEAARKKAEREALLAAEEASLQSKSKAAPKAGAKKKPADKLVATGTG
FT                   VAGYSVSDPLNLRKAKGPDGEPEEVKELSAKGIDEMLEALELVNQKTDKATVGSKAEIM
FT                   VDPHPERRFKAAFEAYLDREMPILKQEHPGLRQNQMRDMLYKQFQKAPENPFNQAKIAY
FT                   NATKDEKVEAYKKIMESREAKFSRA"
FT   CDS_pept        join(complement(962450..962644),complement(962257..962393),
FT                   complement(961925..962195))
FT                   /codon_start=1
FT                   /gene_family="HOG000184344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806589"
FT                   /locus_tag="CNC03010"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42291.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniParc:UPI000043029F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH3"
FT                   /transl_table=1
FT                   /translation="MRIEKCYFCSANVYPGHGTMFVRNDAKCFRFCSSKCHKNFKMKRN
FT                   PRKVRWTKAFRRANGKEMVVDTTFEFEKRRNVPVRYDRELVATTLKAMERVAEIRQKRE
FT                   KAFWKNRMSGNTAKNMRDSALEIERHIELVQPRSATAVSTSKASEALEQREKVREKIKV
FT                   RAAGRKAMALQQMGQGKKQKESRLIPAEGSGMGMSLD"
FT   CDS_pept        join(962990..962995,963049..963096,963143..963181,
FT                   963232..963239,963346..963373,963425..963554,
FT                   963603..963705,963760..963958,964010..964234,
FT                   964285..964554,964613..964649,964703..964704)
FT                   /codon_start=1
FT                   /gene_family="HOG000283479" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI19789275"
FT                   /gene_name="MPG1"
FT                   /gene_synonym="PSA1"
FT                   /locus_tag="CNC03020"
FT                   /product="Mannose-1-phosphate guanyltransferase "
FT                   /EC_number="2.7.7.13"
FT                   /function="GTP binding"
FT                   /function="mannose-1-phosphate guanylyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42293.1"
FT                   /db_xref="EMBL:AAR84601.1"
FT                   /db_xref="EMBL:AAZ22401.1"
FT                   /db_xref="GO:0004475"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG495575"
FT                   /db_xref="HOGENOM:HBG688195"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI00004B444E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKH2"
FT                   /transl_table=1
FT                   /translation="MKALILVGGFGTRLRPLTLSWPKPLVEFCNKAMILHQIEALVKAG
FT                   VKDIVLAVNYRPEVMVSVLKKTEEEFGINIHFSVETEPLGTAGPLALAREILGKDDSPF
FT                   FVLNSDVTCVYPFEAFRDFHIAHKCEGSIMVTKVAEPSAYGVVVTKPNSTVIDRFVEKP
FT                   VEFVGNRINAGIYIFNPSVLDRIELRPTSIEKEIFPAIAADQQLHSFDLQGFWMDVGQP
FT                   KDFLAGTCLYLSHLTSQHSPLLTDPSQNKWVYGGNVMVDPSAEIDPTAVIGPNVVIGPD
FT                   AKIGPGVRLQRCVIMSNATVRDHSWIANSIVGWNSTVGRWTRVENITVLGDDVTIKDEL
FT                   YVNGASVLPHKSISTSITEPRIVM"
FT   CDS_pept        join(965052..965306,965371..966507)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806590"
FT                   /locus_tag="CNC03030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42634.1"
FT                   /db_xref="HOGENOM:HBG067594"
FT                   /db_xref="HOGENOM:HBG176022"
FT                   /db_xref="UniParc:UPI00004B444F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH1"
FT                   /transl_table=1
FT                   /translation="MAHPPRPTPAPNRHTLPLHKRQSYVTVSVVANDTDTSSTTPANSS
FT                   SGSSFPVAIAIPALVGGMAVAIAVFGFWWWWSKRSKRVKRERWEAAQRRKNKRHAAEKD
FT                   KPTTHPGQSQKSPTGEKAFNPILPPLSTAQPYYPPPQTNGYGYAPSQQGYAAWQTQPGI
FT                   EQVQYGQQASPSPQQGYYSPPAYAQGSAPPLSRDYSSESTIPLTQNTTPPATSPTSPTS
FT                   SRSSSNSSSTGGGRKPSGNIPPPRRSSSDEKKSSTPSSPSPSSSPSKKSSKNSKNSRAT
FT                   ARMAVAESAAANASMNRMFRHKPSKPSPLAIKAQQEREALAATTDPLSRISADETSNPF
FT                   NTESEGLYPTAADSSRANAPSGEWGVALGSPDEEDTFADSQAAVLDSGLYHGAKSSYSE
FT                   DPYIEKKAQTKSGMYSQDPYALYHEQEEEKEEEVEDADRYHNAAESMGLGSASKNKKRD
FT                   VGKWV"
FT   CDS_pept        join(complement(970102..970266),complement(969451..970062),
FT                   complement(968506..969396),complement(967105..968445))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789276"
FT                   /locus_tag="CNC03040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42295.1"
FT                   /db_xref="HOGENOM:HBG067593"
FT                   /db_xref="HOGENOM:HBG176023"
FT                   /db_xref="UniParc:UPI00004B4450"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKH0"
FT                   /transl_table=1
FT                   /translation="MGLATPPPHLVALLANTRTPANYATDALEEWIAHRRAKGDSLFNI
FT                   SLALAHLEDITPPHTAHLFDRARYLTNVPQPQDLTPPVGPFPLARSASLATILNHLLAT
FT                   PPPSIQHSREVILEYVLARESKLKEKKPGRAGKGTMGREGFEDIAKRMSELEDSLRENS
FT                   ASSPPTSPSRDVYPSPRRSTRASQGQLLNENQQIGLTLILSLRMSLSYFALQELANQLM
FT                   LVTLGDAERMLIQHIRRRVPGEGRWGVGKELEYVEGLTLSRRPALRPAFRSAKARTLLP
FT                   PKPLYPIQLPAPSKSQCIKQIQALAKEIEAGGPAAGQEFLHAHEPSGISAPVFNTPNSE
FT                   KYFLGRRSANASPTVKAIFAREGSPQTPLSNLPPALGTPAGSPAQVSQPDPNILANFTM
FT                   ELISEFITREKREQMLKSKWAKTGRAQVSKDLGEIEAALCLVSKNNASSIAPLLLPTFL
FT                   LLRRTFALPPSPLPQAITEPYIDILPAPPDPDDVPFREPTVSSTTAALYVNPRLNDDKA
FT                   YDALEELAEFEKEKVDAAGGTRQQMIDWAFSQIEAVQKRFPDGSYKQVFNRMKDNLLQQ
FT                   RRPEEHYQSISFAKSPSIHRRVKSNAFPSGLSDSEAGSPVAVDPLKAQHTRSLSMPDRK
FT                   APYDSDSDSEEDVSLVQRSTPADQPPLTPATSVPSSKPLPDVERSFPQLPPLIVTPMNI
FT                   GDRRSSAASASAAPSSGGGGGGGGWWDVVSAVAKEDSSSNTAPWDTTPEKRSNEPTSHV
FT                   SQLSTDSRRDGLALNINDPARNIAAPLPPGAEPAQALDFTRPMMSLDLNSPVSQAKPPF
FT                   SAPVSPQREAQYLPGQTVRLVETTGLGFAPSSPPYGYTQRQDEDGILPPPPPLRFDQSR
FT                   GGHTLGSSTTPSAHSSSLTAEPTPTSTALNHSALSSGPSYPAPSNASPTVAQGPAPHPA
FT                   GPFVSSSTTTKSKLGSFGRSMSLVRRKSKKEKEKEKDGEKEGKDKNKKERVLNDPGKWN
FT                   RDLVANIMGPPAR"
FT   CDS_pept        join(complement(973688..973718),complement(973437..973636),
FT                   complement(973154..973375),complement(972913..973103),
FT                   complement(971867..972843),complement(971535..971803),
FT                   complement(971341..971475))
FT                   /codon_start=1
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093375"
FT                   /locus_tag="CNC03050"
FT                   /product="Putative uncharacterized protein "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="AAW42297.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000042C6D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG9"
FT                   /transl_table=1
FT                   /translation="MLDHISISHQSGLVLWSRAFTPAFETLANTPNSPINALVKSTFIE
FT                   GKAMTNGEEQGLEKDGYSVRWSVDNGLGLVFVVVFPALLPLTYVPALLERTKALFLALF
FT                   QPYVTSLIESLSSGGASAGSALKQLKEKIVEERWDEVWDRCFRSCEGEKKSRSTLVKQR
FT                   VSDRTNPAISSADTSDVDVGSQSALSAEEIAKNVQSLKAKMKGGKRRGVRDGLSPSPSP
FT                   SPSRKPPSNATSKLMRRWGDTPVTAEDMAALDYSTPAPDSSANDTAHVDKESLISSEAL
FT                   GTRNDTGAYQVADWDFRRAPASSHESLPSEEEIIARGTSRLSLNRPTDDGSNQSSWTSM
FT                   FSRLTGSKILTRNDLEPVLIEMEKHLMSKNVAKDIAEKLCNSVGAALVGKKLGGLNSVK
FT                   SEVQSVLSTSLTRVLTPKTSTDILLEIQRKRSSHLATLSTTSSPLDSGPDPYTLTFVGV
FT                   NGVGKSTNLSKVCFWLLQNGLRVLIAACDTFRSGAVEQLRVHVRNLGALGEEMGQGQGK
FT                   RIELFERGYGKDAAGIAKDAIAYAKEHAFDVVLIDTAGRMQDNEPLMRALAKLVTVNNP
FT                   DKIVFVGEALVGNEAVDQLTKFDRALRDFSGAGVGGVARKRGIDGIILTKFDTIDDKVG
FT                   AALSMTYITGQPILFVGCGQTYTDLRQLRVNHIVQALLS"
FT   CDS_pept        join(974126..974282,974331..974542,974591..974885,
FT                   974939..975082,975139..975209)
FT                   /codon_start=1
FT                   /gene_family="HOG000034184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806591"
FT                   /locus_tag="CNC03060"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="proton-transporting ATP synthase
FT                   complex assembly"
FT                   /protein_id="AAW42299.1"
FT                   /db_xref="GO:0043461"
FT                   /db_xref="HOGENOM:HBG176024"
FT                   /db_xref="HOGENOM:HBG737593"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="UniParc:UPI000042D998"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG8"
FT                   /transl_table=1
FT                   /translation="MASLRISARPVLAALMPVPRIYRPAAVCARTFSTSFARWAVVKDG
FT                   PPVTQTNRAEQTLRRFWKTVNISATPSDGYLITLDHRALKTPFGAKLEIPKERGLLAAL
FT                   IANEWENQDEVLKQHALPVTSLASRAIDGLSEGPTRPAVIEALLQYLETDTILYPDDAP
FT                   PPLVRLQKKHWDPLYEWLKEDFGVELQLAQGFDAVKQSDDNMEKLKRVVETMDGWELAA
FT                   FERAVYATKSFVIALALCRGRLTAHEAAQASHVEVSSQIERWGEVEDTHDVDYQDIRRA
FT                   LGSAACLLIKS"
FT   CDS_pept        join(complement(976189..976239),complement(976008..976139),
FT                   complement(975376..975956),complement(975269..975314))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806592"
FT                   /locus_tag="CNC03070"
FT                   /product="Ribosomal protein L1, putative "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42301.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG067592"
FT                   /db_xref="HOGENOM:HBG176025"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI00004B4451"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG7"
FT                   /transl_table=1
FT                   /translation="MISSSIRVSGRSLAQVIRPAVASASFSTTATAGARVQKKQSKKKV
FT                   ASPDALSASEAARVLRALEVAHPTSTYSLTLHTKSHKSALPIRGSFTLPLDPRRTSETI
FT                   LVFAEPSSPSATLAKEAGAAYVGGDELFEPVLSGKIHPTRCLATPGMMPAVTRTLARFL
FT                   GPKGLMPVAKRGGVAEGEELAERIRDAAGKMEYRADKQGTVKVNVARVDFGIPSVENNI
FT                   KSFIQTVRDNQATANQTDDPLAAAGKSKKKKGTLIHHLCDLGINKWT"
FT   CDS_pept        join(977134..977355,977481..977562,977609..977769,
FT                   977817..977906,977962..978601,978660..978893,
FT                   978943..979066,979116..979206,979261..979283,9
FT                   79338..979389)
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806593"
FT                   /locus_tag="CNC03080"
FT                   /product="Pyruvate kinase, putative "
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="AAW42303.1"
FT                   /db_xref="EMBL:EAL22276.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG378296"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI00004301CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG6"
FT                   /transl_table=1
FT                   /translation="MVLGHFSPQTNTTVPPPPHPSAFVPLFQTNTSVVSGKPNAFSTMA
FT                   GTPSSQLAWLSGLSTNFNEMSADQKFLRKTSIIATIGPKTNNVETLVQLADAGMNIVRM
FT                   NFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEIRTGLMKDDTDVPISAGHE
FT                   FWVTTDKAYAEAGTAEHIYIDYTNIVKVTAPGKLIYVDDGILSLQVISIQGEKIRVKSL
FT                   NSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGVDMIFASFIRSANDVKEIRKV
FT                   LGPEGADIKIIVKIENEQGVMNFDEILRETDGVMVARGDLGIEIPASQVFMAQKMMIAK
FT                   CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVIDGADCIMLSGETAKGKYPIEAV
FT                   KMMAETAFLAESSIAYPPLFDQLRALTPRPTETAETLALSAVAAAIEQDAGAIIVLSTS
FT                   GVSARLISKYRPACPIICVTRNEQTARQLHLSRGVYPVWFPEPRGIPAEKWQIDVDNRI
FT                   RYGLRMALGLGIIKPEATVMAVQGWKGGLGHTNTLRILSVPSDPADLDLHSIERD"
FT   CDS_pept        join(977263..977355,977481..977562,977609..977769,
FT                   977817..977906,977962..978601,978660..978893,
FT                   978943..979066,979116..979206,979261..979283,9
FT                   79338..979389)
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636610"
FT                   /locus_tag="CNC03080"
FT                   /product="Pyruvate kinase, putative "
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="AAW42304.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG378296"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000042D58D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG5"
FT                   /transl_table=1
FT                   /translation="MAGTPSSQLAWLSGLSTNFNEMSADQKFLRKTSIIATIGPKTNNV
FT                   ETLVQLADAGMNIVRMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEIRT
FT                   GLMKDDTDVPISAGHEFWVTTDKAYAEAGTAEHIYIDYTNIVKVTAPGKLIYVDDGILS
FT                   LQVISIQGEKIRVKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGVDMIF
FT                   ASFIRSANDVKEIRKVLGPEGADIKIIVKIENEQGVMNFDEILRETDGVMVARGDLGIE
FT                   IPASQVFMAQKMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVIDGADCI
FT                   MLSGETAKGKYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAETLALSAVA
FT                   AAIEQDAGAIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGVYPVWFPEP
FT                   RGIPAEKWQIDVDNRIRYGLRMALGLGIIKPEATVMAVQGWKGGLGHTNTLRILSVPSD
FT                   PADLDLHSIERD"
FT   CDS_pept        join(980537..980659,980749..980875,980933..981071,
FT                   981134..981199,981334..981559)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806594"
FT                   /locus_tag="CNC03090"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42635.1"
FT                   /db_xref="HOGENOM:HBG055821"
FT                   /db_xref="HOGENOM:HBG067591"
FT                   /db_xref="UniParc:UPI00004B4452"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG4"
FT                   /transl_table=1
FT                   /translation="MPSIAGKLVNKVLKDHISKQAPEDPLYTVTVNSKGKSKRQVRPLP
FT                   EGLSKRDRKALKKIRKRAHYLDKGMNICGFRVGWTFFIGIIPGLGDAVDAGLNYCLVVK
FT                   PAKKLDIPDSLVHKMLFNNAISAGLGLVPIAGDIFLAAWKANSRNAALLEAYLTIRGQE
FT                   YIAALRREPGVIDPAEAIAHGVPPEDLRDQFGPGAGMDHPVEDEESNRGFFGGRKSKKE
FT                   VTKK"
FT   CDS_pept        join(982655..982673,982730..982914,983000..983056,
FT                   983111..983179)
FT                   /codon_start=1
FT                   /gene_family="HOG000245859" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942389"
FT                   /locus_tag="CNC03100"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42636.1"
FT                   /db_xref="HOGENOM:HBG176027"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniParc:UPI000042C6D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG3"
FT                   /transl_table=1
FT                   /translation="MTIIHVVAFKTATPSTIGPLTTSIKALKDNCINPRTGKPYILDLR
FT                   GGKQISTEGLDRGMQVVFVLEFENDDDLQYYIDEDPAHEQFKKSAKGEWEAIDVLALDF
FT                   SNGKF"
FT   CDS_pept        join(complement(985823..985882),complement(985515..985591),
FT                   complement(985373..985432),complement(985212..985236),
FT                   complement(985068..985163),complement(984911..985008),
FT                   complement(984676..984849),complement(984610..984625),
FT                   complement(984390..984480),complement(984152..984243))
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806595"
FT                   /locus_tag="CNC03110"
FT                   /product="Putative uncharacterized protein "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="AAW42306.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniParc:UPI00004B4453"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG2"
FT                   /transl_table=1
FT                   /translation="MPIELDLDSILQFAIKLALDLVTEVDKAVEKFIVERIREAYPSHK
FT                   FIGEESYEGQQITDEPTWIGDPIDGTTNFVHGFPMVATSIGLAHKGIPVVGVIYNPFLD
FT                   QLWSAAKGRGAYLNQKRKLPITGSSKPLASLGQALIGVEYGMSRSPPALPRKLAAFEKL
FT                   TAHTDVGGKMCHSLRSMGSAALNIVLVASGGLDIYWEVGAGICILEESGGRCFGAKTAD
FT                   LSGEVDAKLMEIVLLQKETSLDQQKKFIKEFYDCVEDFDP"
FT   CDS_pept        join(987901..988059,988133..988259,988311..988414,
FT                   988467..988520,988573..988655,988713..988755,
FT                   988806..989032,989090..989193,989319..989355,
FT                   989425..989613,989667..991537,991590..991861,
FT                   991922..992039,992090..992163,992222..992280,
FT                   992336..992429,992479..992626,992678..993224,
FT                   993272..993333,993392..993657)
FT                   /codon_start=1
FT                   /gene_family="HOG000186574" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636611"
FT                   /locus_tag="CNC03120"
FT                   /product="Transmembrane protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42308.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176028"
FT                   /db_xref="HOGENOM:HBG735770"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00004B4454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG1"
FT                   /transl_table=1
FT                   /translation="MPFIKALDHAIPNGQTFNNLAKAPGAVAGGLTSAVGSVGNMVGVE
FT                   QVRGAAVHMFDPDASPAVKAAAAAKAKASLGLPSRDKVREGISGDGGGARAVIIDSSTS
FT                   ANAPKPTVTLADIDKASQAEGQREGSDDMPGSIPSNTAPSIPTWVMAGWKQAAGLGKTA
FT                   TAREEATVLQTYLTETMYGAWYHNAAVILFAILSTRLLTVLHLDWGWIIVVLAFCSSYY
FT                   SISISRTRQRVRDDIQRELVKTRLVTETESADWINSFLERFWLIYEPVLSQTIIASTDA
FT                   ALAGVAPPGVDSIRMTTFTPPRIDYVRTFPKTPEDVVIMDWALSFTPNDLEDITPRQAA
FT                   KQVNPKVVLSIRVGKGALSKALPVLLEDMSFSGKMRIKLKLMTNFPHVQTVDISFIEKP
FT                   TFDYVLKPIGGETLGFDINSIPGLAPFIRDQVHSNLGPMMYDPNVFTIDLQQLLSGTPL
FT                   DAAIGVLRVTVLDARNLKATKFGGGDPDPYVSFSIGAKPAIAQTKTIRSSSNPSFHETQ
FT                   FLLINSLADVLNLNVFDFNDHRPDSLLGTVSHELGTLADDAEQEGIVGQILGGGKDRGT
FT                   LRYDLSYFPVLKPEKNADGTLEPLPDTQTGIVRLTIHQAKDLDVSHALLGGGALSPFAS
FT                   VFLGSGKNEVHRTKVLKHANQPIWEDACEFLVPEKHNSVVTVAITDSKDFAVDPSLGMV
FT                   TIRLADLLEAKERHQDWFPLKGSRQGKVRMTAEWKAVAMTGSIGGANSYIPPIGILRVW
FT                   LKRAVDVKNVEAALGGKSDPYVRIMGNNRIMARTEVINNNLNPEWDQIIYVPVHSIREH
FT                   FMLEVMDYQNIGKDRSLGHVDLAARDYIDESGEQKYPYISKGSQDRRDRIKLDKANHFK
FT                   GELHYEVDFKPAVSLRGGVSFDAQKNELEIAAEAAEAQSAAEGASSSVTATVTPEANGS
FT                   IKAASVPSGIVGVDDVTAGDANGHANQSVVDASIAAAALTAEEEDAQPETAAEDPREGV
FT                   IMSTEEILSCQSGVIVFQVISGKLARRGSLEVMFDDGYWPAFTSGKARSNHPTWDQVGE
FT                   GFIRELDFSRVWLRINAADENSKEDVVAEFKCDTKDFLERSINAPYDFVLTEPDGSNRS
FT                   IVQIAARFVPVDIVLQPRESINNMGILRVDVIDAKALHGADRSGKSDPYVVFSLNDMKV
FT                   FKSETKKKTLHPVWNESFETMVPSRVAAKFAFEIFDWDRVGTATSLGGNIIDLAVLEPF
FT                   EATEVSLPVITEKRGEKGTFTFRLLFTPEIIARVRHNTSSFVSAGRAITQIGGVPLGVG
FT                   KGVIHGGGAVAGGVAHGLGSVGGFAGRRIGLIKKKDKLTGKEVVIDPVTGTSVPVAPGT
FT                   EITPAIGESSDVAAGQTSAPVGANLDGAVPGHHATTLPVGESASPQQPGTLGVTVISAK
FT                   DLKSNREGSVKPYVQIKAGGKTVKTEHVKGSAPEWNESFSFNLTPNIKSFSVTVCDHHT
FT                   LGKDPELGEAEVDIWRHIRPAVPDADVWVELSNGTGLLRLKLDWNTGFANPTPMRLGSR
FT                   IRTPSVSSKSLPDSPGRFSMKKSKE"
FT   CDS_pept        join(complement(997714..997864),complement(997182..997657),
FT                   complement(996881..997120),complement(996678..996822),
FT                   complement(996530..996615),complement(996370..996473),
FT                   complement(996279..996318),complement(995849..996224),
FT                   complement(995549..995793),complement(995417..995488))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806596"
FT                   /locus_tag="CNC03130"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42310.1"
FT                   /db_xref="HOGENOM:HBG067590"
FT                   /db_xref="HOGENOM:HBG176029"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="UniParc:UPI00004B4455"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKG0"
FT                   /transl_table=1
FT                   /translation="MTGESSAIRKYDVDFKKTPGTLSITSTHIIWVPKVKDAMDRQSQA
FT                   MNRAINMLASKPENERVSLKIIFKENVPPGGLHFVFTNANTRGDDRKAVQDILIPFVAA
FT                   NKNPTASAPGTPGSSTTPNTPSAATSAVMSDVAKGKRKMNEVTPAGLSTVSTESSPLPP
FT                   AVRSQRRKYNTLRQRVLEKNDALRMLHRDLVLGRQITEEEFWEGREALIQAEEMAYAQK
FT                   PGRPSRLLDDRFDLDAGRRGKTTGGTGVGIKQADNGPVILKLSKELTREIFEEFPVVQD
FT                   AYAKYVPGISETEFWSRYFTSQLWERHRASVRKSANDEISRKKDDIFDQYLEEPDWNLQ
FT                   PRQPMPDRDGVERYLDLAATEEDHGEATSIRDVTMQAGRERSALPLIRRFNDHSKKLLR
FT                   AASAGQTVRNSAFGGDIGIYEEINLEDLHDPSATPAIILDVENAAALDEGDDKLAPTGV
FT                   LPGYSDSELLAMATESASILLDSMPDFSSVCLANPGPFIDDDESQRNPAYEAFAKQRDS
FT                   QAAALATVKDMWSRANAENAVLPVFPEMLFEQIRSCHNSATEFLRQYWSAILPSVPGAL
FT                   GGQTPSAKDAKAAKMASYLKNTSNKIEAIVQTAQITGFDPERVRKALAPTLGAVEVALE
FT                   RERKRVKGK"
FT   CDS_pept        join(complement(999589..999627),complement(999341..999384),
FT                   complement(999097..999282),complement(998991..999046),
FT                   complement(998766..998888),complement(998579..998586))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093376"
FT                   /locus_tag="CNC03140"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /protein_id="AAW42324.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG176030"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00004B4456"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF9"
FT                   /transl_table=1
FT                   /translation="MVGRWADLACANEILEDIAHISNNQFGHFAITKLVSYPNFYKQTC
FT                   EAIINSYPPVATTHHGVNLAKIALTEGGRASFIKYVEAICRQDDGRTPGIVTIATSSIG
FT                   KAHLKSFLTGSYSSLLRSMFEFVRPAVRIAPVFETAKAVTIFFGHYT"
FT   CDS_pept        join(1001795..1001810,1001859..1002063,1002114..1002440,
FT                   1002492..1002591,1002637..1002701,1002754..1003015,
FT                   1003073..1003231,1003281..1003646)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806597"
FT                   /locus_tag="CNC03150"
FT                   /product="Transcriptional activator, putative "
FT                   /protein_id="AAW42326.1"
FT                   /db_xref="HOGENOM:HBG067588"
FT                   /db_xref="HOGENOM:HBG176031"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00004B4457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF8"
FT                   /transl_table=1
FT                   /translation="MQQLLNPFAQKYPDAVDSTLFTQGVCLAFNRSGPFAGHYLAVGNS
FT                   HGTVEIWDVETRGVVRILEGHVKAVEGLSWSRNNRYLLSASSDGTAIVWDLSVLPHPLL
FT                   SPRTPLTGEPHAGPSSARLHTVRFDSPVISASFHPRNSRIILAVLSCGEAVIVDMRKGG
FT                   GKYRLEDVSDEDETAVNRKRISMTCGDFSPCGSRVYVGTSNGMLIVIDPMTRQILQRAK
FT                   LANSGIRQLSFDTSGFHLLTSATDRALRLLHIDPLTLSLSPLHRFQDLINRTPWNSIGF
FT                   SGDAEYVMGGAAHKMAHNVFIWDRESGVLVKVLEGPKEPLIACTWHPTKPIIASITTSG
FT                   DVHVWQTSSPDNWAAFAPGFEELEENVEYDEREDEFDIEDETELNRRKDLEEDIIIDLL
FT                   TPQEDAFPRRARPIISLPSNIIFANDDEQLEAMRFIESISNVAKWADREAAVYEDALVS
FT                   GDGEQEELGEAANGAADGDDWEGFYLSQDLLSDIRSDDAGT"
FT   CDS_pept        join(complement(1005577..1005704),
FT                   complement(1005285..1005498),complement(1005200..1005229),
FT                   complement(1004946..1005135),complement(1004612..1004894),
FT                   complement(1004481..1004562),complement(1004091..1004423),
FT                   complement(1003827..1004034),complement(1003735..1003763))
FT                   /codon_start=1
FT                   /gene_family="HOG000138312" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942390"
FT                   /locus_tag="CNC03160"
FT                   /product="Chaperone regulator, putative "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAW42328.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG336641"
FT                   /db_xref="HOGENOM:HBG738294"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000042FF10"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF7"
FT                   /transl_table=1
FT                   /translation="MSTIVDSRPRGTYIPADCPSCRSEQEYMIPPTFIGGLRVRCSACK
FT                   QLFTHPQPKPSGSSSSSTSKAAPRTRSIGTDKDPLDLAYYDVLGLDSQCTTEEVKKAYR
FT                   RLAIKLHPDKNRDDPDAEEKFKEISVAYQVLSDPELRHKYNEFGQKNGGGMSEPAGGFH
FT                   DPEEVFGKMFGGDRFEVLIGNISIGKDMKEAFQQQHEEDPSDFTIGPNGKPILTPAGAQ
FT                   KKWSREKKVAEEKARQRQARVDQLATHLINKLNIYTEAAKGPQDEMVGASFKEICRLEA
FT                   DDLKDENYGVELLHAIGKTYQAKSSQHLASSQFAPLGWFHGAKSSFNVVSDTVSTLRSA
FT                   MELKAVFERLQRAEQSGMSADELRKLEEQAAEQGMRTMWKGVKLEVESVVRDTCEKVLS
FT                   DPTLPKEKLHSRAVALGLMGEAFLAIRKEGETHGEDFVRVETPASKQREASHTTTHAPP
FT                   PVPPRPENTTSATQDAQLKEKEETLKAAYRAYESKRQGNP"
FT   CDS_pept        join(complement(1007158..1007227),
FT                   complement(1007046..1007104),complement(1006898..1006976),
FT                   complement(1006700..1006770),complement(1006476..1006635),
FT                   complement(1006150..1006424))
FT                   /codon_start=1
FT                   /gene_family="HOG000209141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806598"
FT                   /locus_tag="CNC03170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42736.1"
FT                   /db_xref="HOGENOM:HBG002949"
FT                   /db_xref="HOGENOM:HBG677020"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI00004B4458"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF6"
FT                   /transl_table=1
FT                   /translation="MSPFYSEFWQTANGKFCRVSPWDGVRNHEAKKIMREKMKLGDKVL
FT                   FYHSNCKVPGVFAVAEISKEGYPDSHSRNRDHPYFDPKSKQDSPTWFMVDVRFKRRLDY
FT                   PPTLALIKHLATLSNLPKEVSYIGDRGLEAIKNMSLVNRGRLSVQPVDDAAYNAIVELG
FT                   TKGGWDSFVSVSSQASKSRKAKASESSSELVKAKDNDTLEEKPHKGKKFLPGEDGIFES
FT                   GQGQRRSKRLKRSLP"
FT   CDS_pept        join(1007718..1007765,1007822..1008503,1008553..1008803,
FT                   1008857..1008927,1008975..1009284,1009335..1009765,
FT                   1009820..1010090,1010142..1010183)
FT                   /codon_start=1
FT                   /gene_family="HOG000136000" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806599"
FT                   /locus_tag="CNC03180"
FT                   /product="ATP-dependent RNA helicase, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW42330.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000042DED1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF5"
FT                   /transl_table=1
FT                   /translation="MAAGIDVATPLKKKNKPESQKRRDKKKNKKKRKIQKAKRAAAPKN
FT                   KDWKPDPVLEALKQSTTFRKIDSVKGPKGDRTFEEYDTGTESGGQTTAQVPGDKEKKQQ
FT                   EKREKREKRQRKEERRARREAAITKMGVDMGPGEGTMVVEGIPEPDQVEEQEKNKSMPS
FT                   LERSPTPPPLVAFPLPRLAPAPDASVLARQGLPKGLEDATFIDQSLRVEVEGLSVEGRD
FT                   EALSVNMRRRLNEIGIEDFFAVQAAMLPRLLPLQLIPSPYCPLPDYLISAPTGSGKTLA
FT                   YTIPILEILSQRTICRLRALIVLPTRDLVFQVRETMEALSKGTGLTIGTVTGQHSFAQE
FT                   RKQLVADLDTPLLGGSSKLDILIATPGRLMDHLASTPNFTLQHLRFLVIDEADRLLNQS
FT                   FQDWLTQVLAYTRPPVEPIAPSFKRKPYDTVSSAFMEACGLVDKRGEWCDSSPSICQKL
FT                   LFSATLTRDPSKVAALSLHHPQYYIVQSSSVPALPTSVGEQFALPSSLSEKMLILPPAL
FT                   KPLNLIHLIHHSEFNVDRALVFTKSVESAARLVKLLEFFEDAYVLGGGGGKRLVVEQYS
FT                   GETRAKDKKQLLAEFGEGKVNLIVCSDLIARGIDLPSVSHVVSYDIPLDIRKYVHRVGR
FT                   TARAGRQGTAWTLVEKQEALHFKGMLQNAGHLKAVKKVKVKEDDLSPYRESYEIAMKRL
FT                   KDYYHHD"
FT   CDS_pept        join(complement(1011128..1011290),
FT                   complement(1010981..1011076),complement(1010878..1010933),
FT                   complement(1010598..1010829),complement(1010392..1010534))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093377"
FT                   /locus_tag="CNC03190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42735.1"
FT                   /db_xref="HOGENOM:HBG067587"
FT                   /db_xref="HOGENOM:HBG176032"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI00004B4459"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF4"
FT                   /transl_table=1
FT                   /translation="MAQTTDGQTPSPNSAKSTLEQRRARREQFRNFYGLKSDAAAKIEG
FT                   VNDSKLVDIDSPTFKPAAYYEDLIAKSTLSGLMRTTASLSSDIGRLQGTRHSLVYNHHH
FT                   QLFAAGDTISQLNARTPQLLSVVTNLQQSFSSISQLVDSINIPRIEEQIVVDPEEATTI
FT                   SRRKTQRQLERLRLMVQANESSDRINEFYKIHYEALHSLATEDDLAKKHLEDCEAAIQL
FT                   TSRIVPA"
FT   CDS_pept        join(1011549..1011767,1011824..1012048,1012096..1012212,
FT                   1012270..1012385,1012447..1012669)
FT                   /codon_start=1
FT                   /gene_family="HOG000186751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942391"
FT                   /locus_tag="CNC03200"
FT                   /product="Cap binding protein, putative "
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42332.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG346234"
FT                   /db_xref="HOGENOM:HBG559144"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="UniParc:UPI00004B445A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF3"
FT                   /transl_table=1
FT                   /translation="MTSTAIPPAAVAANNNTLNSALAAEQISSPASPVDKPVDEKKQLE
FT                   EGEIEENPSEGDSQTKTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAMPQ
FT                   GSHGWMADIRKVVSFDSVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQNKNG
FT                   GKWSIQVPKNSESKSSIDRMWLYTMLAAIGETFETASTDSENAPSPTQSDLITGVIVSP
FT                   RPAFYRISIWTREASDVNVLDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGFQTELT
FT                   FDAHKDSEKKVNKNKFTV"
FT   CDS_pept        join(complement(1014299..1014588),
FT                   complement(1013928..1014239),complement(1013829..1013876),
FT                   complement(1013677..1013716))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806600"
FT                   /locus_tag="CNC03210"
FT                   /product="Expressed protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW42334.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG067586"
FT                   /db_xref="HOGENOM:HBG491530"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="InterPro:IPR018351"
FT                   /db_xref="UniParc:UPI00004B445B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF2"
FT                   /transl_table=1
FT                   /translation="MEAELQTYRDQLAYVNLSLESDPSNDDLLKLKAELNELIDLTQQA
FT                   MGHTAAAKGVDAGKEKAKAKGKEKEKEVTNWQDQGPYKAGMDCMAKYKDGKWYPARINA
FT                   VVGSQESPLYAVTFKGYTSSTNLPLSSLKPHDPNAPIPQPQKRRADELTEKEKEKKKKK
FT                   GEKWMETQKQRAEEVKEKKNAWEKFGKKAQKKGIHISGLEGRSVFRTPDNPYGNRGSRI
FT                   WARRDGV"
FT   CDS_pept        join(complement(1018131..1018243),
FT                   complement(1018066..1018077),complement(1017993..1018003),
FT                   complement(1017914..1017938),complement(1017848..1017855),
FT                   complement(1017774..1017804),complement(1017695..1017726),
FT                   complement(1017450..1017640),complement(1017365..1017388),
FT                   complement(1017251..1017310),complement(1017076..1017197),
FT                   complement(1016894..1017020),complement(1016736..1016828),
FT                   complement(1016654..1016666),complement(1016590..1016607),
FT                   complement(1016522..1016536),complement(1016393..1016471),
FT                   complement(1016219..1016343),complement(1016106..1016166),
FT                   complement(1015980..1016046),complement(1015915..1015926),
FT                   complement(1015752..1015860),complement(1015363..1015700))
FT                   /codon_start=1
FT                   /gene_family="HOG000209091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806601"
FT                   /locus_tag="CNC03220"
FT                   /product="Receptor, putative"
FT                   /function="receptor activity"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42687.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG332415"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B445C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF1"
FT                   /transl_table=1
FT                   /translation="MPDPSIPVVGHKTQRKLVGHNLLYSVSVFLSIGVWLFGYDQGVMS
FT                   GIITGPYFKAYFNQPTSTQIGNMVAVLEIGAFITSLAAAHIADNYGRRMTLRTGAIVFT
FT                   IGGAIQTFCVGYNSMVLGRIVSGFGVGMLSMVVPIYQSEISPADHRGLLGSVEFTGNII
FT                   GYASSVWIDYACSFFQSDWSWRLPLSVQCIGGSVLFIGSFVTPESPRYLVDTDQEVEGL
FT                   AVIADFQGKALDDISVQAEYKEIRDAVLADRAVGDRSYRALWRRYKGRVLIAMSSQLFA
FT                   QLNGINVISYYAPLVFEQAGWIGRDAILMTGINALFYVASSLPPWYLMDRAGRRPILLS
FT                   GAVAMAIALTATGWWIYIDQAITPNAVVICVVIYNSAFGMSWGPVPWLYPPEIMPLSFR
FT                   AKGVSLSTATNWISNWWVGVSTPLFQELIGWRLYPMHAFFCALSFILVYFLYPETRGVP
FT                   LEEMDKLFGDESDEDEVDSDFDEVEEAESEISSLVSNPRHRRRSASSSLGPSLPTSRKP
FT                   SPIPSREASSSRGLFGRITDSVNGLIGSTKQQSRSVGYTAVNEE"
FT   CDS_pept        join(1019313..1019843,1019913..1020428,1020485..1020862,
FT                   1020915..1021046,1021109..1021162)
FT                   /codon_start=1
FT                   /gene_family="HOG000229983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789277"
FT                   /locus_tag="CNC03230"
FT                   /product="Long-chain acyl-CoA synthetase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42337.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG519036"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00004B445D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKF0"
FT                   /transl_table=1
FT                   /translation="MTSLNSFPLLERIIARAQSAPASEAIVDVPHSLTVTYSELCGDIL
FT                   SLGSILTSFLSVPETRVVVLCDKGYLVPLSMLSIWTAGGLSVPVLPSLPLPEQAYMATN
FT                   SDASLVICDANNKPRADELKADMEKEGIKTTVLEISLNGVRKAAYDKSGVETLSKMSEL
FT                   HSERRAMMLFTSGTTGRPKGVVTRHSALGAQVSAVVQFWRWTSTDNLLHILPLNHLHGI
FT                   VVALLPALWAGATVELWEKFDARGIWMRWINNEGKTPITMFFGVPTLYSRLIQSHPMLP
FT                   KELQPIASEASSKLRLQVSGSAPLPESIKKTWEKEGGIGGGQVLLERYGMTETGIIAST
FT                   GWENDKRVKGHVGYALPGTGIRLWNEDLNQSITAFDTQGEIQVRGPSITTEYWRLPEAT
FT                   AKEFVDGWFKTGDIGVWSSDTAAQNQLKVLGRKSTDIIKSGGEKISAVEIERAILELPG
FT                   MKDCAVMGVEDEEWGQIVSVCLVTSRPSVTVNEIRNELRSVLAPYKLPKLLKLYEGEIP
FT                   RNNMGKVNKKKLVLEAFPK"
FT   CDS_pept        join(complement(1024476..1024747),
FT                   complement(1024214..1024420),complement(1023366..1024170),
FT                   complement(1023176..1023321),complement(1022195..1023125),
FT                   complement(1021861..1022151),complement(1021645..1021809))
FT                   /codon_start=1
FT                   /gene_family="HOG000196946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789278"
FT                   /locus_tag="CNC03240"
FT                   /product="Protein-Golgi retention-related protein, putative"
FT                   /protein_id="AAW42339.1"
FT                   /db_xref="HOGENOM:HBG266354"
FT                   /db_xref="HOGENOM:HBG317989"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="UniParc:UPI00004B445E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE9"
FT                   /transl_table=1
FT                   /translation="MDEAKLLSDALANVKVQTVQLKRCLDQDEIMEALKAASSMLAELR
FT                   TSSLSPKQYYELYMSVFDSLRFLSNYLYEAHTEGKHHLADLYELVQYAGNIVPRLYLMI
FT                   TVGSVYMSVPDAPVKEIMKDMLEMSRGVQHPTRGLFLRHYLSGQTRDFLPVGNSDGPGG
FT                   NLQDSIGFVLTNFIEMNKLWVRLQHQGHSREREKREMERRDLRILVGTNLVRLSQLDGV
FT                   DLDMYRKIILPSVLEQVVNCRDVIAQEYLMEVVIQVFTDDFHLHTLTPFLGACAQLHPR
FT                   VNIKGIVIALIDRLAAYAVREAESEDPEEKRRDEEEAARRLAEKVKGARGKGKNVEEGE
FT                   KNAPSPVAKPAEADVWGATTDTTSTTPVTENLSGESSKSPVEGEKLGESPAPTPAQMEK
FT                   EETAKKFRGIPEDVKLFEVFWQQVVELIKARPDLSIMDITALCVSLTNLSLSCYPDRLE
FT                   YVDQVLSFTHGKVHDYSQNPDLHSSQTVSNLLALLLAPISSYVSILTLLAIPSYLPLLS
FT                   VQPYSTRLSIGQAVVSSVLKNNTHIETSDDVTGVLGLCAVLVKDQKDHTIGGGAPQRRG
FT                   QAIDWREMAEEQGWVARMVHLFRADDLGVQFELLQTARRHFTEGGERIRFTFPPLIASS
FT                   IQLARRFKTRESVEDEWETRVSALFKFIHQLISILYHKVEAPETCLRLFLLAAQVADDC
FT                   RLEELTYEFFVQAFVIYEESISESRAQLQAITGIISSLQTSRVFGTDNYDTLITKAALH
FT                   GSRLLKKSHQATTVLYASHMWWQGDVPGREKNDKPPFRDGKRVLECLQKSLRIASSCID
FT                   EITSVQLYVDALDRYVYYFEQGVEAVTPKYVNSLVELITSNIDSVNSGGDVHPSSAGGG
FT                   LVEGVSGGDMIIKHFRNTLLYIRGRQRQAQTDVVDQGDEREGGEEKKKVDWESVDVAGG
FT                   CLKMGLTH"
FT   CDS_pept        join(complement(1026044..1026298),
FT                   complement(1025799..1025993),complement(1025649..1025735))
FT                   /codon_start=1
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093378"
FT                   /locus_tag="CNC03250"
FT                   /product="Transcriptional elongation regulator, putative "
FT                   /function="isomerase activity"
FT                   /protein_id="AAW42341.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG179572"
FT                   /db_xref="HOGENOM:HBG526275"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000042F400"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE8"
FT                   /transl_table=1
FT                   /translation="MSSTGWEIRFSNSRQIPYFYNSERSISTWEPPSELSAEQIQQLPG
FT                   AAKYMNVQLAQPAGGKEGQVRASHILAKHAGSRRPASWRNDKITITSDEAQAIIEQHIA
FT                   YLQSLPPADLPKEFAKIASTESDCSSARKGGDLGWFGRGQMQKPFEDATFNTPVGQLSG
FT                   IVKTDSGIHVILRTG"
FT   CDS_pept        join(1026954,1027150..1027210,1027261..1027467,
FT                   1027518..1027770,1027820..1028221,1028274..1028410,
FT                   1028467..1028629,1028682..1028801)
FT                   /codon_start=1
FT                   /gene_family="HOG000165710" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806602"
FT                   /locus_tag="CNC03260"
FT                   /product="Beta1-tubulin, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="structural molecule activity"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /protein_id="AAW42343.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG496287"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI000042DE1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE7"
FT                   /transl_table=1
FT                   /translation="MREIVHLQTGQCGNQIGAKFWEVVSEEHGIQADGSYKGTTDTQLE
FT                   RINVYYNEAAAGKYVPRAVLIDLEPGTMDSIRGGPLGSLFRPDNFVFGQSGAGNNWAKG
FT                   HYTEGAELVDSVLDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFPDRM
FT                   MCTFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICLRTLKLSTPTY
FT                   GDLNHLVSVVMSGVTTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTARGSASY
FT                   RAVTVPELTQQMFDAKNMMAASDPRHGRYLTVACYYRGKVSMKEVEDQIQSVQAKNSAY
FT                   FVEWIPGNISAAQCDIPPRGLKMSSTFICNSTSIQSLFKRIGEQFSAMYRRKAFVHWYT
FT                   GEGMDELEFSEAESNLQDLVSEYMQYQEAGADDEIYGDEEIPIEEEEM"
FT   CDS_pept        join(complement(1036182..1036239),
FT                   complement(1036004..1036108),complement(1034804..1035958),
FT                   complement(1034118..1034741),complement(1031312..1034046))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093379"
FT                   /locus_tag="CNC03270"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW42345.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067585"
FT                   /db_xref="HOGENOM:HBG176033"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI00004B445F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE6"
FT                   /transl_table=1
FT                   /translation="MPQVTVHRAHSPIVWHGKLKWVARLAPRLQLDASPQQLRIAHVRD
FT                   GGREVDIWDDYDFDAFKSRAAAQSAPLVVKVYPPGASSEPGASPATAAPARKPRKKAVP
FT                   SDDQPAPGTPPSTKKDKGKSKASPQSQNLAAPVLQPQQPSTPTAAPKSKKRKRDSTSSA
FT                   AEPLPTRALPVQPTPTGPGRQSTSPQQPKKRRKRGAKSDAALAPAPPPANPSAPAIASP
FT                   SRPFTFSLPLQGSAAFINRYKPAKPSPLGRIDGPPVLAGETASTSSSPAAKETLQPLTE
FT                   SGKKSRKPRKRKEKKEEGVGGVPASPAASSVAPSPAPSSSKKQKSRPSVTEEIMRKQRE
FT                   KMAAEEAKKQAENADKANAKGKDKEKATDKPTAMPAASTSIPLTPSKESTTQPSTPELS
FT                   TQSPLTKTKKEKSPKTPKVNRASEIMRMFREKQAAEAAAKAAEQSIPPVVQTVQPEQPS
FT                   VSSAQPSTEHLSSTPATPASALESKKPSSAKPKAAPRPSITLEIMRKQREKMAAAETQA
FT                   AENVEQENAGEAMDVDQPREKAHIPLVEQSKQGQAEQNTLQLEPQSEIQTESGPVAPPL
FT                   VSHGFATVPQTPTQSSVQPSNTSSTTKKTKSGRPSITSEIMRKQREAMAQQAEKEKEQE
FT                   EQIATRDDGDKEASKPKQPQCLICHGSSHPQKDCPVVKAGVPRLQQVLLERKEEDESPE
FT                   AAVAAIEMWIDRLGRVTSALMGTPVTKGKGRPSSAGLTTQAKQTPSQAASAPAVETESS
FT                   ASESSKSPSPTLPKAASPVPTFPPIYHKALSRKAGSTSGLSVSDAVIETGSSGSSASES
FT                   SEDEGGSVGSGSGYGSESETESESSASIQGQNAMSRSGSTSTSSSPPPSSSSPSPPPPD
FT                   LSKLDPQAALRHFLTAPLSQKQRRAARDSAAHMQVVDTQDVEIEEASEVESDEDGTNAS
FT                   FARIRMDDEESLVGEFEDDEKEEDEVEDVEEEPRDEQPPALPQVQQSESDDEMQLDVEG
FT                   SQPVLEQESALQPRAGQEEEEIRIDVTNTEAEPMDVDQRQTPLKTTQSPPESSPLSFHE
FT                   GSRQSFNDLAALASPSTQHRELPGDAAVREAIAEDEAPVRDAMRQDDDVHPKQRIPNGV
FT                   QEPVLTQQLMSPPSSVAEREDEIEPLPATQLVQRFEDEEGQGEATPIAKSKAPVRRSTR
FT                   QPSRQPSVARDDIPSPPRRRLRSASREPALVPEPPRTRMTRSSSQQRVVPPSPHVPIRR
FT                   STRRTVSSQSDVSQLSSSQLEPSSPVQLHATLTPATLRRSSRRQTTPLRSSQVDELDPS
FT                   SPPPASQQPIEESPLFIPETQLQHSQPQSSQSQSLNSQRFWRISGEEENPLFMSQGSQI
FT                   PQTQAYNLYPNIDSSSDVGETPRGAKIGIEGSSPSNDKQGEGKRANYLSVSSPILEEDE
FT                   EEQNALVDTEKHEQTSESGVDEHDDQSVDASEASSDDEGSSISIPIPRSQPIYPSLPRS
FT                   SLSFSQPVAASQPSTGFPTLSSLPREALRRMKSTFGFSSSQPETSKEKTSRHMNGAGDE
FT                   SESETSGDSSDEEPASLRGRFAGTRARKVKSQGAVKGW"
FT   CDS_pept        1036380..1037492
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806603"
FT                   /gene_name="TSF1"
FT                   /locus_tag="CNC03280"
FT                   /product="Elongation factor Ts, mitochondrial "
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAW42347.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG011746"
FT                   /db_xref="HOGENOM:HBG713289"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="UniParc:UPI000042DA57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKE5"
FT                   /transl_table=1
FT                   /translation="MALLSAAPRALRLPRRLPLGAALPALRALATPAAAQKVPVSLIAA
FT                   LRKQHPVPLAQAREALERSGLDLAAALDYLRTSTSASAEKKAAKVSGRDTNEGLIAISL
FT                   LGGKRVGMIHLACETDFVARNQVFLDTARGVAETTAFLDVPGDHEKPQIASSPYAFDPI
FT                   LDFPTESLLSAPLISLPAADTADGSLSPLPTSEPTTIKQSLLSSLAQTGENLKLLRAVS
FT                   FAAPFPSTPDVRFVPGGYAHGGITDKEGKVGGIVVLSVTSADPEKPIASIIHGPGGDDL
FT                   EKAAESLARTVARQVVGFPTKVIDRGDRAVDDEEVLMEQPFMMFNGDSRSVKDVLAEWG
FT                   KERGVVLRVVGMRRWAVGDEIEIKEKETDA"
FT   transit_peptide 1036380..1036466
FT                   /gene_name="TSF1"
FT                   /locus_tag="CNC03280"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKE5 "
FT   mat_peptide     1036467..1037489
FT                   /gene_name="TSF1"
FT                   /locus_tag="CNC03280"
FT                   /product="Elongation factor Ts, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKE5 "
FT   CDS_pept        join(complement(1039567..1039904),
FT                   complement(1039426..1039516),complement(1039261..1039371),
FT                   complement(1039131..1039209),complement(1038936..1039069),
FT                   complement(1038521..1038889),complement(1037913..1038441),
FT                   complement(1037564..1037871))
FT                   /codon_start=1
FT                   /gene_family="HOG000170863" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942392"
FT                   /locus_tag="CNC03290"
FT                   /product="Tetracycline efflux protein, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42686.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG176034"
FT                   /db_xref="HOGENOM:HBG328580"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4460"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE4"
FT                   /transl_table=1
FT                   /translation="MTTHETGEFVEDQDGKAEDDGLHTHDEEHEHGHEEGDQEHLEQSH
FT                   KTLRSEKGKEDNREQGKDEEAEIEGKKSGQKKTFELQDQTNLLPTKQVIFVFVGLTCAL
FT                   FCSLLDQTIVTTALPTLGQVFGRADISPWVGTAYLLTSTATQPVYGRLSDIFGRKFTLL
FT                   GCLFIFLMGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKERGKYQGI
FT                   TGCVVALANSCGPIVGGAFTENASWRWCFYINLPLTSISMIIIVFLLPLRRVRGSMVAK
FT                   IKKLDFYGSILTLAWAAPFLIALSWAGSQYAWDSAAVLVPLLVGLALLGLFIFVEAKVV
FT                   SLPLVPMHIFKNASVSACFFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSGVLTLPLM
FT                   LVQTVTSFTSGIIQSKTGDYWWNLVVGYTIWTIGLGLISSITSTTSIAKLSGYQIIVGI
FT                   GAGQTFQTSLVAIQAGVERKDMATATGLRNFLRQLGGTIALAACNSIVNNCVRRNLSGV
FT                   LPGTAYKAILEDPTRATSLGLSASELSAVTDAYGNADREGGDLNVARGINEVFWFCAPC
FT                   VGICIPITIFLIKKVTLNRSDDAVKKAEAKAWVESKKAKRAKKRKGSEETVVDSGASTM
FT                   VSGEEKKRDGRRIGKEQ"
FT   CDS_pept        join(complement(1044579..1044581),
FT                   complement(1044082..1044502),complement(1043762..1044028),
FT                   complement(1043145..1043705),complement(1042833..1043098),
FT                   complement(1042654..1042786),complement(1041851..1042601),
FT                   complement(1041423..1041801),complement(1041181..1041369),
FT                   complement(1040867..1041127),complement(1040783..1040812))
FT                   /codon_start=1
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806604"
FT                   /locus_tag="CNC03300"
FT                   /product="Protein kinase C, putative "
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42349.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055849"
FT                   /db_xref="HOGENOM:HBG396709"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="UniParc:UPI00004B4461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE3"
FT                   /transl_table=1
FT                   /translation="MASNDPKAKVILQSIATEKRNIEGARAVIRAFEASSKNETVIQQA
FT                   QNEIRTATMSIKFLEDELAKLQVGGSGGASGTPGRGEPSGGTGAGVPGKQGPQGVVASS
FT                   PGGRGMAGDRERPLPPPPPGAEQDSAKKPETKNYSQLDLLRYDAPLTGAKITRMLNQLQ
FT                   FKLQVEEQYKTGIEKMAQAYRAEGDKRLKSETDAKKSESEGKIQLLRKAKKRYESLAKF
FT                   GGAVEDDEDLMSDGKRKEALRKPISGKLVISLRSARDLNHRALPRRSSKTYSETTVVIK
FT                   VEGNERAVSHPSRNDKWHEDFHIPVEKANEVEITIYDTVAPGDSAPIGMLWLRVSDLVE
FT                   ALRRQKVGIEGQGAGWVTAATAATMGPRSSGNAPDSVTLHSAGTLRGKPDAEGKGPDGI
FT                   DGWWSVEPAGAISLRMDFVKDTVAGARRPYEALGRQGAVRMRKGDVYEMNGHKFVQRQF
FT                   YQPIMCALCQEFLLTGEGYQCEDCRYACHKKCYPKVVTKCISKSNADGEGDEEKINHRI
FT                   PHRFTPYTNMSANWCCHCGYMLPFGRKNAVKCSECALTCHQTCSHLVPDFCGMTMEMAN
FT                   LLLKNLRDIKTTQHRKPVPSTSTSSSVSTLPSYHSQESRSHPVQSAAPQQPAPSSRPPA
FT                   GALPSTDQRPIQPQVQNQQTGAYDNLRPAGGRAMPQLPPVAVPSNKISFEGDRLQEPHG
FT                   QIPPVMPAAQPQPQTLPPSAQSVQSPVKPQYVPQPAVQQQVAQRLPPQQPLMARKRKVG
FT                   LDDFNFLAVLGKGNFGKVMLAEEKTSSNLYAIKVLKKEFIIENDEVESTQSEKRVFLAA
FT                   AQERHPFLLGLHSCFQTETRVYFVMEYISGGDLMLHIQKKQFTLRQAKFYACEVLLALQ
FT                   YFHSKGIIYRDLKLDNILLTLDGHVKVADYGLCKEEMWFGKTTSTFCGTPEFMAPEILL
FT                   EQRYGRAVDWWAFGVLTYEMLLGQSPFRGEDEDEIFDAILEDEPLYPITMPRDAVSLLQ
FT                   RLLTRDPTRRLGAGEGDAEEIKQHLFFRDVNFDDVYHKRIPPPYFPVIGNATDTSNFDQ
FT                   EFTREQPTLTPVHTQLSEADQKEFAGFSWIAPWAAAQT"
FT   CDS_pept        join(1047066..1047232,1047288..1047345,1047405..1047431,
FT                   1047489..1047507,1047562..1047609,1047669..1047925,
FT                   1047976..1048034,1048091..1048193,1048256..1048603,
FT                   1048655..1048718,1048771..1049042,1049091..1049249,
FT                   1049311..1049487)
FT                   /codon_start=1
FT                   /gene_family="HOG000276711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806605"
FT                   /locus_tag="CNC03310"
FT                   /product="Putative uncharacterized protein "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42351.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG489192"
FT                   /db_xref="HOGENOM:HBG644911"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI00004B4462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE2"
FT                   /transl_table=1
FT                   /translation="MFLSRLAARQTRVQSYLPRQIAYRSFSSTIAIGMSMNDDILTKAV
FT                   LPDNELKNGEKKAVDFGEGKVLLSKINGRVYATSAFCTHYGAPLEKGVLSHDGRLVCPW
FT                   HGACFNVCSGDVEDAPGLDSLWSFSANVKNGQIEVTASKKEVTSKVGRIVARKRTKDQM
FT                   QNQGQVSEETVVIVGGGSGGIHTLESLRMNGFGGKIVLISAENYAPIDRTKMSKSLLDD
FT                   VEKLQWRTPDELRDSFGVDFHPGTTVTKVDFEAQTVTDSSGVLYKYNHLVLSPGGRPKK
FT                   IPIPGADLKGVVTLRHVEDTKTITSSITKDSDVVLIGTSFISMEASVAVLKKGPKSVTL
FT                   VGMDDVPFQGLLGKEFGSALMESMKEQGIKFRMSAQIEKITASDSNPDHAGMLHVKGSD
FT                   PIPANLIIMGTGVSPATSFLEGSVKLEEDGGVLVDEYLHLKGYKNVYAIGDIAHYIQYP
FT                   DKFPRRVEHWNVASNHGREVGHNITHPDNPVIYTKVPIFWSSIGKGLRYLGTGAGYDDM
FT                   YVDGNFKELKFAAYQAKGGKVTAVATMQRDPIVSKASELMRLDLMPPLEEIKKGKDILQ
FT                   IELINKGQK"
FT   CDS_pept        join(complement(1052587..1052730),
FT                   complement(1052520..1052527),complement(1052340..1052455),
FT                   complement(1051961..1052282),complement(1050613..1051010),
FT                   complement(1050297..1050541))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093380"
FT                   /locus_tag="CNC03320"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42734.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG176036"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00004B4463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE1"
FT                   /transl_table=1
FT                   /translation="MADTGLLEAYAEPMLGPEDELDREYRKSPRKKPRITLPRGHACVA
FT                   CRQRKLKCQEGIRPCITCVKANIDCRDEEIPRKKPRHVVLEERVAELEGLLGLQKGQPV
FT                   PRKSNPSSTTFSGYSASPSPSEHFFSEYPQVSSSHTVNPYLDHPPLSVTGRPTASSQIE
FT                   IPPGSAIELSLIQFILPYTPYLLLPLHPQRFLASLFDLPKITHPTSLSNEGSFPFFPHI
FT                   PPIEDVESVEICLALFRQHIPLPFIFPPPVSTANGPAMASAPLDTEIYDGPSDPWWILF
FT                   HFNLYAAEMLMWREMAFHRPESSGAALQCARALVNLTRSIPDEKWANVDMMVAFSISLA
FT                   ARLLVKEAARFQASGALTAAAHALADADILQNCLDGPFNRYMEVAGGMFSRIVDNVREG
FT                   RTEKNGEYERV"
FT   CDS_pept        join(complement(1058972..1059185),
FT                   complement(1058562..1058900),complement(1055736..1058500),
FT                   complement(1055592..1055682),complement(1054895..1055537),
FT                   complement(1054534..1054845),complement(1054441..1054486))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789279"
FT                   /locus_tag="CNC03330"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW42685.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG067583"
FT                   /db_xref="HOGENOM:HBG176037"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI00004B4464"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKE0"
FT                   /transl_table=1
FT                   /translation="MTQKQSFADFLASGSPYGGKNRGRGSSSRGRGGGGRGGFYGNASK
FT                   KAYNADYSNVPFDYDRINSQHYKKLEPASVAPYGNRDINRFHNGPDKNVSSSSYHVPRL
FT                   AHTPGTATPNKIHGLGFQTSSQLSQSDSVHPSVEMTKNKTASESSRGLSGSRWGGGLAP
FT                   LFIKAGELFKDGEVDVITQEEDKGIDVGHYYKPEASETRMADTESQANTQLLQAEDGDN
FT                   TSDAVIDGKSEQLKVDSQSGSSLPPTAGDDSNIFQVVQYTGELSIGPSIGNSHQDPVEG
FT                   GYSRNGGIMGIPVPNEHQFTGSNTFTKTCPDIMSSFDRHEHVDGLVSEADLQPHQEDTL
FT                   FFIDTNPDPDSTPSQTPQYNTVAAPPIGSSSPDSDEEDIVFVPRAYNQQKAIGPHVSSL
FT                   HQRHGMRCLGQGSSKYQSYIEIVDDLNAQPLLDSTRQIQNFVEDANPNPQPPSVPASLR
FT                   TEELPDSISGYINAPAASYTDEKMVKHQKKRANKNAKRLARRAAARGVPRDDSDIEWGS
FT                   DGPPNLAGGEQDQMSVDDLIGGGKGKESEAILRDYLEGVKLSQKADEDEDKYEDDDDMA
FT                   ALSKWANRINVLGKEVDSDEDSDEESSPPSVQASASKIYHGPEDRRDELRQDEKDDDEL
FT                   RELETLHNFANRINALDEGQNLSEGEEITLVQPQAPKISLKLQEKRREQHEKLEHGDGD
FT                   VMDEELMELEALQEFADRINGQGIENESSGDDMGEIQMQKIQSPPKARVKQVKFSSYNQ
FT                   EITHAQWEADEEKLALDKWALSINTFGGDDYGDDDDDENMGVLLPTQQDNKLQPRFMEC
FT                   FEPDSEQDEEDAELDALDAWISRVNSHSQGQDLSDDELDTAYTSSKPKLKKPALPKMRQ
FT                   RQSSPSSQPSLNQQSKHMSPEELSQPTELGDNEGWPISEAEATEDNPWAFDPKEAEKDN
FT                   PWAAKDPKEEHNLRSGEVVYEEQNFTQSTSLHADISSDSPPEQPDVVVFSTSEERLAEQ
FT                   RRESEGGDWSNGKIASKVFNEVYSEEEDLEAEGDDSSSSSTGKWKKYEAKQEEGMFNGV
FT                   NHWSDDDESEDDSDEGRDEISGENDGDSDSHYESEEDEEDDMEVDDYDQTEWFINAMED
FT                   ALGGKEINFNDPRAKMFNAIKEDSYEFSSAPAKKGKKNKQLKGIPMELQVQWEKDRQTK
FT                   AEKKRQRELARHAEEFDSTIISGSSRNGKNKRYSKKGGQSKDSKQIYQASVAHLISGSA
FT                   ADVADMFSEEEGLSDSEHEEYFGHSDRYETIGNDPFNLSLKPKNARFSMGFKKNKKRGL
FT                   EKKTVAGPEWKTLDWVDDLIQAFLKDKKSESMSLPAMDKEGRKKIHMLAECYGVGSTSR
FT                   GSGKKKSISLYKTKRSGVDVKEEKRERLLTAAPFSGSMFHKTLYTKSSHGGVKSKGRDW
FT                   ASGATAKPREGELVGYGADKIGIDNVGHKLLSKMGWAEGNKIGIGSGSGIDAPIVAVVK
FT                   NTKSGLGA"
FT   CDS_pept        join(complement(1063726..1064886),
FT                   complement(1063610..1063681),complement(1063502..1063561),
FT                   complement(1063247..1063444),complement(1063102..1063194),
FT                   complement(1062903..1063064),complement(1062806..1062846),
FT                   complement(1062477..1062756),complement(1062210..1062424),
FT                   complement(1061748..1062157),complement(1060968..1061692),
FT                   complement(1060449..1060916),complement(1060108..1060395))
FT                   /codon_start=1
FT                   /gene_family="HOG000183568" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942393"
FT                   /locus_tag="CNC03340"
FT                   /product="Protein-histidine kinase, putative "
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42353.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG220979"
FT                   /db_xref="HOGENOM:HBG309709"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI00004B4465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD9"
FT                   /transl_table=1
FT                   /translation="MSLPDAYPPVIATEGSTAFQSHILSLLSVISQHPSPDYPFPSSGD
FT                   STLQDNASVTAKKNATLSTFPGKKTPAEDAIERAIIALGDRVWTSERTQAHLVKDVKRD
FT                   VPAQPGSDLLTPDWTPPVPTLNDSSPDPVCPTCTRPVSSSETSSFTPQQIASFYHPFTA
FT                   ALSTPPPPLPEQMFFPQSVLAAYVSATSDSESAGDSGMSAEKELELLKAQVQDIARVCK
FT                   AVATGDLTQKIIVPVKGQTMTELKNIINAMVDRLQTFAVEVERVSLEVGTEGKLGGQAV
FT                   VPNVEGTWKVLTAVVNKLAANLTNQVRSIAKVTKAVAKGDLSETIDVEASGEIAELKTT
FT                   VNGMVMSLRTLADEVSRVSLEVGSQGKLGGQANVPDVEGVWKDLTVNVNRMCESLTTQV
FT                   RSIGSVTTAVARGDLSKMIEIEAEGEMAVLKNTVNSMVRQLTVFAKEVTRVALEVGTHG
FT                   QLGGQAVVPGVEGVWDDLTTNVNKMARNLTDQVREIAMVTKAVARGDLSKTVNADVQGE
FT                   ILDLKCTVNEMLTNMPCKVAQLTVFAAEVTRVSLEVGTEGKLGGQAVVPNVEGTWMVLT
FT                   DNVNLMALNLTTQVRSVAEVTTAVAAGDLSKKINVAAFGEILELKNTVNNMVDSLRSFS
FT                   SEVTRVAREVGTDGRLGGQAKVPGVAGTWKDLTDCVNIMAANLTEQVRTIAHATTAVAR
FT                   GDLTQKVVGVKVSGEILDLVNTINNMIDQLAIFAAEVTRVAREVGTEGKLGVQAEVENI
FT                   EGTWQEITSNVNTMASNLTSQVRAFAQISAAATDGDFTRFITVEASGEMDSLKTKINQM
FT                   VYNLRESIEKNTKARQEAEMANRSKSEFLANMSHEIRTPMNGIIGMTVLTLESELTRQQ
FT                   RENLMIVSSLAGSLLTIIDDILDISKIEAGRMTMEQIPFSLRVAVFSVLKTLCVKAAQN
FT                   KLDLIFDVDPTMPDQLIGDPLRLRQVITNLIGNAVKFTTKGQVALSCRVKRYVTVADAV
FT                   ELEFCVADTGIGIKQDKLDVIFDTFAQADGSTTRKYGGTGLGLTISKRLVNLMSGDLWV
FT                   ESEYGQGSRFYFTTVAEMTSVPRDQIIERLSPWSGRSVLFIDTLGDQTGIVEMLQELGL
FT                   KPIVIHSVNDVYLLQDQGLTVFDTMIVDSLKAAGELRGIEYLRYIPIVLLAPSNKPSGP
FT                   SNPSFISLPESRRRLLALPSASEQLLSPIPVKDCLEMGINTYYTTPLSLQELSNAIVPA
FT                   LESHQIQPGDTVKDTILSVLLAEDNLVNQKLAVKLMEVAGHKIEVADNGEIALEKYKRR
FT                   QLARTPFDVILMDVSMPVMGGMEATGLIREFEANEGVPRTPIIALTAHAMIGDKERCLA
FT                   AGMDEYVTKPLRRGDLLASIAKVLAPKQSASGLEMPAVPIPANIYGR"
FT   CDS_pept        join(1067238..1067500,1067557..1067956)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789280"
FT                   /locus_tag="CNC03350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42355.1"
FT                   /db_xref="HOGENOM:HBG067582"
FT                   /db_xref="HOGENOM:HBG176038"
FT                   /db_xref="UniParc:UPI00004B4466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD8"
FT                   /transl_table=1
FT                   /translation="MLPLACYWMIVVMVLWVLLTVLVPFGYRIRDLDSITRHLRFAIVE
FT                   ACVLCVSLFGNVLCWLAFGLGRSAYLSVQNGGGDPKSGRAMETTAVAALLSLLSLGTAI
FT                   RGLDLRLRGAQTHWREEAVMVRRRSMALLASGAARPEDAATLGVTGDFWERKDSQRWST
FT                   NSSDVPSYTANNGALQHRDNELKTGYRPDIERGEEEEIDVKLEEAKRNSVDQIRRTS"
FT   CDS_pept        join(complement(1069847..1069952),
FT                   complement(1069482..1069777),complement(1069059..1069429),
FT                   complement(1068798..1069007),complement(1068401..1068752))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806606"
FT                   /locus_tag="CNC03360"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42357.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG176039"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="UniParc:UPI000042F3FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD7"
FT                   /transl_table=1
FT                   /translation="MFYATAGQQATQQPPTSRIAGYPRNGPPGFSVRSSDPNDFPALGS
FT                   HNQHNSSYIAQNQGGQSSANASHQNSQLQQQQHLYMQQQQQQQQQQLGVTPAPPPGISG
FT                   PTASAPSQSNGGLTEEFPALGASSESKDGRMANFFRNPSSVHQPIPSSPSPLPNGTSNA
FT                   SASQSADATPSTNPPHPQSGIGGPASTTDSWQRQSPRHTEPVVRPVQQILSSPVDRWGL
FT                   KALLFEIQMHMNKTDRGMMVFGEDLEELGVDINSEEALYPTFVTPWAEPNSLPPPQIEE
FT                   SFHIPQCYYVHAPPVESKLQNFAEDTLFLAFYMSPQDVLQLRVAEELYARGWRYHTELQ
FT                   TWLTSPTLASIDLSKADRSSGQPNWIRGPFAYLDTRTWVRQRTAEDFTIDANVLELTKL
FT                   ADDVIREEAARKEAQKSPGGVPVNGQNQAQSQGQQNQGQALSYQR"
FT   CDS_pept        join(1070207..1070209,1070265..1070307,1070367..1070412,
FT                   1070461..1070584,1070637..1070684)
FT                   /codon_start=1
FT                   /gene_family="HOG000210519" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806607"
FT                   /locus_tag="CNC03370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42732.1"
FT                   /db_xref="HOGENOM:HBG028785"
FT                   /db_xref="HOGENOM:HBG395617"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniParc:UPI00004B4467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD6"
FT                   /transl_table=1
FT                   /translation="MSSELRYTANTQLEQLHARYTGTGHADTTKYEWLTHQHRDTLASI
FT                   VGHPPLLAYLSVADGECQARERFEVTEKMLQPCGKPPGKTEE"
FT   CDS_pept        join(complement(1074708..1074840),
FT                   complement(1074035..1074408),complement(1073588..1073977),
FT                   complement(1072327..1073537),complement(1071841..1072264))
FT                   /codon_start=1
FT                   /gene_family="HOG000208994" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942394"
FT                   /locus_tag="CNC03380"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42359.1"
FT                   /db_xref="HOGENOM:HBG176040"
FT                   /db_xref="HOGENOM:HBG737031"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniParc:UPI000042F024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD5"
FT                   /transl_table=1
FT                   /translation="MAHYQQAPYSDSAGYGNSYGGPTPNYGGYSDNPRGAAGGDYGNNS
FT                   YLMSSANPNAAAGSGGYAGSAGGFQPKKKRNKWLWIGLPVLLICIILAAVLGGVLGSRA
FT                   SSDNNDSSTSSDDSSSATTGASNANTALPSGVSSANTAATNTGANGEQYLAVATDTYML
FT                   PVYATGTATSGYSAPTVISDPASTDSWPDDPSPPSNSTEGMRAHPRLAPGYKWDALTHG
FT                   GLIQNNPYLKYWNATIVQNASDTIGDDPTPYIPDGGLDGSGVLDVAREIKLKVKNWAYA
FT                   YKVTNETKYADRVWLELTTAAGNNSDVSFGADGTRWNPAHFLDLAEFCAAFAIGYDWLY
FT                   DFWTDDQRDALMWSMLNLGLSFGHAVLSGNTSASSYNWWAGTGVGSSEVNGNWNCVCNG
FT                   GLIQAAVAIVDRDPTGIAQQVIDLAVPDAWNNCFQGAYSDGTWAETANYWYFGTTGAAE
FT                   LVNALQSSYGDDRGLPESNPGWNLTSLFHIYVQGMTSLFNYGDHGPNKYSSTANSLLLW
FT                   ANTFNEPRYALYQRDHYDASEPWSMFWYNPALSGTWWDGLPLDRYFDDENGRWATARSN
FT                   WATNEGSYWAMKASKLTDHQTHGDLDIGDFVFDAMGQRWAGELGSGQYLADGYFSSEEQ
FT                   NSERWLYYRKRTEGQNTLLINDQNQNVNATPTGNWGSSGTAQGAAPSFQLESDDTAYFW
FT                   TDMSTAYNYTVKRGIRYLNARQQVLIQDDVTDVPNLQWRMHTNATITTNNATATLTLSE
FT                   QTLIASIVQGPSGASFSTAEPTRSSSDPALPTGTMDADQPNDGVTVLVVDVPNGGTFSL
FT                   QVLLTPQWGSNFTAIDSVNNVALDDWSLTSH"
FT   CDS_pept        join(1075399..1075578,1075635..1075969,1076023..1076078,
FT                   1076125..1076324)
FT                   /codon_start=1
FT                   /gene_family="HOG000159593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789281"
FT                   /locus_tag="CNC03390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42361.1"
FT                   /db_xref="HOGENOM:HBG113700"
FT                   /db_xref="HOGENOM:HBG736343"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000042E29B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD4"
FT                   /transl_table=1
FT                   /translation="MSIALWVVVYSPQMWENYQLKSGEGLSVPFIILWLLGDITNLFGG
FT                   MMAHLLPTVIILAVYYTICDLVLLFQVYYYRRFPSPSAHQHITSDESTPLLPEPRQPKP
FT                   LLPPLIEYPVLLGFVLLAGAGAWFLTDRDEVHVPEDPEVTIEWKSQALGWASAVLYLGS
FT                   RIPQIVHNYKTRCAGLSLAMFFFAISGNITYVLSILLKSLNPRWILANAPWLAGSGLTV
FT                   FLDLFVLAQFAIFSWQDERRKKTSGEVDNEEEDG"
FT   CDS_pept        join(1077270..1078517,1078567..1079133)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806608"
FT                   /locus_tag="CNC03400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42363.1"
FT                   /db_xref="HOGENOM:HBG067581"
FT                   /db_xref="HOGENOM:HBG176041"
FT                   /db_xref="UniParc:UPI00004B4468"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD3"
FT                   /transl_table=1
FT                   /translation="MAGRTGLPSRPQSQSSPKSRARSGTMVSPNEVRKIYLDRPPVPIT
FT                   SPTSLSEISGLQLSPVASKSTSSGDGSPVIPPPSRIPIRASSKSRGGSDPYSFLRSDGP
FT                   RSMLGLSFSSTIPATAGRMSRSPQLQREVSIAHVKELAEGPSAKKSRGQFSGELKQRDF
FT                   GEDSPTLDAAQITEGFIKNELPPFIMSPEEALRIAERGHNLESDDDAQMQDWQHLELDP
FT                   YAASGPSQEIGLAEGKREKRKRATTMKTSGRNRHVAARSVNKDCQPDFGLPVFENPSLK
FT                   ASKSRIQTGSTPSATATSYPISQTSRSVSMKAFSSTPRTLHPYNTLPNSSSRLGVAAHL
FT                   IPPASTYTPPKGANWDEVVLPAVAKKLGIGEARTADKIDTGPDAEDLAVEWDKNGTPIK
FT                   WVKKKMEDRTSLDKQTDLETKSPNSKLMELPFNPILEPLPDSPFCQSNYGAQHPDTIGL
FT                   GPQREAPGLHIIPPPLSKTISQTSINLKPSFLRKTSMQDVTKPSSQRSLQAQRCDDEES
FT                   EPFVGNDLVPGQSHWGVPPVQPSAPGTTHRITGAVYEKRMNKQRGVASVQANLLGVGNV
FT                   QSGKAVDSKPNKKAKQDGHSKGCGCAIM"
FT   CDS_pept        complement(1079628..1080359)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806609"
FT                   /locus_tag="CNC03410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42365.1"
FT                   /db_xref="HOGENOM:HBG176042"
FT                   /db_xref="UniParc:UPI000042E377"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD2"
FT                   /transl_table=1
FT                   /translation="MQAQFSGIDEPSEAADYTPAPEGHGEDEGEVLEEDDEGVQEIDDE
FT                   GEAEDGENKPLELERSSPQSRAGSDGRSKSQRKPTGSPEAQLTPQSVQLPPDSSHASPK
FT                   HAEDIHEASEAPSESVLEHNVSQREESFAGPSATTDEVSHDAPIPPHHQIPVNAVEVAN
FT                   IPPNENEVGKGSLGEAGRSGIEVRQAEHSDSAGTLMGEEKMDVDGPVAKEDEGLVHGEM
FT                   EPPVPELAVEGVDEPVEVEQE"
FT   CDS_pept        join(1080956..1081020,1081247..1081296,1081359..1081784,
FT                   1081839..1081969)
FT                   /codon_start=1
FT                   /gene_family="HOG000207273" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636612"
FT                   /locus_tag="CNC03420"
FT                   /product="Elongation factor 1-beta (Ef-1-beta), putative "
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="AAW42367.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG020880"
FT                   /db_xref="HOGENOM:HBG714747"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="UniParc:UPI00004B4469"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD1"
FT                   /transl_table=1
FT                   /translation="MASTIDLKQLEQHLATRSYIDGFKPTTADVEIYKSLGSAPEATFP
FT                   HCHRWYIHIASFADEFDSLPAGANPLSSTSAGAAAAAGEEEDDEVDLFGSDDEEADEEA
FT                   ERIKAERIAKYNEAKEAKKQEKLAAGKTLEVAKSVVTLQVKPWDDETDMQALEDGVRAI
FT                   EKDGLVWGASKLVPVGYGIKMLQINLVIEDAKISLDELQEEIAELEDYVQSSDVAAMQK
FT                   L"
FT   CDS_pept        join(complement(1083924..1084124),
FT                   complement(1083735..1083873),complement(1083510..1083683),
FT                   complement(1083214..1083441),complement(1082763..1083148),
FT                   complement(1082097..1082714))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806610"
FT                   /locus_tag="CNC03430"
FT                   /product="Alpha-1,6-mannosyltransferase, putative "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="AAW42684.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG067580"
FT                   /db_xref="HOGENOM:HBG176043"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI00004B446A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKD0"
FT                   /transl_table=1
FT                   /translation="MAQAPPMSPSLSPTRTRCLNIVLCLLPFLVTFAHVFLSPYTKVEE
FT                   SFTLHAVHDVLAYGFNPHNLQLWDHVTFPGAVPRSFIPPALLGILAYPFSVVSVASGAI
FT                   KTKFGVQILIRLVLASFFSYSFNKLACSLQKAFNVSVRVWFTLLSLSSFHIPYYAGRTL
FT                   PNFMALPGVLWSISHIMTAQIATSEADRIASLRKAVIALTALATIVRLELALFVIPLAL
FT                   SLLINRQVGFGQVLKWGILGGVGSLSISSAVDYHLWLPTLSHPSFPFKSHFQLFWPELS
FT                   GLIYNAVEGHSAEWGVMPWHYYLSGSLPKLLAGNSLLVGIATGGWLLDKMGLDMMAKKA
FT                   GGWDRLTGVRGVNKVMKVWALSVVTVIGALSFLGHKEWRFILPVLPILHIISALSASSL
FT                   WSLRPSKLRNLMRLFVLVALGLNSLATIATTFLSVGNYPGGEVWKVMEDIPGLQRQNAS
FT                   IYFPSYPLQTGATLFTFVHAHSVNGTGRGLGPWSAFPETKEPRWIYNKSEDKMMENPIR
FT                   VWESGIDFVVTGDYDQFLALPDKWVEVASVEGLDSVGRAPGTYRVQAKWDRKLAVLQRR
FT                   ENIQR"
FT   CDS_pept        join(complement(1087369..1087371),
FT                   complement(1086626..1087314),complement(1086477..1086569),
FT                   complement(1086039..1086249),complement(1085700..1085972))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636613"
FT                   /locus_tag="CNC03440"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42733.1"
FT                   /db_xref="HOGENOM:HBG176044"
FT                   /db_xref="UniParc:UPI00004B446B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC9"
FT                   /transl_table=1
FT                   /translation="MTFNDLSSIASNIDPQTALPYTPMSVLQAAHWSAADLRARVTAHE
FT                   RDGNVSVESEDDKNEVGLTQTTSSIVEGLRKRRRPAPRSRVPSPASWGPSTTSLAATIN
FT                   SISSATEASFSPLLSHSNSVWYPVPSDETHRIGASGLLSAGSLSTANLSGVPDFGPDLV
FT                   DVLPQEGSKSQPPHGEKNFFGLVSGKATEEEIEEKWVNEGGAFAMSHLGLMGNGNAKED
FT                   KWTKIEPFRFSVEFWDVDKLGEKERYYSATHFYAGSLFNWNPLMRTVTSLSTAPAPSTP
FT                   AVHGQSLAPSPVIPGSPPSATTRFFPGGANQERGNALATDVPYHDTRAVTKAFFSISCA
FT                   SALGTALIRFTSGPDTFAHSQSWGWKSSALKSEEYLSSPPAVERGENLDEGVMGWTGEV
FT                   DTEGIGKGNGRSTLRATVVVGIV"
FT   CDS_pept        join(complement(1093991..1094127),
FT                   complement(1093811..1093871),complement(1093661..1093682),
FT                   complement(1093379..1093589),complement(1093039..1093317),
FT                   complement(1092938..1092989),complement(1092820..1092877),
FT                   complement(1092710..1092758),complement(1092551..1092661),
FT                   complement(1092393..1092486),complement(1092324..1092334),
FT                   complement(1092016..1092274))
FT                   /codon_start=1
FT                   /gene_family="HOG000135989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806611"
FT                   /locus_tag="CNC03460"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAW42369.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG174930"
FT                   /db_xref="HOGENOM:HBG737401"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR013944"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B446C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC8"
FT                   /transl_table=1
FT                   /translation="MFPRTKTLFTGMGAKIPSRTQRITLLERSTARGALLRGSRSMSIL
FT                   SNDKAIQNGDDFHALMIGGGFAMFGTPEGPWNISSRLEKRLGPRLKVDAVIEINGPRAE
FT                   TALTEKRKSFVHEAYADTMVLPDVEEFKRRVSTGEAQEPRAIFVATPPLFRGGLGPQNN
FT                   LEIKLNELFPNAAIFLEKPVATGVPAEQSVGEAKAVGAMFATQHNAPVAVGYVLRYLNA
FT                   VREMKKIIDDNNLTVMATNARYVTAYELAIKTDWWNKSIMQGPIIEQGTHICDLSRYFG
FT                   GDVNIETICAHALEAHEKPGRLSKLNFDESVIPDNLRIPRATSASWKYESGAVGTMLHA
FT                   TALHGKDYAIELEVYADGFQLILSDPFGTPALHVRKPGSDVVEVYPTPGDDPFQSEIDA
FT                   FIDVVEGKPNAKILSGYEDAAKTYEMTWAIRNSAEEWTRRLSQRQGRT"
FT   CDS_pept        join(complement(1101031..1101049),
FT                   complement(1100862..1100972),complement(1100720..1100802),
FT                   complement(1099732..1100668),complement(1099548..1099675),
FT                   complement(1099255..1099500),complement(1098799..1099203))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789282"
FT                   /locus_tag="CNC03480"
FT                   /product="GTP-binding protein, putative "
FT                   /protein_id="AAW42371.1"
FT                   /db_xref="HOGENOM:HBG067578"
FT                   /db_xref="HOGENOM:HBG285492"
FT                   /db_xref="InterPro:IPR014813"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00004B446D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC7"
FT                   /transl_table=1
FT                   /translation="MPRIRKKTSNRQNTRDRAKITKKAAEQKRKDRKASKKDQTWKSKK
FT                   KADPGVPNSFPFKDQVLAEIAEEKRKSEEGKIARREAAKAQKSTGAEDEADTPGVSSLG
FT                   RTVLNRVPLTATSAAVVTPTEDSDIPELIDTALPTLQEALDRADVICEVVDARDVLGGR
FT                   SGYIERLVKEAEGRIILIINKIDLVPREVLQSWVSQLDIPTFLFKSALPVPPTPSSSRN
FT                   PGPSFFLEPSVILGREQLIAAAKKWSAEKKKSRKSDEPLVLALMGLPSVGKTSILNSLL
FT                   PSTANKSRHVVAPLIPSGQSAKSLQPTTKSPVEVEIDVDGLKIKVIDTPGWEPVEDEKD
FT                   EDEDEEEDEQIPEKWDRLEAKLSGDLLRRNLGRVDRVKDVFPLVSYIVERSNHQDLMLA
FT                   YNIPFFEKGDLEAFLTGLARAQQRIRKHGEPDLEGAARVLLRDWAHNNFPYYSLPSSTS
FT                   ASKMDVDASKAIDKYDMTAILEKCRGKKEMKKESSKGMIRFKGGEIDEREIILDDDYTA
FT                   MMTVTSDDEEQEEIDDEEDIDDEDEDEDEDGIELASASDDEPVIIGSDEGEVLELSEGK
FT                   EPSESESSPEPEPRLPSPSSSKPKKRRISEASVAPAKKAKRVSFARNVPDGEERNIRGG
FT                   KKGKGRK"
FT   CDS_pept        join(1103837..1104503,1104559..1104910,1104999..1105126,
FT                   1105177..1105416,1105481..1106057,1106114..1106447)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806612"
FT                   /locus_tag="CNC03490"
FT                   /product="Leucine repeat containing protein, putative "
FT                   /protein_id="AAW42682.1"
FT                   /db_xref="HOGENOM:HBG067577"
FT                   /db_xref="HOGENOM:HBG176045"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI00004B446E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC6"
FT                   /transl_table=1
FT                   /translation="MPTTHRLDESLREHEQEIQENADDEQSGVERHDTRSSVSITSHKD
FT                   DNRVEDCPDLSSIEPEAEAISEPVRIEEFKKRSTSLSVTSASHEGTIHIMPSAPLLMTP
FT                   TPSAFARNPIRSALRNAATPGDKPKKRQGWSDETTPGLIARGTTPASSGKRSVSFSDGK
FT                   KTGKIIDLDVEMRTTRWQTSAKEECADIFKRESTDSDRSFLPSARTRRIQGLLDDMGEL
FT                   TLNDETPCKPSSRQIEDTDRPFSRASLTSSPDSHSTIPTRSPHVCRSSTYPSRHAGNAT
FT                   FLTECSFGIAHDKLVEIITDIEPFNPHWDQLKMIDLRGKKADSVARLKEFLPNLDEINF
FT                   GIPTTVRTLHVAGNLLTSLTAVNHLRNLQYLDISRNKLDSVAQLGCLIHLRELKVDDNA
FT                   ICDLEGIMEMDCLIKLSCVNNKLDMLDLSAAKWSKLESLNLSNNNISIIKDLHRLSSVA
FT                   SINLEGNRLCTLTPQIPMPSVRILRFSDNHIASFDISLFPKIRTLYADNNLLSHLGRSE
FT                   HSSPSRLENLSLRNQRTAPLHLTYIDLENVRRLYISGNALTEDFFPSRPLYSLVYLEAA
FT                   ACKMSQWPQDFAINAPHLKMLNLNYNYFTDLNGVKGMNNMRKLTLVGGRLGGEEAGKGD
FT                   GRDVMAGLRGLRNLEELDLRMNPFTLSYYFPLLLPSSSPSSVLDPSTPTRNNEDRNRMD
FT                   QPLAVAPAAWSTYDTRFRKNLPDEWYSKRLVYRGLIMQNCIKMRKLDGIVVEDGERKRA
FT                   NQLLEAALGIRK"
FT   CDS_pept        join(complement(1107553..1107787),
FT                   complement(1107237..1107500),complement(1106810..1107177),
FT                   complement(1106677..1106751))
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806613"
FT                   /locus_tag="CNC03500"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42373.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00004B446F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC5"
FT                   /transl_table=1
FT                   /translation="MTLTFKLSDGKDIPFLAWGSGTGGIGKELQLAIGAGIHALKSGIR
FT                   HIDTAQGYDTEEATGESFRASGLKREDVWITTKISDKIPTDKEAIRKNVLASIARLQTK
FT                   PDLLLIHNPFIVQDGNISQFWTYLEDLVLDGTLEGVSLGVSNFRPQDLEAILRVARIKP
FT                   VANQLEYHPYVLVHLEPVLKIAAEHGILIEAFGPLTPVLRHPDGGPLKPVLERIAQRIS
FT                   KDNGQKLDSTTVLLLWTRQKGVVAVTTSKNEQRIKGLADVEHLPDLTAEEMEEIEKIGR
FT                   SHHYRYYIEHMTEDFPNPDLPSVPSTREKSDH"
FT   CDS_pept        join(1109930..1110214,1110286..1110564,1110629..1110942,
FT                   1111206..1111395,1111451..1111534,1111588..1111748,
FT                   1111815..1111907,1111962..1112135,1112190..1112336,
FT                   1112392..1112450,1112507..1112594,1112656..1112671,
FT                   1112731..1112857,1112952..1112998)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806614"
FT                   /locus_tag="CNC03510"
FT                   /product="Expressed protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42375.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067576"
FT                   /db_xref="HOGENOM:HBG176046"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00004B4470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC4"
FT                   /transl_table=1
FT                   /translation="MPEHAPLSMSGQSDSIASSQQERSRAFEPSDLATANDEAPLRLNP
FT                   GFTQRTTVLEILNARQPPSCDACRTRKLGCSGRPSSIEITTEGLAASPCNHCREWNLEC
FT                   SYTYKRKRRGRKNKAVEQLAVQQKARKLSQATRPSATTQLDDQAGDARDHAESSSVGYP
FT                   IDHNLSTQYNSVSVVGPSSNIGTCHQRPPNLPSHVQARADRPIPWYSHPSVPSQSAILG
FT                   DIGLNRSTLTSDDRGTNSHIQQPAVHLSIDHHENIAEAHITPPDVGASPYHGVSPSTTL
FT                   SNVSLPISTNIELATWTDVIDCRQLPKSYFPIPAHKVRSLSDRCLKACCAVTKSEMDNC
FT                   DVDLICIKYFLFVVHNKHGNIGLEASTFGEAQYLAVTMGLHREDTYCDLDPINAERGRR
FT                   VWFLIYNADKFEAVSRQKPVLLRVDEFMGPESTEFPAEVDDESITSEGILPSRTPAPLI
FT                   AGFNTLTRIVTVLGDILISERDLRRQQITDPENLLSALREMRKLGQRIRYISDTLPRPF
FT                   QLEADQGNSLPEPGWEDAVRGELDMFFSDPLPPETAKDGYLVLKGNIHVTLAMTRLRLI
FT                   LLRENLLNCSGQPGTSSRNAAELVAADIGENTVNWRQSVYQDLYNVVHCLPIRALAANG
FT                   PSLVTKIRVVAVTLLDTLQAQDEAIDPNIQGMTTYLLSFLDIMSSIESQFAD"
FT   CDS_pept        join(1113397..1113915,1113999..1114455,1114502..1114684,
FT                   1114751..1115633,1115684..1115978)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806615"
FT                   /locus_tag="CNC03520"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42683.1"
FT                   /db_xref="HOGENOM:HBG067575"
FT                   /db_xref="HOGENOM:HBG176047"
FT                   /db_xref="UniParc:UPI00004B4471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC3"
FT                   /transl_table=1
FT                   /translation="MDPLPIPPSYYDLERRHLEHTIDHDLHSLSLSSLHSSTSSSSSPF
FT                   HPHDYSNSFISSSSDLSLEYPRAQFSGISTQPTQDVGHGHSYGPSGTPRAARGTNPHSN
FT                   NFGGGHSTSAGISPVSTTGHHASAITLGTGAFKGRIPKTNSGDQGDGGFDPERSLGRLV
FT                   GELGRIIGDEKLPKIPNSPFRPRSRSPLPSAANQTIDPSYLAHCNKHLDSRGSGGKTRP
FT                   KSSNVLHEQAQESGEQSRKKPLGSSTSYNISRTPVTRKTIAKDKVDRLRMLQNEGKKAA
FT                   NASVRKNPDASADVTGMTALMATPAKGLIFDSLENNDDVGGEPAVNIPHTLATLHARLR
FT                   ALEMESSVSRRRVKELEAEVEKANREVDAARRNGEKKTRKSENEKSALEDLVGSLRADL
FT                   ARITLELEQHKALIVELRQANLSNLKNGDRSFSDPSMNHEIAALRREIERLTEEVCRLG
FT                   CIVAEGIEVRRRTRGESTMNMEKVEMERLAKKLIEENSDFQRVKADVEKRKAAVDQLKK
FT                   HEAPIHVPLDSANALFTSIPEPQEAKLVMAHNRSHTSPKTPSLSHAKQHDHVQPSPLAS
FT                   KKSSTPSTPRRHKQEREESSRSRRSKPISSSKALDRSVHSPFPSIMGEDLEREFFSPLP
FT                   NGIEGMNQNAEIKQVTDEMEPGKLPPQTVLARVVAELEGDFQHYKMVYSELADQYKLLD
FT                   PASVSAKRHVLADHLREVIDLLELKAGQISDLYDLLAFKDKPIHANRRKIDGRKAKSVD
FT                   DVMRMVKASLGHEVWERLYIDLKKG"
FT   CDS_pept        join(complement(1119180..1119276),
FT                   complement(1118995..1119128),complement(1118862..1118920),
FT                   complement(1118782..1118815),complement(1118644..1118717),
FT                   complement(1118418..1118592),complement(1118237..1118371),
FT                   complement(1117985..1118188))
FT                   /codon_start=1
FT                   /gene_family="HOG000182856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789283"
FT                   /locus_tag="CNC03530"
FT                   /product="Proteasome subunit, beta type, 7, putative "
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAW42377.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG316821"
FT                   /db_xref="HOGENOM:HBG497931"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00004B4472"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC2"
FT                   /transl_table=1
FT                   /translation="MAKLAETPSVGFDFSNYARNQFLGQRLQGIPKATSTGTTIVGVIY
FT                   GGGSSGEEPGVCLGADTRATGGPIVADKNCEKIHYLAPHIRCCGAGTAADTEFVTNLIS
FT                   SNLELHALSQGRQARIVTAMTMLKQYLFRYQGHVGAHLVLGGVDSTGPHLFTVHAHGST
FT                   DKLPYVTMGSGSLAAMAVFESSFKEHMTRQEAIDLVARAIRSGVFNDLGSGSNVDVAVI
FT                   TKNGTEMLRNYQTPNERGLKSRNYKFRRGTTAWTKESVRSLIVTEEVKSTTGAGKAQGA
FT                   AEAVPVAVGAGPGGAEGMDIDG"
FT   CDS_pept        join(1119482..1119582,1119634..1119672,1119734..1119833,
FT                   1119890..1119982,1120036..1120203,1120260..1120411,
FT                   1120471..1120509,1120560..1120641,1120702..1120851)
FT                   /codon_start=1
FT                   /gene_family="HOG000164027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806616"
FT                   /locus_tag="CNC03540"
FT                   /product="Cytoplasm protein, putative "
FT                   /protein_id="AAW42379.1"
FT                   /db_xref="HOGENOM:HBG176048"
FT                   /db_xref="HOGENOM:HBG396944"
FT                   /db_xref="InterPro:IPR018859"
FT                   /db_xref="UniParc:UPI000042D58C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC1"
FT                   /transl_table=1
FT                   /translation="MQAFRNFQAQIPALPSVDVTAVSKSFRQTVQATRERIGNVGPEGI
FT                   TELPAEYRQLEARVDALRDVHNKMLKITKVHERESYDYPSDVTEGISEVGHQAASAWNT
FT                   FANKNLKNTNLPIPIPSPTAPTPHQPKTLSHALSRAAKSGATELGAEDRLGVSLGIYGA
FT                   ALEKIGDARISQDQVITERFVTPWQATLSTSIGLAMKARQNVKTSRLELDAARAALKSA
FT                   APAKQEQARLHVEEAEDKLVQNTETAIGLMKAVLENPEPLQNLSNLVKAQLIYYSTAAE
FT                   TLSGIQGQIEEAATVAEGDYRQSRGA"
FT   CDS_pept        join(1123049..1123234,1123284..1123946)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806617"
FT                   /locus_tag="CNC03550"
FT                   /product="Peroxisomal membrane protein pex13 (Peroxin-13),
FT                   putative"
FT                   /biological_process="protein import into peroxisome matrix,
FT                   docking"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="AAW42381.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016560"
FT                   /db_xref="HOGENOM:HBG067573"
FT                   /db_xref="HOGENOM:HBG517039"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniParc:UPI00004B4473"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKC0"
FT                   /transl_table=1
FT                   /translation="MQPYSQRYNGSYGMSPYNNMSGYGSYGGYGAMGGMNRFGGGYGGY
FT                   NYGMGGYGVGGMGGPGEGYPTLASSLQASTAPAFAVVESLVTAFTSLAQLVESTYLATH
FT                   SSFFAMVGVADQLGSLKTYLGQVLGVFSILRLGRKILSWLKGKKVKTGPWGEEWDRIGS
FT                   SGLPPNGQGGRPSIKPLVIFLLSALGLPYLMSRLVKVLVAHQTNQKSILSPDGTIDPTK
FT                   LEFVRAKWEFTPTEEWELGLGRDEIVAVLEKRGEGMNSWWRGRTRDGRTGWFPANYVSN
FT                   V"
FT   CDS_pept        join(complement(1128828..1129160),
FT                   complement(1128511..1128780),complement(1128042..1128461),
FT                   complement(1127582..1127989),complement(1127371..1127523),
FT                   complement(1126980..1127312))
FT                   /codon_start=1
FT                   /gene_family="HOG000209156" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636614"
FT                   /gene_name="SNX41"
FT                   /locus_tag="CNC03560"
FT                   /product="Sorting nexin-41"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="autophagy"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endomembrane system"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAW42383.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0012505"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG176049"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI00004B4474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKB9"
FT                   /transl_table=1
FT                   /translation="MDSDTSPNPFASSPPSSPSPRPSLPPPVPRKPSSLVSAASGSPPP
FT                   THRASFPDPARHPKMGATVPGPKPKTGYCCSIDKDISAGEQVHIVDALKTTEGGTASYI
FT                   TYVIRLGTHTVRRRYSAFLSLHQSLTGLYPVLIIPPIPSKQSLTDYAVKGQSKAREDAT
FT                   IIARRKRLLEDFLQRLIRHPILGGEHVLHRFLEEDVSWSEVLHSPPISLLSKNPLHAPS
FT                   HNPTFQPTTPTSPSEAPATTSYIAHHLLPTPSPSHPLRQPDQRFMDSEAFTEKFQSHFS
FT                   GTMEKVNRRVTKRWGERAHDMSELGGIWNGFSLVEQGKLGDAIEKVGRAVDAEYLATAA
FT                   LLQSWEKTTTEPLHIYSQFATLIRARLSFRHQKHVQYELVQEALETQRDKLEILENAER
FT                   EARRLEEALERGGSVLASPQLEPEAARDERERAQRRARASQGFGLLSAVKHSLSGMIDM
FT                   DPEATRRANIAKTRDNISQLEDSYQAAAQDLKYASMTLQADLDRFQRQKVADLREMAIN
FT                   LSQVHRDWCKQNLEAWKAAQAAVREIDPHPNRPAQTQTQVQSQQSHAGPSTLHAQTEDD
FT                   VSKLGVDAMKNEIERVEIEIADKPLPKPSLAETGGDGVVPSPQPRQENDTEEQEGHGPL
FT                   GPL"
FT   CDS_pept        join(1129412..1130096,1130735..1130768,1130827..1131516,
FT                   1131579..1131687,1131742..1131855,1131930..1132053,
FT                   1132109..1132175,1132237..1132385,1132451..1132637,
FT                   1132694..1132755,1132806..1132907,1133121..1133382,
FT                   1133445..1133703)
FT                   /codon_start=1
FT                   /gene_family="HOG000092200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093381"
FT                   /locus_tag="CNC03570"
FT                   /product="AMP deaminase, putative "
FT                   /function="deaminase activity"
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="AAW42384.1"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="GO:0019239"
FT                   /db_xref="HOGENOM:HBG176050"
FT                   /db_xref="HOGENOM:HBG713563"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="UniParc:UPI00004B4475"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB8"
FT                   /transl_table=1
FT                   /translation="MSHSPDDPYTSPSPSPFPSPLPIPAPTYEDHLNGAPHSHSSPSFD
FT                   YHEERRTHLKDEIWMSHHLPRLPPPSASEAGSSVRTDTGTSFKSRMAPGDYFDTSNPTG
FT                   PVRQLSPKASFNPSVLRANMSNVEKGGEAMTMREHEVDPDVNDLGTALRQATLRLDKES
FT                   TMLSPSGPDYGDLDPAPALVHRQEMDAQERLDLEEEKKEKELAMKAFTGENEGQTKVQP
FT                   QQPSGVQQGIGNELESLYASFSRCLELRDKYIELSNQRLGDNPRDHDGTFHGFNPASAG
FT                   DVMGLKPEYDPETVEIPAEAKDDIPTWNIYPPPPPPRWHWKTAQDGVHPEPATIEDNNK
FT                   RSAPNQRDVEVFKVEDCEIPGKDEGRTFMVNDEGVFTVYVDRVNSPSVSNGQPPERQAN
FT                   AQISDDKQPLSRVPSLKEYFTDLDFLLGVCSDGPAKSFAFRRLKYLQSKWSLYCLLNEY
FT                   QELADMKAVPHRDFYNVRKVDTHIHHSASMNQKHLLRFIKSKLKKSPDEIVIHRDDKDL
FT                   TLKEVFESLNLTAYDLSIDMLDMHAHQEFHRFDRFNDRYNPTGSSRLREIFLKTDNLLK
FT                   GKYLAELTHELITDLEQSKYQHSEWRLSIYGRNINEWDNLAKWVVNNKLISHNVRWLIQ
FT                   VPRLYEVFKGQGLVDNFEDVVRNVFQPLFEVTQDPASHPELHIFLQRVVGFDSVDDESK
FT                   PERRLYRKFPTAKMWNTKQSPPYSYWIYYMYANMASLNAWRRSRSFNTFVLRPHCGEAG
FT                   DPDHLSSAFLTAHSISHGILLHDPLQFHFTASHLLEEYSCAAQIYKLTPADMCELARNS
FT                   VLQSGWEMQVKKHWLGQRWYWPGAAGNDIHKTNVPTIRLAYRQATLLEELALIRHGEHS
FT                   PSATPTHLKPPTTIKPDKPGLATHSSDIAAAAMAKSSGIPAAHLVGGASELDRRSLERK
FT                   RAIGGTDKQAQMSDTAS"
FT   CDS_pept        join(complement(1135946..1136117),
FT                   complement(1135714..1135894),complement(1135552..1135643),
FT                   complement(1135272..1135495),complement(1134793..1135203),
FT                   complement(1134411..1134732),complement(1134160..1134355),
FT                   complement(1133917..1134106))
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636615"
FT                   /locus_tag="CNC03580"
FT                   /product="Hexose transport-related protein, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42385.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042E376"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB7"
FT                   /transl_table=1
FT                   /translation="MFFSKYRGSTGRNKPEHAHAPDRDSIPSLDDLGIQLHPDTARYVT
FT                   DSQALADAIGGNGLRDMFGNGLVVAAAFSTCMGGLLFGFDQGILSIVLTMPQFLEQFPD
FT                   VNINVSSSAAFNKGIMTALLELGAFIGALQAGFVADKYSRKKAIALGSVWFVIGAIIQT
FT                   TSFSFAQLVVGRFIGGLGVGLLSAVAPMYISEVAPPNIRGALLAMEGATIVIGIVVMFY
FT                   ITYGSRFIENDWSFRLPFLIQMAPCILLGFGLWKLPYSPRWLAGAGRDADCLNALMRLR
FT                   RLPSTDPRLQAEWISIRAEAIQNREVIIKDHPSLQGRDFMSELKLEVVSWIDMFRPKLI
FT                   KRTIIGPMLMMFQQFQGVNALIYYSPTLFEQLGLDYEMQLDMSGVLNISQMVATIVAFF
FT                   VLDRVGRKPPLIFGSICNTICHIIVAVIMAKYSHDWVKYHNEAWVAVAFILTFMFTFGV
FT                   GWSPVPWAMPAEVHSSSRRAKGVAITTCACWLCNFIIGLITPPMLQNIKYGTFLFFGVF
FT                   ALLSGIWVWFFCPEPMGKTLEQMDEIFRSNTAHEDNITKVEIQAAIMDASPIGSTTSVF
FT                   RSGEKLGDKDIQQEWVETV"
FT   CDS_pept        join(1137436..1137742,1137793..1138207,1138265..1138395,
FT                   1138445..1138662,1138714..1139276,1139330..1139642)
FT                   /codon_start=1
FT                   /gene_family="HOG000240003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789284"
FT                   /locus_tag="CNC03590"
FT                   /product="Monooxygenase protein, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42386.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053468"
FT                   /db_xref="HOGENOM:HBG700572"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000042C1B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB6"
FT                   /transl_table=1
FT                   /translation="MAPIAIQNPLEDAQVAPPPPLKSSKASMGSIKKELPKHPDAVPHD
FT                   YMYKFKYNHELPLHGKEGIEIPQNVNPKDVADEIASLLSQATSKGDPKAFSELFLEHGV
FT                   WRDRVALTWDYRTFNWRSAILKAATDLLPENPISKVTVIDPPPTVERPYEDLSFVQAHI
FT                   GFQTNKVGATALCNIVLTKDGYKIWTFNSAIESLHGFREVPERDGHMTGPHSWTQQREI
FT                   DISMEDSEPEVLIVGGGQNGLMLGARLKALGVNALIVERNKRIGDNWRGRYEALSLHLP
FT                   HWADHFAYMPYPEQHWPTFCPAAKLGDWFEWYASAMELNTWTDSSVTGAKQDPDGKWTV
FT                   EVNRGGQGKRVFHPKQLVMATSLIGIPHVPKVPGDDIFKGTIRHSSQHDSSREWVGKKV
FT                   LVVGTSSSGFDTAYDFARRGVDVTLLQRSPTYIMSLTHCIPRLLGVYKPDDNGKRPDID
FT                   IADRIAHGMPVGPGEELGRRLGQELTELDHDLLQALEDKGFKTWRGQRNTSTQTLGYTK
FT                   AGGFYFDAGACTQIIEGKIKVEQGYIDHFTEDKVVLNGDREKTYDLVVLATGFSNTIDS
FT                   VRRTLGDDVADRCKPVWGMDEEGELNSAWRDTGVPNLWVMVGTLQAARYHSKKVALNIK
FT                   ARLEGICKEPYLE"
FT   CDS_pept        join(1141023..1141041,1141107..1141186,1141257..1141484,
FT                   1141540..1141741,1141792..1142085,1142223..1142236)
FT                   /codon_start=1
FT                   /gene_family="HOG000138244" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806618"
FT                   /locus_tag="CNC03600"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42273.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068300"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB5"
FT                   /transl_table=1
FT                   /translation="MKIEGKSFVITGGLGSIGGSTAKLIAEKGGYPIIFDILSPADGEK
FT                   KIKELPNSERYVYQQTDIADRAKMEQAIQAALKKVPKGSLAGGVHCAAINPGMPWGPKM
FT                   ADKLDDFEKVMKVNAYGTFCVDAVVADAINSQYPPLDPFHERVEEERGCIVNISSIVAF
FT                   DPPARCLTYGPSKTTVLGITSAAADFLAPTGIRVNSIAPALVYSALMNSGGRGDYFKDE
FT                   MNAHSMFPRRMTNASEIGAAILFLIETSMMNAFHLKVDAGWRNVTSWACGRDHGSI"
FT   CDS_pept        join(1143987..1144043,1144124..1144214,1144322..1144603,
FT                   1144659..1144919,1144973..1145121,1145177..1145980)
FT                   /codon_start=1
FT                   /gene_family="HOG000226734" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806619"
FT                   /locus_tag="CNC03610"
FT                   /product="T-complex protein 1, theta subunit (Tcp-1-theta),
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42275.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000042F022"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB4"
FT                   /transl_table=1
FT                   /translation="MSLKVPKASGPDLFKSGYKHLSGLEEAVLRNIAAVGELSEIVRTS
FT                   FGPNGRNKLIINHLGRLFVTSDAATIIREIEVAHPAAKLLVMASTAQEAEMGDATNLVL
FT                   IFAGELLKRSEHLLTMGLHPSDVIQGYEMALAKGREELETLVAAQITSSPLPSVDNLAA
FT                   AVSSSLASKQPGCEVLLSKLVAEAALAVMPKNPKDFNVDSVRVVKVLGGGLEASRVVRG
FT                   MVFGREPEGIVKNATRAKVAVYTCGLDISQTETKGTVLLKKAEDLLNFSRGEEKQLEGY
FT                   FKEIADSGVKLIIAGSGIGDLALHYLNRMGIAVIKVLSKFDLRRLCRVVGATPLARLGA
FT                   PTPEEAGMVDVFETIEIGGDRVTVLRQEEGEKTRTATIVLRGATANYLDDLERSLDDGI
FT                   NTIRILFRDGRLVPGAGASEIELARRISAYGGKTAGLAQHSIKRWAEACEVVPRTLAEN
FT                   AGLNSEDVVSSLYKAHADGQVDAGVDIESEKEGVRSTKDMGVFDPYAAKDWALKLATEA
FT                   AISVLRVDSIIVAKQAGIAPPKQQGHWDDD"
FT   CDS_pept        join(complement(1146577..1146669),
FT                   complement(1146461..1146513),complement(1146067..1146280))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806620"
FT                   /locus_tag="CNC03620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42278.1"
FT                   /db_xref="HOGENOM:HBG067570"
FT                   /db_xref="HOGENOM:HBG176051"
FT                   /db_xref="UniParc:UPI00004B4477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB3"
FT                   /transl_table=1
FT                   /translation="MSDRRKLAAPPGVGAGKPDHPFAVTVEDPVPNAIVPDGYGIKYHA
FT                   YHTIAPNVQCRRLSYDITAWNETAGWCYGACELQSATSSMLISRLGTEKIVMDKVAKPG
FT                   PPAAKVPPGPICSIQ"
FT   CDS_pept        join(complement(1148459..1148551),
FT                   complement(1148257..1148374),complement(1148043..1148194),
FT                   complement(1147851..1147979),complement(1147633..1147803),
FT                   complement(1147349..1147573),complement(1147037..1147273))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636616"
FT                   /locus_tag="CNC03630"
FT                   /product="Putative uncharacterized protein "
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42280.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG067569"
FT                   /db_xref="HOGENOM:HBG176052"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4478"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB2"
FT                   /transl_table=1
FT                   /translation="MASGFSSESPVNILLIGLGSIGSIYAYLLEKSGKARVTAVARSNY
FT                   TLYTTSGVTLDTERFGEINNWKPYRVFKTQQEALNDGTFYASCIVCTKCLPDVLPNVKL
FT                   LEDTLASDQIGSYHLMQNGLGIEEDLFTALEGREIPILSSCAWIGIMTSSDGQVVSWSG
FT                   QDMLVTGIYPPASPETGNQTRAFSLKEAEALNLWVDLLRAGEGIVHPTERIDSIRFSKN
FT                   VWNCAWASVQGLVRATALAFAPLSLEQAAVVKAYFREIVAVGFEAGLLWKGMIQYPSGE
FT                   ISAGLEDVVNYCWDKITGMAVARGVGHKYSLLIDVETGRPFELEVIVGSVLRLAQKHNI
FT                   ETPRLEYTYVLLKVLQGEILREKRLRVKERAVVA"
FT   CDS_pept        join(1152859..1153535,1153593..1153866)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806621"
FT                   /locus_tag="CNC03640"
FT                   /product="Expressed protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42282.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG176053"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000042FACB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB1"
FT                   /transl_table=1
FT                   /translation="MSFSPPQESPNLPSLAAALADTSGAAQGIQIAPELIGDGGAPPDL
FT                   PRREELQGQQPSDGVSQAFGSYQNSSTRDDGYRGWSNGPNPPPRAQNPWEEGYRDHSSH
FT                   PDPTINQQYSYSEQAGPSISTENIEEPQKPPRKRARQSKPRGHEKNGVNSDGLPEEGIL
FT                   DFAHPSGDFKLGPVFVHPPKGVAQACVRCHKIKRKCDNARPRCAGCSRADVACVFELNP
FT                   ATASYVSSLKSDNVTLSAQMVSAAERISQLEAVLVNTGQEIPPPPQTLKNIDFTAIAGD
FT                   KFSAKDDDVSTEDAIKRLAESALTTSLHKRRRMSW"
FT   CDS_pept        join(1155763..1155826,1155904..1156073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806622"
FT                   /locus_tag="CNC03650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42688.1"
FT                   /db_xref="HOGENOM:HBG176054"
FT                   /db_xref="UniParc:UPI00004B4479"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKB0"
FT                   /transl_table=1
FT                   /translation="MPANLARETVDKTPKMVLLRAQARKTFKAIMTMPVLAPPLADADT
FT                   SMEDASTVDVLNKRAADDGSKDAVVKRSRVGM"
FT   CDS_pept        join(complement(1158188..1158598),
FT                   complement(1156932..1158132),complement(1156192..1156865))
FT                   /codon_start=1
FT                   /gene_family="HOG000076521" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636617"
FT                   /gene_name="OCT1"
FT                   /locus_tag="CNC03660"
FT                   /product="Mitochondrial intermediate peptidase 1 "
FT                   /EC_number="3.4.24.59"
FT                   /function="metal ion binding"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAW42284.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG056557"
FT                   /db_xref="HOGENOM:HBG562792"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00004B447A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KKA9"
FT                   /transl_table=1
FT                   /translation="MLRLPRITRRALSSGALAPHFDRPLPPPPPAPPAPLCALPPLTAP
FT                   DALAPLTRRTVRHADALVARIAAAPAHPDPAELRRVVKNLDRLSDVLCGVIDMCELVRN
FT                   VHPDPRWVAAAEKTYETLCSFMNQLNTSTGLYDALVATVSHTFPGNPLSPAELRVAQTF
FT                   LSDFERSGIQLPPGVRAKFVRHSDNILSLGRTFLSFAAAGPSADTPIEIPEPEVLLAGL
FT                   SSKFVASLPRKKRKGPALLAPGSWEAQMIGRYADNEEARRLVYIGSMREDKDRVYVLET
FT                   MLKERAELAHVLGKETWADVALSDKMAKTPQNVLQFLTSLATHHRPSAAADVAALQRLK
FT                   ALSTVSRTSSQLPTVHAWDRDHYAEQYAASLLPNGSLPSITPYFSVGTAMSGLSHMLSR
FT                   LYGISFKPVSVAHGEVWHPSVRRLDVMDEHGKRIGVIYCDLFSRPGKPSAGAAHYTVRC
FT                   SRRVDDDPSEGDGLPPGWDQHLGKGMEVQGEALHGKEGKYQLPIVVLTTDFGTVEESGP
FT                   ALLGWNDLETLFHEMGHAIHSMIGQTEFHNVSGTRCATDFVELPSILMEHFISSPAVLS
FT                   TFATHYTTNEPLPIPLIQAHLQLDQSLKALETHSQILMALLDQKYHSIKHGEQLDSTRV
FT                   WNELQSQVGVIPPVRGTAWQTQFGHLYGYGATYYSYLFDRAIAGKIWSSLFARGRTGPA
FT                   AANHDPAAAEDILSREGGEAFKEKVLKWGGGRDPWEMVGDVIGGAEGEQVAKGDEKAME
FT                   LVGRWMIK"
FT   CDS_pept        join(1158687..1160273,1160467..1160739,1160805..1160880,
FT                   1160938..1161002,1161070..1161087,1161139..1161327,
FT                   1161403..1161640,1161709..1161890)
FT                   /codon_start=1
FT                   /gene_family="HOG000138311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806623"
FT                   /locus_tag="CNC03670"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAW42286.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG067567"
FT                   /db_xref="HOGENOM:HBG176055"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="UniParc:UPI00004B447B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA8"
FT                   /transl_table=1
FT                   /translation="MSAPLFTSPSGAELSLQNAGGHLSRWHVAVGHTPAFRFHRSDAPP
FT                   ATLCTVHLPGLGPVTSDPCANKARAKQSASFRAVQRLLASHELDDRFQPTPSQPRTRAR
FT                   DDIMATKSRCNYRWESRKLLIKDELPQGHGSGDYAYRTTPQFWKECPPFAPGERVHAAV
FT                   LLLSPTAEKTFGHPECRPMCLLTSRPLPLFETHDTVEVNLGVGEQPTHRGCVRMTSAGS
FT                   LEGGLDDVTLGQTLRFTERLMRAELQRLIKADLHRIKWLLLPLTYGYSSARQPGPLARE
FT                   DIAWEQVEAVANGPLTVPFTLKDEDDLAAQCFDAMASANSELTRRSYITAVRQDLNPDS
FT                   PHPERPEKTILQVIQGENCLFPQLVHRKQPILQVETACLAKNGSYITTSATPAEQRSTQ
FT                   FLIPEYENRHCIPASIFRALTPFPFFIHQLECMLIAYEMSTKLFGSLLHPELALQALTA
FT                   PSSQNVTPWTYERLEILGDTLLKFFITIHVYLHGGGANSREDSLKVWQDRHKLVSNRTL
FT                   TANAIKLGLVEFLLADIVEAIIGASYGRDKNFDNVISTLIHLNVPLDLFSTWEEIKHVL
FT                   PLSDDEHDTEEHGAADAETETDSFSACEILGYKFKRKRRYEDVISMSNQPHARRIRENY
FT                   KMLGNAVLDLHVIEFLLAKYPEEGPGSLSNMKTFRTTEGLRCALATELGLQDLLKDGDE
FT                   RAERELGRATYFMRDAKAQADAGLSDEEQGGIHYWDGVAVNHFTGSIIEVIYGAIFQDS
FT                   GFSLEHTQRIFDNHIVPFIEKYCKGPSASDLHPKGLLTRWMQAKGCAYWKLDAVGPKLC
FT                   EGVVTCHDQDVARCKAFTTHVAVRNVCEEAIKRLRDENRIKDICDCPSFKEIVPEDKTF
FT                   GKWR"
FT   CDS_pept        join(1162131..1164008,1164071..1164337,1164392..1164467,
FT                   1164518..1164582,1164637..1164654,1164717..1164932)
FT                   /codon_start=1
FT                   /gene_family="HOG000138311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942395"
FT                   /locus_tag="CNC03680"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAW42288.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG067567"
FT                   /db_xref="HOGENOM:HBG176055"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="UniParc:UPI00004B447C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA7"
FT                   /transl_table=1
FT                   /translation="MTEEPSSIIADNSTAIKSPTTFTSPNGTVLTFQSAGSHLSSWLQT
FT                   IGHTPDYSMEDVLPEGYIPPPLSKKAAKKAALGDANVYAGPPPGSMRVCTVNLPFYGPV
FT                   RSTPWANKALAKQSASFEAVKELHKHGEVDDNFQATPLRPKKKGDTKGTKSRCHDTWEI
FT                   KKAVIKDQLPRPTGGVGHGQYDYQTTPEFWSTCPPFNPRSLHASILQLSPAGEGKYDHP
FT                   ECRMMCMLTSRPLPVFRKSNQVEVRMAVGEQPPLCATMRVINGGKMDTFYSGKLDQALV
FT                   FTEKLMRAEVQKVFKTDLRKVKWLLLPLRREYVPPTKEQLVAGKSASLKLDDISWKEVD
FT                   AVTDGALTLPFTFDDYDSLKREIVDSLATAPSEMSRRSYIIDVRQDLHPLSPHPDIPEK
FT                   TICDVLKEGNVTLPQLTDPSQPILEVETVNLAKTGSYISTAAMAAEERPRQYLVPEFEH
FT                   RHCIPASVFRTCTVIPYFIFYLESMLIAEEMSAKEFNSILDPELALQAITAAEGLNVPR
FT                   WTYERLEILGDTLLKFMTTLHFYLLGGGADSEDDMNKVWQDRHMLISNRTLTANAVKQG
FT                   LVKYVRNKKFKVKEWTPRDWELDLLPGQFAPKKTMPTSFDGPESRVLGDKVIADIIEAI
FT                   IGASYMPNKDLDSVIAILHHLMVPLNLFNTWDDVKHVLPPPKAEEPKNPDVPAYINFFK
FT                   KSSYEVLGYKFKDNKKFEDAFSLAPAQQTRRIRERYKMMGNALLDLYVIELLMDSYPDE
FT                   GPASLSIMKLSRTTEGLRCALAVELGMSDLIIDGDDHSRSELKRATHFMQKAKAQADED
FT                   LNENKEGGVHYWEEVVISRVRSSLSRV"
FT   CDS_pept        join(complement(1166906..1167192),
FT                   complement(1166730..1166843),complement(1166583..1166670),
FT                   complement(1166466..1166494),complement(1166426..1166429))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942396"
FT                   /locus_tag="CNC03690"
FT                   /product="Chaperone protein DNAJ, putative "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAW42290.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG067566"
FT                   /db_xref="HOGENOM:HBG176056"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00004B447D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA6"
FT                   /transl_table=1
FT                   /translation="MSYILTSFLASFLPSQITTAILPYLSANLPAIFPPAPRGSPRYLH
FT                   NYRLAFTGVICIWQGYSFLKDGLGNGDDWYRLLNVQGNADEDALKSAFRTLARKHHPDR
FT                   AGKDNDDHFILARKAYETLSDPVKRYAYDRFGPKILQWKAASVREYILFGLQNSIGFYI
FT                   SLGKVVQDHI"
FT   CDS_pept        join(complement(1169487..1169552),
FT                   complement(1169286..1169381),complement(1169097..1169173),
FT                   complement(1168839..1169046),complement(1168539..1168780),
FT                   complement(1168206..1168480),complement(1168008..1168159),
FT                   complement(1167891..1167955),complement(1167512..1167842))
FT                   /codon_start=1
FT                   /gene_family="HOG000113618" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093382"
FT                   /locus_tag="CNC03700"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="AAW42292.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG316482"
FT                   /db_xref="HOGENOM:HBG394789"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="UniParc:UPI000042FACA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA5"
FT                   /transl_table=1
FT                   /translation="MATLEPKQDPQASARQRGHSAMDFKSATTGVAAKTMRNELNRMVA
FT                   NEQDPAKKKMFEAEMQSFFILFNRFLTERAKGEKLDWDKINPPKPEQVRPYEVLPNVDP
FT                   SILNKLAVLKLNGGLGTTMGCVGPKSIIEVRDNMTFLDLSVRQIEHLNEKYNVNVPFIL
FT                   MNSFNTDEDTARIIQKYQNHNINILTFNQSRYPRVDKESLLPCPRESSSDKSNWYPPGH
FT                   GDIFDALTNSGLLDKLIAAGKEYIFISNVDNLGAVVDLNIFQTMIDAQAEYVMEVTDKT
FT                   KADVKGGTIIDYDGKPRLLEVAQVPKDHLDEFCSTRKFKIFNTNNIWCNLRAIKRIMDE
FT                   DALNLEIIVNNKVTDDGLAVIQLETAIGAAIKHFDSAIGINVPRSRFLPVKSCSDLLLI
FT                   KSKLYNLEHGVLTMDRSREFGGTPVVKLGGEFKKVANFEKRFKSIPNITELDHLTVSGD
FT                   VWFGKSVRLAGTCIIVATEGNKIMIPDGTNLENKLITGNLSIIDH"
FT   CDS_pept        join(complement(1173630..1173860),
FT                   complement(1173520..1173566),complement(1173416..1173481),
FT                   complement(1172913..1173357),complement(1172687..1172753),
FT                   complement(1172609..1172630),complement(1171969..1172553),
FT                   complement(1170533..1171901),complement(1170096..1170488),
FT                   complement(1169951..1170037))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789285"
FT                   /locus_tag="CNC03710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42294.1"
FT                   /db_xref="HOGENOM:HBG067565"
FT                   /db_xref="HOGENOM:HBG176057"
FT                   /db_xref="UniParc:UPI00004B447E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA4"
FT                   /transl_table=1
FT                   /translation="MSRSTMSRQSNGDSTPARDLLLPHPAEDLSADDDLLSWVLVDQLG
FT                   CMPNTRLGVHPQQVKFVGPPFKTDEVLNIVRETVTKGDLNGAMKRLQEFWLFQQHLQSK
FT                   LTTNQKERFIQHLRRYLLCLQPTSRVEIHLTSRYSFATGHTELAVFATRPLARGLVVQE
FT                   LQGSVVPLPEEWREEMDIGDDFAVEAAEESGSERDEEEEDVRSEAFTSTSGRRGKSKAK
FT                   EESRRQGQRRSDRTKRRDFSIVWSGLKRCYQLFLGPARFLNWVYITFEWKPKLTITASS
FT                   GENYFGKGNVECLCLTCEKNHHGGFTPKPESSRRTSRHLSRDFTADPPCVRGRSSVSRS
FT                   RESISTGPTSLKHETAVKQEPFSDDEHEVSIGLSTAPSLSTEEECDTPIDNVSNTPRVA
FT                   SPFGESLASDVDSVIMPPRRERYARKAAQNSKSWLLLKGRGPKTDIDEDLAFVGGDEEF
FT                   PPDFPRCATCAKPLSDQIWYNGRYFDHCQRCVRHALVFQLPWPAHKPQEVQEYPPAYLI
FT                   PPGYIPPKISTVPLPSLSKNRLPPRVNVIATSQTPPRAGNSMEDRAHRLRKQIEIEEFI
FT                   VNSLREAAWSVQEAKELAQEAKEEAKRKKKEEKMRLDALRIKGNGIWQRYEYVDEEELK
FT                   RKQEAMWRVEPGTTRRGTVRKIPQVENSDGKRDKQTGKEAEGTVAVINDEARAKKNEEK
FT                   KRKRAEEKLKREQKMREEERRKEEKRLKDRERKRRAKEMKKEEKERAVLTAVSNYTSTS
FT                   HRDNGYVQPSVDIDEGDNEDLEDEIMVAAAPELLAYYSPETSRTTELPSSAVISARPLA
FT                   RRISKSTSQSPLSSGFKILTSSPQTTISMSAISASNNYAVGVGVPASTPPEAIMLHIPA
FT                   RDLSSKDSASSKLKRKRPPGTVKTMKDQITETAPAKSEEAKSEKGGGGSSTLMGSSQRK
FT                   EESVLPKEDKGKGKDLASHSPKSTISTMDFTKQTALISQELPFGRSGGYFPPPFSPLRA
FT                   NDYPPVATRAAPDLAPTLSRLDTSPQDVAIASASSSSDASLSLTTVAAVKDAMDGEPLQ
FT                   EKLQGLVQNFDPSTASKNHKKRLFEHGVEATSQLQLPPAKKRTFFPSTFQHPMEM"
FT   CDS_pept        join(1174189..1174246,1174307..1174421,1174482..1174572)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807629"
FT                   /locus_tag="CNC03720"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42296.1"
FT                   /db_xref="HOGENOM:HBG067564"
FT                   /db_xref="HOGENOM:HBG176059"
FT                   /db_xref="UniParc:UPI00004B447F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA3"
FT                   /transl_table=1
FT                   /translation="MRLSQVNKILLGSCIVVVPLSFYGGLAIKEYYLSKELEKVDDSRP
FT                   PPHERAMRARIVQLEQERQELLKEGQNLDIKIRDIRKRMTEV"
FT   CDS_pept        join(1176263..1176359,1176420..1176608,1176668..1176721,
FT                   1176770..1176869,1176924..1177106,1177157..1177256,
FT                   1177313..1177438,1177496..1177553,1177616..1177620)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807630"
FT                   /locus_tag="CNC03730"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42298.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000043029E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA2"
FT                   /transl_table=1
FT                   /translation="MSDGEHALAKTVFGSDRLSASKLFNVDGWVVLVTGGGTGLGLITA
FT                   GALAENGAKVYITGRRLEPLEEAAKTAAPKGGKGTIIPLQADMSKKEDIDKVKETIISK
FT                   EKWLNALINNHGVAITPPKIDEAEQTAEGLSKFMYDEEKFDNWLDAYRINTASYYFTSF
FT                   AFLPLLAAAKSVGNYSEPGNIINVASVSGVAVTSQGGQFSYNSSKGATIALTRMLATEL
FT                   ARRELGIRVNMICPGYFPSGMTGYTEDDTQPSKEFKDKMGTPLGRTGNAIDYAQTVFSL
FT                   LSNQYITGRELVVDGGYLLNQI"
FT   CDS_pept        join(1178206..1178299,1178357..1178545,1178605..1178658,
FT                   1178706..1178805,1178865..1179047,1179108..1179207,
FT                   1179275..1179403,1179472..1179529,1179581..1179588)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789539"
FT                   /locus_tag="CNC03740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW42300.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA1"
FT                   /transl_table=1
FT                   /translation="MSSSHSLARSVFGTDALTVNKLFDVSGWVAIVTGGGTGLGLITAG
FT                   ALAQNGCKVYITGRRLEPLQEAAKTAAPSQGPGSIIPVQADMSTKEGIAKLKDVIESNE
FT                   RWINILINNHGVSLPAPQINEAEQTPEGLSKKMFEDETFESWTDGYRINTASYYFTSFA
FT                   FLPLLSAAKTVGNFPEPGNIVNLSSISGITKTSQRGQFSYNANKAATISLSHQLATEFA
FT                   RRDIGVRVNVVCPGYFPSGMTPVDNKYHSAANAEFKQKWGTPLARPGNAVDYAQCIFGL
FT                   VTNQYVTGAELIIDGGWLLAQPF"
FT   CDS_pept        join(complement(1180999..1181176),
FT                   complement(1180736..1180951),complement(1180593..1180674),
FT                   complement(1180338..1180544),complement(1180016..1180283))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093613"
FT                   /locus_tag="CNC03750"
FT                   /product="Endoplasmic reticulum protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42302.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176060"
FT                   /db_xref="HOGENOM:HBG735886"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniParc:UPI00004B4481"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KKA0"
FT                   /transl_table=1
FT                   /translation="MNQPCDVASSPHSSYTSLLLHFSIPYIHLLRRPHPSTAMPAIDPH
FT                   YLWALGHFTVLFSTAYIIFQTVLFRGTPVKTYRLAYSGALLSYFIVVYKSLGRPQLSQP
FT                   WLRRALVDENCQYALLALFWWISKPVNLTVLPFATFSLFHCLTFLRTNVIPKLVPPPPK
FT                   PAAGAAPGATASGASAPQPARPPALLDNVSRRIQVWVKTNYDTAMRFVAYAEIFITLRL
FT                   FAGVLTFRTSFITALFMIHFVRFRYHASPFTRSAVQDITARIDAFVAGKGAGVQNAWAT
FT                   VKRFVVSWGGMPLLPNEGRNGAQGPAAQAQQAARG"
FT   CDS_pept        join(1181308..1181533,1181594..1181797,1181851..1181867)
FT                   /codon_start=1
FT                   /gene_family="HOG000210688" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789540"
FT                   /locus_tag="CNC03760"
FT                   /product="40S ribosomal protein S12, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW42305.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG319268"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniParc:UPI000042CB2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK99"
FT                   /transl_table=1
FT                   /translation="MSDAGSETASNHPEVEAQEVEVAAPSGPMSVEDALEQVIKTALVH
FT                   DGLARGLRECAKALDKKEAHLCVLVETVTEAEYLKLIEALCTEHGIQLIKVSDAKVLGQ
FT                   WAGLAKIDREGKPRKVVGCSCVVITNYGEDSAALQVLLEYFKTR"
FT   CDS_pept        join(complement(1184039..1184350),
FT                   complement(1183826..1183989),complement(1183644..1183774),
FT                   complement(1183496..1183593),complement(1183178..1183442),
FT                   complement(1182611..1183120),complement(1182239..1182552))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942681"
FT                   /locus_tag="CNC03770"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42307.1"
FT                   /db_xref="HOGENOM:HBG067562"
FT                   /db_xref="HOGENOM:HBG176061"
FT                   /db_xref="UniParc:UPI00004B4482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK98"
FT                   /transl_table=1
FT                   /translation="MPHPHTSIAPYPQPGDSSPHKTQSQDSLALQTPSSSGSTSTNSLQ
FT                   LLDNDLDDPDDELDLDLDDMDLDEEESDARVDEPLVRGRGGRRRGRRYKEEATERGLLE
FT                   LIPSLILSHPLPLLPLLALLPYNFLPAGVVFFVPVICILALLSVCAHIVIVYLAWYLKV
FT                   PSFEDVFANVTGKYGKYGLWGGRVATLIAVLGMLVSWLGTLHPLVQPVIETYFPANAVF
FT                   SSRVFWTLLLSLTLLPSLLPSRMTRSLHRSPFVLVLLLPIVAFLIIGRTVEIRKASEIA
FT                   QPGGDHAGDGGADVASLATDVLVHLGKRRFGLAGGSSAGAGLTTLTIFFSPHVNTLPIH
FT                   STLARTKRSSFFMPCLISGAVILILSLPLALVPYYLLPMDATAADTGKGVISNNTIPSG
FT                   VFAHLPADDGWVNLARLLMVTLTLGSTNMWILRGRDVILKAMDVDGGNHYKVGRWIGFG
FT                   WWVVAVGAACLGGWLADKIELVGVLGVIAVGWFLPSLFFIITFHVRSPLSIIFPSRQPP
FT                   PNPDALASLSTSHNLNRRGHSREDSLNDPSTDVLLARKERQLQKRRLGRRLWQDLIVYV
FT                   GIMPMGCVTLAWTAGRLVGLW"
FT   CDS_pept        join(1185041..1185065,1185140..1185252,1185300..1185348,
FT                   1185405..1185601,1185645..1185944)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789541"
FT                   /locus_tag="CNC03780"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42309.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG176062"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI00004B4483"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK97"
FT                   /transl_table=1
FT                   /translation="MDRTCCSICFQSDARMAYIASVISHIIQDPSGINMPKLKDWIRTC
FT                   RTWEGGYASRPGGIEAQGGTTYCSLVALSLMSDFDKSPSPLNDRIFQTDTLRWLVSRQL
FT                   GGFQGRPGKLEDVCYSFWCGGALSLTPGKVLGRDDLIDHDANKSFLLSAQSPLGGFGKE
FT                   PDDYPDPYHSYLALAALSLSLNRFGEDKESNFRLKALNVRWNVSTETAEWLQTEVTRVK
FT                   EQERS"
FT   CDS_pept        join(complement(1187211..1188078),
FT                   complement(1186030..1187087))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807631"
FT                   /locus_tag="CNC03790"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42311.1"
FT                   /db_xref="HOGENOM:HBG067560"
FT                   /db_xref="HOGENOM:HBG176063"
FT                   /db_xref="UniParc:UPI00004B4484"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK96"
FT                   /transl_table=1
FT                   /translation="MSSRKGKARAESPDERTLLLPEPFRPRSQPVPPAEQSPPRRARVR
FT                   SVLLTVSIVAASLFLSALLFIALLAASFKPSPSELSDLPQTAFKYTSPSSISVVNVTDD
FT                   GILVNISLSCGIDVDRALGIQNFYQESERQKAAERGDRGMGAVWWESLRRKSANWLIGS
FT                   LQRKQMSLDISKGVYIFPENDSSPPLGHIDLLGPLSIPLVTGVPPYSPDHPDLSWLEPI
FT                   SFTAFVKPMASSGEIWNFIHQGWLHGGLNVAVGAESIQTGLGDGEERWWGRWVAMKEND
FT                   VSLQMELPIPQLPGLPRPGHPFDLSALVSLQNYSLSNADDRSLVINAMATIPNFIRHLD
FT                   FVQNGNFTVPFGLPFALSLPSSEDDVRMATVILQPVTVGQEKMIELRMSGTVIADLDRT
FT                   TGGNDTSPLSAFLQNYLHGRPSPIIVRGLSHYPNSSFFPVAPRWLLSTLPSLSLDLSFP
FT                   GPSPPPQIIRSVTIERMTIVEKEGKMKAGGIIVAEVEMPKDMRDVDVDVRAVRPDVLIY
FT                   DGPAPEDDVYHKGDGEKDEYPPKAFGHIHPAKWLPSTTTRSSDPFTPHRFIVRAPLSDV
FT                   DLDILPGRDSILSGFVTKIIFKGGALAGVEGVSDVQVQVKGVKGEVEVGDLPVRGEFWV
FT                   GKKKAL"
FT   CDS_pept        join(complement(1189848..1189925),
FT                   complement(1189688..1189793),complement(1189182..1189639),
FT                   complement(1188988..1189069),complement(1188312..1188940))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789542"
FT                   /locus_tag="CNC03800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAW42692.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG067559"
FT                   /db_xref="HOGENOM:HBG176064"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00004B4485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK95"
FT                   /transl_table=1
FT                   /translation="MSDPISLITDSLTLPNGIRVPNRLVKAAMAEGIGLGGGPPQPNHL
FT                   RLYGRWAQGGWGMVISGNVQIDPKHLASPHDLTITPSTADRVAYRRLASVVASNLEPPL
FT                   LIMQISHPGLQSSSTVNFSRLPYQRAIGPCSARPDMDGGIMGWLWSHAVWPRKSKEIND
FT                   PEDWLRIVDKFVVGAVLAEEAGWDGVQVHAAHGYLLAEYLSPLASHHAANAGINRKTSK
FT                   SFIKAVKVNCSDFVQGGESGLDEIQASELIKTIVSWQLLDIIEISGGTYTQPAFAYPET
FT                   LSSPSKRQSLFSHFTTSLLPLLPPPPQGPAILLTGGLHNRELIAASLAERACDMVGIGR
FT                   PACLIPDLPRRIILNRAIADDEAFFGTYSIPHAKVVKFLLGGPSTAKGKGIPLVGAGVS
FT                   TLWHTWQMCRIGRGVEPDGEMSWFRGLLVEEIWKGMIVRGVTLMLSWKGNV"
FT   CDS_pept        join(1190453..1190539,1190606..1190667,1190784..1190876,
FT                   1190928..1191005,1191066..1191288)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942682"
FT                   /locus_tag="CNC03810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42312.1"
FT                   /db_xref="HOGENOM:HBG067558"
FT                   /db_xref="HOGENOM:HBG176065"
FT                   /db_xref="UniParc:UPI00004B4486"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK94"
FT                   /transl_table=1
FT                   /translation="MSRFLFTFLFVLLSVQFCLAQRLATRIDEDGHTVVITGPNGYNGV
FT                   GTLPSSTATPMSTSMSASSRMTKSRLDDSTMSSTPFASALDSWHSAANAAWTESPSASD
FT                   SSSSTPATTASSTEKSAAVNGAASAATDASATTSQTNTSAVMSHAESSATLSLPLNLGP
FT                   VIGITLTGVVSLWALIA"
FT   CDS_pept        join(1191917..1192333,1192399..1192822,1192881..1193084,
FT                   1193135..1193210,1193264..1193495,1193551..1193871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807632"
FT                   /locus_tag="CNC03820"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /protein_id="AAW42313.1"
FT                   /db_xref="HOGENOM:HBG067557"
FT                   /db_xref="HOGENOM:HBG176066"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniParc:UPI00004B4487"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK93"
FT                   /transl_table=1
FT                   /translation="MPSKKGKSKSNAKANAAANSNSTQRAPNLPNGAPTVPDEAAPQAP
FT                   PADETIEPKPLQEGEEQTQEQNHEHKDEEPSGPSRGEEQEEQDDVPVDERIRILEDDLE
FT                   TMRQEKEALGNQYRSLLGKLTAMRTTLGDKLKEDAEELDRRETQINNLVTENSELHETV
FT                   NTLKSELSSLSQESSHLSAQLAQLRSQSDSSSSDVLSLTREMRELRGEMERLRLEREEW
FT                   EVEAGRERERRETLEDDLRVFERREQDMCSALEKLAEERDKEKERGDNLQEVLSEFQAA
FT                   KDSEIQRATVELETQLRTAAESLSEFKLRAANAETRLSEVSSDASKSSALEKELKDKNQ
FT                   IIGKLRHDTVVSNEHLKEALRRLRKNQSDNNVDRRLVTNILLSFLMTSRGDPKRFEMLS
FT                   LLATILSWDDAEREKAGLQRQAAAGGGSKGKASASKGKETEKSAEEEAAMNESFSNLFV
FT                   EFLLKEASQGQPSQTGTSDHQPHRTLSSLSLDSPPIFSPPRGPAAGSMTFSPPASSPRQ
FT                   RPREMSSSSSVSEWPMMMGGRKGSYALKDVMEGQGQTYNP"
FT   CDS_pept        join(complement(1194845..1194896),
FT                   complement(1194687..1194796),complement(1194580..1194636),
FT                   complement(1194435..1194524),complement(1194361..1194384),
FT                   complement(1194073..1194309))
FT                   /codon_start=1
FT                   /gene_family="HOG000161354" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807633"
FT                   /locus_tag="CNC03830"
FT                   /product="Inorganic phosphate transporter pho88, putative "
FT                   /protein_id="AAW42314.1"
FT                   /db_xref="HOGENOM:HBG055481"
FT                   /db_xref="HOGENOM:HBG328355"
FT                   /db_xref="InterPro:IPR012098"
FT                   /db_xref="InterPro:IPR019263"
FT                   /db_xref="UniParc:UPI000042CFE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK92"
FT                   /transl_table=1
FT                   /translation="MNNPAVSNLILSLGAMQVARKIPMEDPQVVNYLRIGYVSAQLISL
FT                   AIYYFITLKIRKKNDLTVLKYVNPASPMNPDAKPELVQTTVKDYDLAETGKAIRSLLIS
FT                   VAIMTFLHGYMKYTQPLFIQSIMGLKGALESNPAKLHLWNKKAEGDLARPFKSSGGMFE
FT                   SLTGKASGPQTDAASIKEAEKAGKAE"
FT   CDS_pept        join(1195116..1195305,1195357..1195556,1195629..1195709)
FT                   /codon_start=1
FT                   /gene_family="HOG000135997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789543"
FT                   /locus_tag="CNC03840"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAW42315.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG176067"
FT                   /db_xref="HOGENOM:HBG737185"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniParc:UPI000042FE46"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK91"
FT                   /transl_table=1
FT                   /translation="MRPQLFRPARTLGRRLNSSSSSPQANPNVQKAVENAQKAYAQTAA
FT                   TLKKAAGPVGEKIGGALGGYREPVVYNSKVFASICRQVWQAEKLSPPLDLATWARAYSE
FT                   IYAKASNGGYWKNVLKTGAWAGLGVAALEAYGIFKIGEIVGRRNLVGYSLKE"
FT   CDS_pept        join(1196245..1196247,1196301..1196355,1196406..1196461,
FT                   1196527..1196733,1196789..1197058,1197121..1197235,
FT                   1197284..1197353,1197401..1197460,1197506..1197911,
FT                   1197958..1198339,1198392..1198666)
FT                   /codon_start=1
FT                   /gene_family="HOG000105095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807634"
FT                   /locus_tag="CNC03850"
FT                   /product="Phenylalanyl-tRNA synthetase beta chain, putative"
FT                   /EC_number="6.1.1.20"
FT                   /function="ATP binding"
FT                   /function="RNA binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42316.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="HOGENOM:HBG023052"
FT                   /db_xref="HOGENOM:HBG497667"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniParc:UPI00004B4488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK90"
FT                   /transl_table=1
FT                   /translation="MPTITVDKAELYRRLEKEYSHEEFDELCFEFGIELDEDTTIQVEE
FT                   ARKRGLPTPPPQLKIEIPANRYDLLCIEGLARALRIFLQKDIPPSYKLDIPEKLQEVYV
FT                   EASTAPLRPYFASAVLRLARPMNQLEYESFIDLQDKLHQNLCRMRKFVAIGTHDLDTIE
FT                   GPFRYMCKDPKQIKFAPLNRDTEHTAEELMTIYEADRHLAKHLHLIRDAPAYPIIYDSK
FT                   DRVLSMPPIINSQRSKIVPGKTTNIFIDTTATDKTKLDIVINMVCAMFAEYCRVPFYIE
FT                   PVRVHMPDGTSHITPPLEPRATTASSSYINAATGLALSRQEICTLLTRMSLSATPSPSN
FT                   EDLLDVLVPCTRPDILHECDIMEDAAIAYGFNKLPREMPTTNTVAKAFPVNKLGDIIRK
FT                   ECAMAGWVEALPLILCSHDENFAWLNRPDPGHYAVHLANPKSLEYQVVRTSLLPGMLKT
FT                   ARENKALPLPMKIFEVSDVAIQDSTEERQARNYRRLCAVYMDRKAGFEVAHGLLDRVMQ
FT                   ILGVPLLERKENEGNYGYYIASADDPTYLPGRAAHVFYRPKPTVQPSEPTPSAPPSNPI
FT                   QSFTSDLKAALHAEKGSSWERDIDIGSLGILHPSVLDNFELIRPCSALEIDVEPLL"
FT   CDS_pept        join(complement(1201507..1201720),
FT                   complement(1201273..1201453),complement(1201068..1201211),
FT                   complement(1200808..1201017),complement(1200673..1200758),
FT                   complement(1200571..1200615),complement(1200224..1200514),
FT                   complement(1200105..1200175),complement(1199929..1200055),
FT                   complement(1199748..1199866),complement(1199610..1199691),
FT                   complement(1199273..1199562),complement(1199147..1199219),
FT                   complement(1198853..1199097))
FT                   /codon_start=1
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807635"
FT                   /locus_tag="CNC03860"
FT                   /product="Adrenoleukodystrophy protein, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42317.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00004B4489"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK89"
FT                   /transl_table=1
FT                   /translation="MPSSHIVPLTKDTLRSRFKFILNSYLQHRPIFQRAFTAAFVIYCL
FT                   ISTYGSLTGRGAKGAPGGKGNGKRDKGAKHGITGSIKDPLFHVRLKRLIRIVIPSLKSK
FT                   EAAMLALHSAFLVGRTGLSLYVADLDGRIVSSLVTANPHAFLMNIARWLLVAIPATYTN
FT                   SMLEYLQSELGLAYRTRLTKYALTMYLDPPGVESGGDKDGEQLFYKLANLDDRIKNADQ
FT                   YLAEDIQQLSSKLAEIYSNIAKPVLDVILYNYQLSRNVGAESLVLLTILVQTSATLLRA
FT                   ITPPFGAYTAHEAKLEGELRFTHSRLLESAEEVALYHGEEFEKNVIERGYFALVKHINR
FT                   ILKIRVGHGMAEEGVIKWLWGSLGLCICAIPVFGGSALGMKEGDLGSRTEGFVTNRRLL
FT                   LSSSDAFGRVMYSYKDMAELAGYTSRVSELFETMEHAKKGEYQKKLVSSVSTENNAKIL
FT                   QGRGKIIESDEIEFDQVPLISPNGDVLVKSMSFHVKPGKHLLVIGPNGCGKSSLFRILG
FT                   GLWPVYGGTVYKPPSNQFTYIPQRPYLCTGTLRDQIIYPHSHADMLSHGKSDEDLSKIL
FT                   EVVEMAGIIEREGGWDAVREWRDTLSGGDKQRIAMARLFYHKPKYAILDECTSAVTLEI
FT                   EKTMYDHATSLGITLMTVSHRPSLWKFHTMVLEYDGQGGYTFTHLDAEKRLALQEEKQE
FT                   LEHKLLSVPKLKDRLEELKMIKEQREFTSGI"
FT   CDS_pept        join(complement(1204258..1204315),
FT                   complement(1203981..1204170),complement(1203392..1203928),
FT                   complement(1202879..1203338))
FT                   /codon_start=1
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807636"
FT                   /locus_tag="CNC03870"
FT                   /product="Putative uncharacterized protein "
FT                   /function="coenzyme binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="AAW42691.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG421010"
FT                   /db_xref="HOGENOM:HBG729179"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B448A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK88"
FT                   /transl_table=1
FT                   /translation="MPTKLPRIHTTGWIGLGAMGHPMALNLFLKTHQFYQKVSPSVTPT
FT                   FLFCEHEDSRAESFIRELRNRGGQDLASRAERVGTGKEMVMGASKVFTMLPSTPQVQAV
FT                   YLDQDNGILAGLAKLPMDTPPLSETLLLSDTSLLSNTVTQEEGVKKESPSMIDASTPAT
FT                   QPIHVHTMLVDQTTLDPTVSLSISSLIHDSTSRAALMIDAPVSGGTVAAERGELTIMFG
FT                   SPAPIATRLAMPLLQMMAREGGVIECGGSGTGVGVKVCNNLVLASNQIALSEGLALGRS
FT                   LNIDIALLQSVINTSSGSSWSSRVNPPISSIPGTPASRGYSGGFQTRLMLKDVNLALQA
FT                   ANKHNLATPLTSASKSIYEAICSDGDGDWASKDFSWVKSMLEIDKTESFFSVAYEWVQK
FT                   KQQEAMDMAWKDGLP"
FT   CDS_pept        join(1204578..1206152,1206201..1206392)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807637"
FT                   /locus_tag="CNC03880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42318.1"
FT                   /db_xref="HOGENOM:HBG067556"
FT                   /db_xref="HOGENOM:HBG176068"
FT                   /db_xref="UniParc:UPI00004B448B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK87"
FT                   /transl_table=1
FT                   /translation="MPRSPSPPPRLPRRPFIEDSPQRFRDRDPRDDYRYRGEPSRYRGP
FT                   AGFDRDRRDPRDRDWRDRDVERDYDRGSRFGGRQSWYARDRDAERMRERDDRDRIRSPL
FT                   PVRPGISLIDRDERPRDERPRESIEGSTKARSEGTPEEGQITSPVVAPPTISGLPPRPR
FT                   SPPRSPPRRRSRSPPPFRRFDRESWRDRERDRERDRFYRRRSPSPYSPIRRRRSPSVSS
FT                   ASTPSRSSRFSPIKRGISPAERSRYTRSPMSEKPQRLTSPEPMSPIDHSRPLSRTSVSG
FT                   PTRPQTPTSLPPTLSTPQQPAPALAHTQPLSTPSVSTFPKRPPPTGPRSERLGLVPPTG
FT                   PRALAHLYGGRPAAPRVPYATPIAGLSSTNPTPTATVKNDFHASTTPETPTATFGAHAP
FT                   PTGPSSGRLSWSERKNVLSQPHPISTSEQTSNFNPYAPLPSYNGQAANRRGDSSSPAPA
FT                   PHPSSSVSTTPLPRILTPAAEESPNVEESVVAEEELAERKAKEEQARILAELPPVLIGF
FT                   GGSAWETELASHMHHYTSLVQNTLRLQAAQRLAAASLADAEAERVAVMERSKICDEQLM
FT                   SGTLGVGIIGGI"
FT   CDS_pept        join(complement(1207941..1208068),
FT                   complement(1206870..1207891),complement(1206745..1206818),
FT                   complement(1206665..1206691))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807638"
FT                   /locus_tag="CNC03890"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="AAW42319.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG176069"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="UniParc:UPI000042FAC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK86"
FT                   /transl_table=1
FT                   /translation="MSNPQLSSDEIQKLCSDLVYQVAYSFYDVPYIIILKMLVQYNVMT
FT                   EIDLGQRVGLSPNEVRKYMGTLHLHRLVKRHVNREKQILPEWKKSQLSTQAMRQSYSSN
FT                   KPPIGDSRTRDVHYWYLDYREFANVTKYRLAMMRKGIDERIKSEVGQRGYQCPQDGRVY
FT                   DTLDVGHLFDPTTSTFRCEDCQAELIEHDPTIDQENNSSLQDMMQRFNIATAPIRDALK
FT                   AVEVLTLPSTNVIAWIAQNVKTGVVSVNGQEGGEDSKKFEVVIGGEDDEAKEKLAQAQR
FT                   EQNALPEWYTHSTVTGDATTLGINDINQRAKVAERAKHVGDHETEVGDQALAAHYELLD
FT                   EEDDVEEVGVDINEGVQLDTVERRDEAEVEEVPAGESLGKTVFVNGQMKKIEDVTEDDQ
FT                   ELMTSEEYEAYAQAMYG"
FT   CDS_pept        join(complement(1210104..1210679),
FT                   complement(1209361..1210050),complement(1209190..1209309))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789544"
FT                   /locus_tag="CNC03900"
FT                   /product="Cytochrome c oxidase biogenesis-related protein,
FT                   putative"
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42320.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG067555"
FT                   /db_xref="HOGENOM:HBG176070"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI00004B448C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK85"
FT                   /transl_table=1
FT                   /translation="MFGLRIGTATLSASQAVRSANSMPTSRKLSTLISTFTPRSALVSS
FT                   IERPSLASSKAVRQNQLRLLSSATITQTAVDSQLASPVDLPLEPLHEPLLQPASTFLDP
FT                   LIHPLSEALLSIPHPLGYGTTLILLTVIVRTAFTLPVSLWQKKRAKKMQSVVAPEMKVI
FT                   NEQLAETVAKECRKKGVGYAEYLIELRRQLRKAQKAVHKKHNIHPWVTTWAPLVAHIPI
FT                   FVTLSLTIRRALDLPGSPMASESFLWLDSLGQADGYGILPLVGMAVAFGNAEVVGRRVK
FT                   DVRDALEGKVSNEKKAGLSATPVPQSRRIPKPESPKGDINARPSPLFARSPPANTGPTS
FT                   HNNQTRSLSTSNSLNVQRQARWKAPTNSLIKEKDDGFVEVGPNDKPPTFSLARQAEFRR
FT                   SIFANILRFSAIGFAMIASQMPSGVVLYWFTSLCYSFIQNFFLTVLPQLRLEKQRKEEA
FT                   VSN"
FT   CDS_pept        join(1211426..1211497,1211545..1211641,1211695..1211858)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942683"
FT                   /locus_tag="CNC03910"
FT                   /product="Transcription initiation factor tfIID, putative "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42689.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG176071"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00004B448D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK84"
FT                   /transl_table=1
FT                   /translation="MDEEQARRFDTFSTVAINKNAIKRLNRDLFDQHCPPQLSQVVAGM
FT                   AKVFVADVIEMAKDLQPHSAHPTGPLQPYHLKLARMCLEEQGMVGSRTQGSASGLRKGK
FT                   ALFRRR"
FT   CDS_pept        join(1212230..1212567,1212615..1212640,1212715..1212787,
FT                   1212837..1212938,1212987..1213391,1213440..1213518,
FT                   1213570..1213687,1213738..1213768,1213835..1213903,
FT                   1213952..1213986,1214405..1214589,1214641..1214713,
FT                   1214760..1214879,1214922..1214956,1215011..1215399,
FT                   1215450..1215482,1215539..1215580,1215637..1215785,
FT                   1215847..1215912,1215961..1216130,1216196..1216216,
FT                   1216272..1216694)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807639"
FT                   /locus_tag="CNC03920"
FT                   /product="DNA supercoiling, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="AAW42690.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="HOGENOM:HBG716030"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00004B448E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK83"
FT                   /transl_table=1
FT                   /translation="MTIGTIKPRRSLGAIIDSIPSQQEYVPDSCSENSGSDSERDAPIP
FT                   TLKPIPLTPLPPRSARLISELGADPIKIGKKNEREEARAVPGDGKIDTKVHGAVDTLLA
FT                   PVLYFAVQWRKPQFKKHKTWDGDANIKVEGNRIVMLDEDGNQMAATNVGDKVIKPEAEF
FT                   KIGGYEIMVDHVLQQDQFKASTSILNRPKVIPTIKSTGYRPASFTKPFRPPIQKANLTP
FT                   AKPSTMEIVNNEQHQSPISSSSKRSIPTPAAAQRAVAASSFYTRQSPKPFNERIVLGEK
FT                   SNKERLQWGGALFNPHAEGAVVMPRPGEKLAKLKGTTIVDVVLDPVLGNLLRDHQKEGV
FT                   KFMYSCVMGMTGAEGEGCILADEMGLGKTLQTIALIYTMLKQSPFANQTSIIGKAIIVC
FT                   PVTLVDNWRKEFKKWVDRRVNVLVADVLSGTPVQNDLGEYWAMVNFACPGVLGKYSAFA
FT                   KHYEKPILKSRTPNCSAKDVELGRERANDLAKLSKEFVLRRTAAVLENYLPPKYEYVIF
FT                   IAPSLLQLSVLSNLLDPNIVGSFIRGYGAQSLALIDLMRKISNSPMLLKRRDDELARAN
FT                   DDLGSATSAAISAIPSDANINDVTTSGKMLMLDKMLHSIYQCTEEKVVVVSNWTSTLDL
FT                   IQGLCKLKRYNYLRLDGSTPPKQRQELVDRFNKDKGRQESFVFLLSAKAGGVGLNLIGG
FT                   SRLILFDSDWNPSTDLQAMARIHRDGQKRPVYIYRFLTTNAIDEKIYQRQITKTGLSDQ
FT                   MMDQTRTEKQTSKDSFSAAELRDIFTLNVRTDGCQTHDLLGCQCTRKPVGETRDIAEGE
FT                   HNSKDLPDNASEESDNDENDHPTFVSANKYDPEPTPKMRRKAIQEQKNKLAALKHWAHF
FT                   DPFEPASFRGIQDSLLYNVLFDSWETDSAPLSQNIKTYGSLAFESPHERHEDDLDSDEE
FT                   VLVPKKRKSGIVRSGVMLKKARAADEENTGFSQRRHNLRSIAESGGTGRVTFVFEKISK
FT                   STIA"
FT   CDS_pept        join(complement(1221830..1222019),
FT                   complement(1221759..1221770),complement(1221653..1221668),
FT                   complement(1221506..1221594),complement(1221406..1221448),
FT                   complement(1220574..1221346),complement(1220501..1220522),
FT                   complement(1220335..1220431),complement(1220128..1220279),
FT                   complement(1219981..1220078),complement(1219752..1219926),
FT                   complement(1219559..1219691),complement(1219303..1219498),
FT                   complement(1219104..1219244),complement(1218973..1219052))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807640"
FT                   /locus_tag="CNC03930"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW42701.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG067551"
FT                   /db_xref="HOGENOM:HBG176072"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00004B448F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK82"
FT                   /transl_table=1
FT                   /translation="MDFYPPQLAGQSSTTTSLEHLGSSTQANQQPVTPDTVTTENKRKK
FT                   RTGSSGKDGTKIKKTRQSQSCDACRARKVKCDRPPPGKETDGPIKNMCSHCAQLNLPCT
FT                   FDYVQRKRGPPNMYLKRIQEDQQVECNENGKSISSTVGSSKFSSEVPATIPRAPPPLQA
FT                   ALRGTPPATSDNTSSEWQPTLGMTMSTTRAAHAGHYPIMSISASSSPSVQAATVPLGLS
FT                   PLRSRSYLPVSLDPSHSLATSQTPSAQSSPLHLPQHLAYINHTYDPRNPLDSVLPRRLL
FT                   YHIIDLYFDYIYCLIPCLHRPSFIHDLNTKREENPDQEEWVILVLAVVASTLVQLPRSF
FT                   VDLPRNEVKDLVLRCHNRIKDYLARDFDTITVTRTIIIYLSLYVYGITGHIVVSHGLFG
FT                   QNYVFMLALRAHEEGTYATLGNIERVLLRRMFWLMYGGDKTLAFTGAFPVLFHEDDCAS
FT                   VALPDDIDDEYLTEEGYTKQPESYTSVLSGFRYISHLFRVSGEVLDKRRRDKIRSPSGL
FT                   MLQMRINEINELYNRTMSIMDFCPAPLKLDYRSASASVMSMSPDWDERIKSDIHTIFSD
FT                   PNEHDMDLVKDFYLVQQANIYVTQQLVRFIIIQYREELLEIQQDEAHHGLDLAQREAMK
FT                   RSIREQTQDEKDEVVVDMLSILQKIPIQVLAVNSFTIIEKVRSVASSLLDFLDHGEDMG
FT                   LLPLSSHETRAQKAQRNLWKFLNYLSEIESMYSWHDEKGTGKGF"
FT   CDS_pept        join(complement(1224931..1226088),
FT                   complement(1224775..1224874),complement(1224245..1224719),
FT                   complement(1222973..1224192),complement(1222817..1222914))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942684"
FT                   /locus_tag="CNC03940"
FT                   /product="PM-scl autoantigen, putative "
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="nuclear exosome (RNase complex) "
FT                   /protein_id="AAW42700.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0000176"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="HOGENOM:HBG067550"
FT                   /db_xref="HOGENOM:HBG176073"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="UniParc:UPI00004B4490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK81"
FT                   /transl_table=1
FT                   /translation="MSKATSGEASVPSPTQSFSEYLPFLTAALDRLTTNAASLPDKTDL
FT                   NFHRSLDRRFNKDVEKTSERLLGMTERILDLIERSQKEARQGRDKGKTAKVMIRRRKLE
FT                   DQDDIIDGYRGAVQGVIDGLLEDAVRRSLPLCPCCSNISKDINLDELRGGKGKTSVTVK
FT                   PALVAQAGKKVSESHYTLACYAHHIVQIPGPFTERLPANIIHASDLTKPQLLFHDAPDN
FT                   ARTSESWKPSLTTKPHAMVPLGFKAPLDYELTSEEEMDPSKAALRREKEIRARTHPYYY
FT                   ETKHLPYPTSLFIDSKPVPPQSFDETPFEFVDTPEKLHRMVEKLKQAKEIAVDLEHHDM
FT                   RSYAGFTCLIQISTRESDWVVDTLALRKEIQQDKFGDVFTDPTIVKVFHGADSDIIWLQ
FT                   RDFEIFVVNLFDTYSACVVLEMPQRSLSALLQHYCNFEADKRYQRADWRIRPLPDGMLY
FT                   YARSDTHFLLFIYDNLRNALLHKSSRPSSPANCGTIVLDSARPNPQEAMREVLGKSADT
FT                   ALKMYERDSYDIVTGRGSGGWLAAGKKWLPKGEIEQESGWVWRHLHDWRDRVAREMDES
FT                   PFYIMPNNMLRDVSTADNTANLSRIIRRDRAPIAAQYIPEITSIIVAAKEKFKEITAER
FT                   AANPQVQEMEKIGVKEIGANDVKKVPVAALAVPSVPLASTTSNIWDVAAKPTSTRTNAK
FT                   SGLFGSAIKFSQPKHASGYITASKSGQSALFGVTLDRASNQKSSSAALTLRERELSPGF
FT                   LKVMESMRMDLHPKGMTSGSSEGDGKMGLNPETVPFIPSNQRKTTATSSLEVRGKRPLG
FT                   LTSESAHPQSGQKASSSTAYAPTSGIPSTLIKEMSPQKSSKSGTVDEGVVQVKKSKKQK
FT                   KRERASTTDRAGDDSDSKKAKLGTDGDGEFGAATPPAQAVIPSVELLNTVIVGEGGNAN
FT                   KSTASKNKKKKVKPEDIPAFDYASQPNLLDQPHSVIAQDDAKKKKKKFKEARPSGAGIV
FT                   EVPTFGARPARDLSQPKQGNKSGTFAR"
FT   CDS_pept        join(1227718..1227795,1227859..1227955,1228011..1228243,
FT                   1228297..1228545)
FT                   /codon_start=1
FT                   /gene_family="HOG000135930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636877"
FT                   /locus_tag="CNC03950"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42321.1"
FT                   /db_xref="HOGENOM:HBG176074"
FT                   /db_xref="UniParc:UPI000042CBDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK80"
FT                   /transl_table=1
FT                   /translation="MFALKFILITSFIASTALAHFTLDFPESRGFVSDIEGQFCGGFST
FT                   VGPRQPFPLGSGPVHINSHHSLATVVAFISTSSNPTSFDDFNTTSNGTIIPLASNIFQV
FT                   TQGEKCFNIDLESLNVGLTNGSEVTLQIQYDGGDGDLYQCSDLVLIQGYEVPSNETCTD
FT                   DASRTSNASSTSSGSATATSAAATSSSSGTSGAIKEVVGLGALSLALGIAGLIIL"
FT   CDS_pept        join(1232634..1232769,1232821..1233032,1233085..1233181,
FT                   1233233..1233349,1233401..1233805,1233859..1233995,
FT                   1234042..1234224,1234277..1234519,1234570..1234707)
FT                   /codon_start=1
FT                   /gene_family="HOG000171119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807641"
FT                   /locus_tag="CNC03960"
FT                   /product="Phosphate transporter, putative "
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW42322.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744844"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK79"
FT                   /transl_table=1
FT                   /translation="MSSQFEVEKAHANVPMSAGERRRAALAEIDEASFSWFHAKACIVA
FT                   GVGFFTDAYDIFSISIAATMIGYVYHNGGSNTSNQDLGIKVAHSIGTFFGQLLFGYLAD
FT                   HIGRKRMYGVELIIIIIGTLGQAVAGHAPGVNIYGVLIMWRFIMGIGIGGDYPVSSVIT
FT                   SEFAARKIRGRMMAAVFSAQGWGNFTCAIVAVIVVAAYKDSIHSQPLDDLKSVDQAWRL
FT                   IIGIGCVPAVIALYFRLTIPETPRYTMDVERNIKQASQDVDAYITTGQYIADPVQINDR
FT                   AEVPKASWSDFARHFGQWQNGKVLLGTSWSWFALDIAFYGLGLNSSTILSTIGFGSSTD
FT                   LPTKQENIYQTLYNVAVGNIILAVGGLIPGYYFSMAFIDSWGRKPIQLMGFVLLTIIFV
FT                   CMGFGYDKMLSTDPGKKAFVFLYCMANFFQNFGPNTTTFIVPGEVFPTRYRSTAHGISA
FT                   ASGKLGAIVAQVGFSRLINIGGTNQFLKHILEIFAFFMLTGVFSTLLLPETKNRSLEDL
FT                   SQEDQESFVRNSGTATAVPMVQKTGTSSDDERVLAEAL"
FT   CDS_pept        join(complement(1237587..1237754),
FT                   complement(1237480..1237535),complement(1237282..1237428),
FT                   complement(1237037..1237221),complement(1236723..1236983),
FT                   complement(1236580..1236668))
FT                   /codon_start=1
FT                   /gene_family="HOG000224023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942685"
FT                   /locus_tag="CNC03970"
FT                   /product="Nicotinate-nucleotide diphosphorylase
FT                   (Carboxylating), putative"
FT                   /function="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="AAW42323.1"
FT                   /db_xref="GO:0004514"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="HOGENOM:HBG280888"
FT                   /db_xref="HOGENOM:HBG751540"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="UniParc:UPI000042C1AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK78"
FT                   /transl_table=1
FT                   /translation="MSETDLKPGQNLAHLLPPSWSAEVQRWFAEDTPSFDWAGFVVGEE
FT                   EQEAILWGKSGGVLAGVPFFEEVFKQVDCAVEWLMPEGSVVPPDTKTKVAIVRGKARQL
FT                   LLGERVALNTLARCSGIATVSRRFRDLARAEGWKGVVAGTRKTTPGFRLVEKYGMMVGG
FT                   VDPHRHDLSSMVMLKDNHIWATGSITSAIQTVRRVAGFSLLVNVECQNFKEADEAVTAG
FT                   ANIVMLDNMVGEDLHSAARRLKEKWQGQREFLIETSGGIIEGSLTGRVGPDIDILSTSA
FT                   VHQSCPHVDFSLKIQPRKSS"
FT   CDS_pept        join(1238089..1238206,1238263..1238359,1238419..1238641,
FT                   1238691..1238840,1238895..1239079,1239128..1239199,
FT                   1239249..1239765)
FT                   /codon_start=1
FT                   /gene_family="HOG000242438" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093614"
FT                   /gene_name="BNA5"
FT                   /locus_tag="CNC03980"
FT                   /product="Kynureninase"
FT                   /EC_number="3.7.1.3"
FT                   /function="kynureninase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="NAD biosynthetic process"
FT                   /biological_process="tryptophan catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42325.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006569"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0030429"
FT                   /db_xref="HOGENOM:HBG000049"
FT                   /db_xref="HOGENOM:HBG523016"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00004B4492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KK77"
FT                   /transl_table=1
FT                   /translation="MSNDLPTKKDLVKWDQEDALNWTRGEYEIPNSKACGGEADGKAIY
FT                   FCGNSLGLLNKKARQHIMEELDVWSTSSVTGHFNHPYQRPWKHVDEPLTPHLAKLVGAR
FT                   EEEVAHTSTLTSNMHNLFTSFYQPTEKRWKIVIEKGSFPSDWYAVHSHPRLHDKVLRPE
FT                   QIDNAIIALVPREGEDTLRTEDILKVLDDNKDSIAIVWLPLVQYYTGQLFDISSISPKV
FT                   HEIGALLGLDMAHGIGNVECKLNEWNVDFAVWCTYKYLNAGPAAIGGFYIRSGLEDGGR
FT                   RLAGWWGNDARTRFHMSPNFQPTPGAKGYQHSCTPVFSSIPLLATLQLIEAVGFSNMVE
FT                   KARRLTGTLEALLKASRYHVHPADPKGKIGFKIITPAAPYRGTQLSLVILPEEEHVMPK
FT                   VFDRMLRKGLVGDERKPSVIRLSPVVLYNTFEEVGRAVEIVEEALEEEEEERKR"
FT   CDS_pept        join(1240746..1240955,1241007..1241213,1241284..1241473,
FT                   1241528..1241748,1241798..1242049)
FT                   /codon_start=1
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807642"
FT                   /locus_tag="CNC03990"
FT                   /product="Putative uncharacterized protein "
FT                   /function="lyase activity"
FT                   /protein_id="AAW42327.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG358848"
FT                   /db_xref="HOGENOM:HBG370502"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000042F705"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK76"
FT                   /transl_table=1
FT                   /translation="MPAATISPKTLPPGVYCPTITFFEPTAEQNLDVETHVKHMEFLAK
FT                   SGLAGVVVQGSTAEAVTLDDEERKTLIRTAKEAFKRCGNHGPVIAGTVGAQSSRQALKL
FT                   CQDAAEAGADFALVLPPSYYPAAMSADAIQSFFEELASASPIPIIIYSYPGVCSGINMD
FT                   TDLICRLARHPNIAGVKHTDHDVGRIGRETAQSMGNAFGSPFTILGGASDYLLGTVAVG
FT                   GQGAITGMANVAPRVCVKAFELARAGRYEEALQYARVISTAEWGMGKGAILGTKYMTAW
FT                   ANDYAPTAALARKPLPLCPESTKQHVRAVGTEIVALERSLEQQGWAGAAMRGETQSEKV
FT                   LAPSKKINGIVNGAEEVAI"
FT   CDS_pept        join(complement(1243715..1243801),
FT                   complement(1243401..1243654),complement(1243148..1243354),
FT                   complement(1242930..1243084),complement(1242327..1242884),
FT                   complement(1242170..1242276))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093615"
FT                   /locus_tag="CNC04000"
FT                   /product="Cytoplasm protein, putative "
FT                   /protein_id="AAW42329.1"
FT                   /db_xref="HOGENOM:HBG067549"
FT                   /db_xref="HOGENOM:HBG176075"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI00004B4493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK75"
FT                   /transl_table=1
FT                   /translation="MPPHMTQATELIDWIVSNGGYFHPSAKLQVDESTGLSVFADNTIK
FT                   PEEKLVSCPFSLAVTSELATQAVCEIAGVEKGQLIWPKGHAKEGKPWNERMRIGAYLGF
FT                   HWIYQERPETEWPRSLVHKTYLASLPPASNLSTPLYFTESELQLLSGSNLLGAVEDRRK
FT                   EWSAESAALRSVLKEDGLTWERYLATATYMSSRAFPSKLLDLPPDGEMTPQPTRIDGVS
FT                   KPALLPGVDIFNHARGQPILWLSSLVSIPNGSRGVPSISLVSSSVCESGSQLFNNYGAK
FT                   PNEELLLGYGFVLDSNPDDIVNLRLGIASLPEPINERLQSKGLDARERFELRRNGEVDK
FT                   RLLEIMRVLLGGGNVEDEVDDDDEHALHEKEEREMQLELDVLGMLGGMLEDKLEKLRTG
FT                   SQIKVVDAREEVRRMCAVYRQGQMDILNAAMDKLSDRIERIESLMDEGMGGCPCCS"
FT   CDS_pept        join(1244012..1244142,1244352..1244449,1244499..1244718,
FT                   1244794..1244812)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807643"
FT                   /locus_tag="CNC04010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42331.1"
FT                   /db_xref="HOGENOM:HBG176076"
FT                   /db_xref="UniParc:UPI00004B4494"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK74"
FT                   /transl_table=1
FT                   /translation="MTLLTRDLSATASNVHPRIIRPLQEKLAPKDLRQMQRTTFCAPRA
FT                   QGVTVVALLIYGSQELAAREKAGVVKRKDDRIVVYPQTSPSPAAPEPFVRSDEPSALPE
FT                   SLSSAVDAKSNAYPLRKEERMKVSEFAKRLKEAEALQKEEDVSRRRTDHRI"
FT   CDS_pept        join(1245155..1245234,1245290..1245425,1245480..1245490,
FT                   1245542..1245622,1245679..1245752,1245800..1246032,
FT                   1246089..1246189,1246245..1246314,1246367..1246456,
FT                   1246516..1247088)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942686"
FT                   /locus_tag="CNC04020"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAW42333.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG067547"
FT                   /db_xref="HOGENOM:HBG176079"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR017182"
FT                   /db_xref="UniParc:UPI00004B4495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK73"
FT                   /transl_table=1
FT                   /translation="MHQNNPYLKQKPDFARLASRYPKFAPFVSVSEDGYTSINFQDPTA
FT                   LRELTKCLLKEDWNLDVDLREDRLCPTIPNRLDYIYHVLDLEPHLPSSSLRPLRILDIG
FT                   TGATAIYPILLARLRPDSRIVATEIDESSYNHAKATLEKNNIPPSSITVLKSPTPDPIL
FT                   FPLLECKGKSEDWDLTICNPPFFASSQEMLQGMELKDRQAHAAPTASDNELITRGGELA
FT                   FITSMIRESIDIGHKCTWYTTLVGKYSSLQPLIETLREFKIDNYFVINMKQSRTSRWIL
FT                   GWSHTMTRLPDSITRPYAIMENTTFAQLLPSSNTVRFNAPPPVSLTTLKAKVLDVLRTV
FT                   ALDPSKDSPDPSQYEGETQNSVLISPRINTWSRAARRMAARQESKAEPEGQGEASKPLT
FT                   LFRCRIKYVNSHTRPMDGSPSLEIDWLEGRREDREVWESFCNFLLSKLGLSRKRQAEAE
FT                   SDGRPLKSSGRRFQGNYARGRMAM"
FT   CDS_pept        join(complement(1249039..1249065),
FT                   complement(1248913..1248986),complement(1247667..1248866),
FT                   complement(1247180..1247618))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807644"
FT                   /locus_tag="CNC04030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42699.1"
FT                   /db_xref="HOGENOM:HBG067546"
FT                   /db_xref="HOGENOM:HBG176080"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI00004B4496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK72"
FT                   /transl_table=1
FT                   /translation="MFGGLKILDLSKNLLKGVPDALSDLLRLSSLDLSHNSLPSIPRSV
FT                   LLLPQLQVLDISHNSITTLSFDSPIGPSEEGLRYGSGFFTTAIQRQTALKSERPILPVL
FT                   RHLSLGSNTITQEGLKALASVNLKHMRVLNIENNNVSGVLDVQSLGISEKAMPELSHLV
FT                   LSGNINIRGLIGTIASAAKVDTIGCNLRQATPSFNHEDTSTVEDNQDKASSAVETGPAA
FT                   NDEHTLPIPEPDLTIVYRTFPAATFDSEPLAVDFDLYLPSTPAGPSGHPLVIWFHGGGL
FT                   LQGNKENLPPHFRRLPSHAYTRGDGRPDESVAIISPNYRLAPQVSILDILSEVTVLFDY
FT                   IQTRLNDRLVKDGKGDHKIDVSRICLSGGSAGGYLALIAGLRVPDEVGDEEIGAYRGLK
FT                   NEAIKCLAPFYPITDLTDKFWATETNPVPWMNGNSISHAQAKPHIDTKAAPVCSAVSGG
FT                   PRSILYPYMLQHSLFPSLLFLTQRSVGQGLDAFRPSPLSLSIPHRLEIASKSSKAKYHV
FT                   PIFFVYGTIDDKVQPMEKTIEALGRASGDLVIERVEGADHAFDEDPKVECQAFQEWLGK
FT                   TLL"
FT   CDS_pept        join(complement(1251795..1252352),
FT                   complement(1251324..1251731),complement(1251028..1251272),
FT                   complement(1249973..1250969))
FT                   /codon_start=1
FT                   /gene_family="HOG000217511" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807645"
FT                   /locus_tag="CNC04040"
FT                   /product="Folic acid and derivative biosynthesis-related
FT                   protein, putative"
FT                   /function="2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine diphosphokinase activity "
FT                   /function="dihydroneopterin aldolase activity"
FT                   /function="dihydropteroate synthase activity"
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /protein_id="AAW42698.1"
FT                   /db_xref="GO:0003848"
FT                   /db_xref="GO:0004150"
FT                   /db_xref="GO:0004156"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="HOGENOM:HBG052971"
FT                   /db_xref="HOGENOM:HBG754410"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="UniParc:UPI00004B4497"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK71"
FT                   /transl_table=1
FT                   /translation="MPPDTITISSLTLHLPHGLGPSAFHLTPSPPCPALLSLTIHLVPN
FT                   SVSATAAGDSMAGLGVNYSSVSKAVYALANDAEKVWSGPWELMRAVSAIPLGFDDVQSV
FT                   DIRLGLPKALLHALEAVYKASYAKNGEETGRSCTIRDLKVVCIVGLHEHERKEKQRLEL
FT                   DVKVRGGDWNVWGHKGFADEIYDFVSNSAYGTIESLNHELGQHLLKSRYLGDPTQSHLE
FT                   ITIRKPSAIPFATPSITIHRSQADYAPSLPSGTACNAPREALERVFVAVGSNIGDRVAN
FT                   ITRAVSLLEEAGCKLLGTSRLYESEPMYVEDQDRFINGVIELATPLEPLEVLRLLKHIE
FT                   KAVGRTKTFTNGPRVIDLDLVFYGHRVVKIGNETDEEDEHGIKWLECPHKRLREREFVL
FT                   RPLADIDPEFTHPALRRSVGQLLASLPTTFPPSLSPIIPLHSHSSPLRLSIPASPYIMA
FT                   IFNTTPDSFSDGDPARTNVEYALAACEKLLKGPEPPAILDIGGMSTRPGSEPCSEEDEL
FT                   SRVIPLVKAIRSSSNPIVASIPISVDTYRPSVAKAAVEAGASIINDVRGGQEPGMLRVM
FT                   AEADVPVVLMHSRGDSKTMIAADVQDYDSHGGVIKGVIQEMRVLVEQALKSGVKRWNII
FT                   LDPGLGFAKSSSQSLTLLKHLPDLVLPGTGLERLPMLVGASRKGFVGQTIKRAVPKERS
FT                   FGDAAVSGWCASSGVVDILRVHEPREMAEVVKMACAIRDAE"
FT   CDS_pept        join(1252569..1252575,1252634..1252663,1252725..1253097,
FT                   1253161..1253602)
FT                   /codon_start=1
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807646"
FT                   /locus_tag="CNC04050"
FT                   /product="Dephospho-CoA kinase, putative "
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW42336.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI000042F3FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK70"
FT                   /transl_table=1
FT                   /translation="MLIVGLTGGIASGKSTVSKLLSERHHLPIIDADLIAREVIEPGTS
FT                   GYSLVVSHFGPDRILQEDGVSLDRGAIGDIIFHDPEERKWLNGVVHPRVKKEMVKRIIR
FT                   YWLNGEWCVIVDVPLLIEAGMWKWVGDTVVVYVNERLQLSRLLGRQSNPPLTQSQASSR
FT                   IASQLPLSAKLSYATSVIDNSGSFSDLNDQVDRTVAKWKAQQGGDSGWWWRVCWLVPPV
FT                   GLAAGALSLLAVWRKGKKDRRRGRGEVSRRDNSEQASERIELMELKGGRRRTASGSVTD
FT                   EE"
FT   CDS_pept        join(complement(1255125..1255172),
FT                   complement(1253902..1255074))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636878"
FT                   /locus_tag="CNC04060"
FT                   /product="Expressed protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAW42338.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG176081"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI000042FE44"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK69"
FT                   /transl_table=1
FT                   /translation="MSEAGSASTPQSNATKDRHEPRGRKPNDQLPPSRAREVQRAFRLR
FT                   RAEHLASLEERILQLETENTQLRALLSLPAADRPKIGSGPTGRGKALKEGGVPMSERVR
FT                   ARKEARERERRALGLPEADTTDMSEAERGNGRDSATLSPRATSGAGPSNATAAAHTAQQ
FT                   QPNVPHLSNPQNVPALFNSPADVSPAPFNYQLPMPFNLPVSPDTQFADFTNNIDNSLYK
FT                   NNTTSATPNFGGMFSMFSSADHNGDSSANGSGVNKPSPISPPLTNPPHAPSPSQLDLLT
FT                   RLKSCCHVSDSHVVNDPGLLVFATRLCQSFGCSFGGTHTEANPRSDAENLTLEDAWHAL
FT                   KATLDPGGDADGENRINTGKMAAELVVRAAHSRGAGGWISCRYREGLSIRRNMVQALVQ
FT                   GLGGKLD"
FT   CDS_pept        join(1255587..1255603,1255678..1255702,1255743..1256204,
FT                   1256258..1256411,1256468..1256660,1256712..1256742,
FT                   1256792..1257799)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807647"
FT                   /locus_tag="CNC04070"
FT                   /product="Urea transport-related protein, putative "
FT                   /protein_id="AAW42340.1"
FT                   /db_xref="HOGENOM:HBG067544"
FT                   /db_xref="HOGENOM:HBG176082"
FT                   /db_xref="InterPro:IPR009348"
FT                   /db_xref="UniParc:UPI00004B4498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK68"
FT                   /transl_table=1
FT                   /translation="MGATGESFLPQVVGLFYATFDPSLGPVVRYQVPENLISDSTTEEA
FT                   RSPSNSRSRSRSRASRFVSPSPSPSPLPNRTLLNFGPISEYVIPKKSLHGRLVTLLTTG
FT                   TGCDEDEQAGYRVMGFPNVMTAPEGTYTRNEYMWNLCFVFHSSSSLEAFEPVVRKCARI
FT                   LRSAERDSAYLSKPSPDHTALPAVLEQLFEDLNSYSETSIPLDGFNSLELKLFPFYPNP
FT                   PDCDDWHVPVALVDLNAHKDDNWDITAARVCQFIDGVNHVKKIAELAKADEALTRETLR
FT                   HMLYYQVIMMARRIDIFQYSNMYTLKPIISRLSADETIISECACYVTRSGFPLPDWPTL
FT                   LQLYSRFQPGITVHDWIEAHEVLSMGIDPRRFVSFGIIKGFLRRVNRWPKLVERREPLI
FT                   HVPEHRKRVGFDDSVRGNSSGFYRDRDRSQSQIHLYQQGHQHTSGFHPNDSAASLSRGI
FT                   LGGESTFTLRSVGSNASLGVSPSSIPTRTPPSLHGRSPRRHPFAPSTAGTGSTHTALPR
FT                   SHVSAAESHPSTSSRRAIGGSITGTNTTGGLVPGGSGFNIRYGLNTRQREEAAAVKQAE
FT                   ELEEELIGFLDGSHHADEIQVRFGWSWGQLEKILGLDEMTGGMGRKGVTVVYR"
FT   CDS_pept        join(complement(1259379..1259463),
FT                   complement(1258916..1259297),complement(1258511..1258843),
FT                   complement(1258090..1258405))
FT                   /codon_start=1
FT                   /gene_family="HOG000169763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807648"
FT                   /locus_tag="CNC04080"
FT                   /product="Galactinol synthase, putative "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="AAW42342.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG176083"
FT                   /db_xref="HOGENOM:HBG325536"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI000042C5E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK67"
FT                   /transl_table=1
FT                   /translation="MVVSPPLTPGVQGSRAWVTLVTNPAYVAGLLTLHRTLSSLSAYPL
FT                   LVMTTPSLPATHSSLLRSLGLNLVPVSHLSPSSSQHPGFDPSFSRFNDAWTKLQVFGLT
FT                   EYDKVILIDCDMIFLKDMDELFDFELPGRDWIGASPACVCNPLKLGHYPKDWIPANCSL
FT                   SMQQSPTSLTSPPIPSPSAPRTAHLLNSGLVILHPSSTVLASLIDFINTSPTIAHVKFA
FT                   DQDVIAEAFKGRWRPLPWWCNALKTLRAVHKPLWRDEEVGIIHYILDKPWSARPPSLPP
FT                   HQHPSPALPPSPASLDGSDDGQASYHVKPQIRRRPLPSGLLDAVRNSPPQKSLTDYSEV
FT                   DAWWWIVYEDLLDDLKARGVDWEAVDKWVTR"
FT   CDS_pept        complement(1260033..1260182)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /protein_id="AAW42344.1"
FT   CDS_pept        join(complement(1261516..1261653),
FT                   complement(1261356..1261454),complement(1261217..1261277),
FT                   complement(1261023..1261147))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807649"
FT                   /locus_tag="CNC04100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42738.1"
FT                   /db_xref="HOGENOM:HBG176085"
FT                   /db_xref="InterPro:IPR022533"
FT                   /db_xref="UniParc:UPI000042E792"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK65"
FT                   /transl_table=1
FT                   /translation="MSQSKPPSPPLNIPSGNSQITPDPEPLKPDETLSGDKFHDFKAAL
FT                   RRIDPRQDLENIGKIPCARNSLLYGIAGGVGVGANPGWQPTGLLVASLQFLSFNARRKE
FT                   LAQMRIIQERYPHRHVSKLQKNNQNSEAGQGEQQSS"
FT   CDS_pept        join(1261998..1262194,1262245..1262275,1262332..1262661,
FT                   1262722..1263034,1263084..1263321,1263372..1263813)
FT                   /codon_start=1
FT                   /gene_family="HOG000198799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807650"
FT                   /locus_tag="CNC04110"
FT                   /product="AAA family ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAW42346.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG022336"
FT                   /db_xref="HOGENOM:HBG521794"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniParc:UPI00004B449A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK64"
FT                   /transl_table=1
FT                   /translation="MFRSSLPQRTSHNSASEAGPSIPTPIPTDGDAVTLENASNTTGEA
FT                   TLSSSGSSEGESLISKMMADNPYFSAGAGLMGIGVALTALRRSITLGATMAQRRMLVTL
FT                   EIPSKDRSYPWFLEWMAHQSAAQTRGNVKPPGLFGWGQGMRSHELAVETSYKQHENGAS
FT                   EAIFNLVPGPGTHYFKYGGAWFQVKRERDSKLMDLHSGTPWETLTLTTLSTSRDLFSSL
FT                   LEEARTLAEASTEGKTVVYTAWGVEWRPFGKPRRRREMGSVVLGKGIAEEIESDLKGFL
FT                   GRGKWYAERGIPYRRGYLLHGPPGSGKTSFIQALAGSLNYNICLMNLSERGLTDDKLNH
FT                   LLGLVPERSFVLLEDIDSAFNRRVQTSEDGYKSSVTFSGLLNALDGVASSEERIIFMTT
FT                   NHYDRLDPALIRPGRVDIQQLLDDAAGEQAKRLFVKFYGNSVNEDGTKGRVLREGELPL
FT                   NDEEVESLGNSVQRIVDDERAHGKVVSMASLQGHFIRTGAKESLDGIRELCRPREGQA"
FT   CDS_pept        join(1264184..1264301,1264367..1264569,1264621..1264901,
FT                   1264957..1265107,1265169..1265348,1265411..1265475,
FT                   1265542..1265739,1265818..1266142)
FT                   /codon_start=1
FT                   /gene_family="HOG000251788" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807651"
FT                   /gene_name="BNA4"
FT                   /locus_tag="CNC04120"
FT                   /product="Kynurenine 3-monooxygenase "
FT                   /EC_number="1.14.13.9"
FT                   /function="kynurenine 3-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridine nucleotide biosynthetic
FT                   process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAW42348.1"
FT                   /db_xref="GO:0004502"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0019363"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG430104"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI00004B449B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55W30"
FT                   /transl_table=1
FT                   /translation="MSQSRARKVLIVGAGPVGALTALSLHRRGWEVEVWETRDDPRGQD
FT                   AAPSNLRSINLAISSRGLEALRSVDPSIAENFLEEAIPMKGRMIHHTDGKQESQLYDPI
FT                   GGQSINSISRPILNQRLVQSLPEAVKLRFNTKLKHIDFKNRVAYASHKQETSLLPGEES
FT                   EKDKKQNTEDEDGTAFDLVIGCDGSWSKVRTAMMRAERIDFSQSFIPHAYIELHMPSDP
FT                   AFPGGYAMDKNHLHIWPRHAFMLIGLPNKDGSFTLTLFIPFSSLELLDTRESAAAFFRE
FT                   HFPSAVDIVGEKVLLDDFEKNPRGNLVTINCTPSAWSSHAILLGDASHSMVPFYGQGLN
FT                   CGLEDVRVLSSILERHHISPTTTLALGETDPELELALKAYSDERQGDLKAICELALQNY
FT                   TEMRSHVLSPLHHLRRQVDKVFTTLFRSAPQATLSLMEPFPTKKVRGWTSLYEMVTFRP
FT                   DVGYSEALRKERWQKDVVGYAGWIGGVVGVGAAGVFAATMAKKWLERR"
FT   CDS_pept        join(complement(1267845..1268165),
FT                   complement(1267663..1267794),complement(1267034..1267616),
FT                   complement(1266247..1266986))
FT                   /codon_start=1
FT                   /gene_family="HOG000225103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807652"
FT                   /locus_tag="CNC04130"
FT                   /product="Dihydroorotate dehydrogenase, mitochondrial,
FT                   putative"
FT                   /function="dihydroorotate oxidase activity"
FT                   /biological_process="'de novo' pyrimidine base biosynthetic
FT                   process"
FT                   /biological_process="UMP biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42350.1"
FT                   /db_xref="GO:0004158"
FT                   /db_xref="GO:0006207"
FT                   /db_xref="GO:0006222"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG338888"
FT                   /db_xref="HOGENOM:HBG351027"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00004B449C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK62"
FT                   /transl_table=1
FT                   /translation="MPRPLPLPALRAALPRPHPLPLRRLASTAPPPRRHYLSTALLLGG
FT                   SVLLVAYYYDSRSLLHEHVAMPLMRLVADPEQGHKLAVRVLAWDKWARPRDMGVDGAEL
FT                   QAELFGMHLKNPVGIAAGFDKDAEAIDGLFDLGFGYVEVGSVTPEPQPGNPKPRFFRLE
FT                   EDDACINRYGFNSLGHGHALARLRLRLAKFAQDHPSLFPSPLPANLVPPAGLPRSLRAG
FT                   QLLAVNLGKNKASDPDSNDDYVRGVRTLGPFADVVVINVSSPNTPGLRALQGKQQLERL
FT                   LNDVVEERNKIAQGTGLPKIAVKVASDLSEDELADVASAVRSSGVEGVIVSNTTIRRKE
FT                   LNLVSGNQDQIGGLSGKPLFPYALNALKTLRPLLPPSIPIIGCGGISSGSDALTMANAG
FT                   ASIVQVYTSFGFRGVGTPRLIKDEITEHLKGESWKTHVGRDWASSGQPMGWDENRLKQE
FT                   SQALVDEANGLAELLRQSNDKAETAKLIEDAERALGIVKEKDGAASAATVVDETMPSLP
FT                   PQAAVPSQGGGFGIEGVGAPSIGEALIAEPVPQVDLAPIVVLEEKKDNVDDRREGGERD
FT                   NEWKQAVKAGPKRLV"
FT   CDS_pept        1268295..1269236
FT                   /codon_start=1
FT                   /gene_family="HOG000033575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807653"
FT                   /locus_tag="CNC04140"
FT                   /product="Phosphoribosylglycinamide formyltransferase,
FT                   putative"
FT                   /function="hydroxymethyl-, formyl- and related transferase
FT                   activity"
FT                   /function="methyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="AAW42693.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016742"
FT                   /db_xref="HOGENOM:HBG061800"
FT                   /db_xref="HOGENOM:HBG649382"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="UniParc:UPI00004B449D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK61"
FT                   /transl_table=1
FT                   /translation="MMDVSQPLGKPLARCPAPAASQSSSQAQASPPPPLPHARSRPAGT
FT                   NLQALLDAAGTPRLPGAAITAVISSRSNAYGLTRARTHAPPIPAAVCALKTFLNRNPGA
FT                   TREDYDAEVARQVLDTRPDIVVLAGWMHILSDRFLDILDGKKEPPPAPALPPPAPSSLP
FT                   TQTEPIPSHAPGAVSQNAQATSELPPPPPSQSFPVPIINLHPALPGAFDGAHAIDRALE
FT                   AFQKGEVTRTGVMVHRVVAEVDRGEPLLVKEVEIKPEDRLEDLEERIHSASLHARGYVA
FT                   LHSADMLLQVEHEIIVDGARLIIEQLDRQGRP"
FT   CDS_pept        join(complement(1271577..1271636),
FT                   complement(1271425..1271508),complement(1271259..1271357),
FT                   complement(1270947..1271200),complement(1270654..1270893),
FT                   complement(1270240..1270590),complement(1270125..1270180),
FT                   complement(1269912..1270059),complement(1269686..1269848),
FT                   complement(1269522..1269621),complement(1269358..1269467))
FT                   /codon_start=1
FT                   /gene_family="HOG000242917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807654"
FT                   /locus_tag="CNC04150"
FT                   /product="Family II 2-keto-3-deoxy-D-arabino-heptulosonate
FT                   aldolase, putative"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="AAW42352.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG292577"
FT                   /db_xref="HOGENOM:HBG347591"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniParc:UPI00004B449E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK60"
FT                   /transl_table=1
FT                   /translation="MAPAPAPWHPSSWREKPIAQDVVYEDKDQLETVLNKLRRLPPLVS
FT                   PVEIDRLRTQLADVAAGKAFLLQGGDCAELFDDCSQDPIEHKLSLILLMSLIILHGSRL
FT                   PVVRIARIAGQYAKPRSKPTEIVEFPTKDGKTEKKEVLSFRGDNVNGYDPTDRAPDPQR
FT                   LLGSYFHSTATLNYIRTLLSSGFANLHNPVDWSFSHVRSPELQQAFSSVIESLQDSLEF
FT                   MKVATGAVGGGERGGMETVDFYTSHEALLLEYEEAFTRSWDSTTLSPPATGDSTPILSR
FT                   SASRIREASSSSSYPHSPARRPKSPKNLSDSINSLSMSVGDLGKGEAKKWYNTSAHFIW
FT                   IGDRTRQLDGAHVEYFRGIANPIGIKIGPSMEPEEIVRVLDIVNPDKIPGKVTLIGRYG
FT                   AAKVDQFLPKHIDAVLRTDHPVVWQCDAMHGNTKSSVHDPTLKTRHFVDVITEITRSME
FT                   IHKEKNTILGGVHLELTGEVNDDGYSVTECIGGSMELEDKDLSFNYRTHCDPRLNYEQS
FT                   LDVAFLLADYLKSKRRGERPHDILLASLRGRKNDVEK"
FT   CDS_pept        join(1272802..1273196,1273261..1273465)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789545"
FT                   /locus_tag="CNC04160"
FT                   /product="Pria protein, putative"
FT                   /protein_id="AAW42354.1"
FT                   /db_xref="HOGENOM:HBG176087"
FT                   /db_xref="UniParc:UPI00004301C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK59"
FT                   /transl_table=1
FT                   /translation="MLPVPPSVHRLVILFLVAVPLLSIILPVTAAAAGVDAPSKLQPRA
FT                   PQPSRRMGATKRSKKIEPLKKKDYSSFLCPGGSVACPIPGDEVSPSSVEALEKSLNSLA
FT                   DWFKVGFECVELETELNSCGGCLALGSGQDCALIENARTTGCESGSCQVYSCFDGYVVS
FT                   PDRTSCVKKGSTIPATPVTAVNVEELVADDQLPLGQ"
FT   CDS_pept        join(1273965..1274037,1274314..1274537,1274593..1274658,
FT                   1274715..1274955,1275005..1275135,1275193..1275213)
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636879"
FT                   /locus_tag="CNC04170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42356.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000042FF0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK58"
FT                   /transl_table=1
FT                   /translation="MTALLAQRVLPQIEYAIFDMDGLLNAILGRYGHTMTWDIKAGVMG
FT                   KPQRIAAEYILSHFPDILEKLTVEEFIAEGVQRREELFKRVEPMRGAAELVKGLHAAGI
FT                   PIALATGSTMPNFIHKTTHLPHIFSLFPPTSILTADSPEVKRGKPNPDIFLAAAHSLGR
FT                   DVGTADECTEEQKAERSRGLVFEDARPGVLAGIAAGMNVIWVPDAELLALNPGETYGAT
FT                   EVLTHLEEWDPTRWGLPPLPGFNHIPAQP"
FT   CDS_pept        join(complement(1277538..1277550),
FT                   complement(1277364..1277462),complement(1276968..1277313),
FT                   complement(1276773..1276914),complement(1276671..1276724),
FT                   complement(1276397..1276610),complement(1276067..1276345),
FT                   complement(1275763..1276018),complement(1275596..1275714),
FT                   complement(1275287..1275540))
FT                   /codon_start=1
FT                   /gene_family="HOG000234158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807655"
FT                   /locus_tag="CNC04180"
FT                   /product="Dihydroxyacetone kinase 1, putative "
FT                   /function="ATP binding"
FT                   /function="glycerone kinase activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /protein_id="AAW42696.1"
FT                   /db_xref="GO:0004371"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="HOGENOM:HBG274731"
FT                   /db_xref="HOGENOM:HBG473357"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="UniParc:UPI00004B449F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK57"
FT                   /transl_table=1
FT                   /translation="MAPAQKHLLNTPQTLVVDSLKGLATLNPNVKLDEAQRVIYTPPTE
FT                   PKVALLSGGGSGHEPAHAAFVGPGLLSAAICGNIFASPNVAQIRRGLELVTREKGGLVV
FT                   VMNYTGDALHFGLAAEQHRSAGKVGDVRVLMVGDDVAVGREQGSIVGRRGLAGTILVYK
FT                   VAAALSDKGADLDSVENIAKYVASRLGTLGVGLEHCHVPGTRAGTSHLGANEVEVGMGI
FT                   HNEAGTYKLEMTTASELVGRMLTQITDTTDKDKSFVPFKGDGSDEVVLLVNDLGAISEL
FT                   EMGGLTNEAVKWLQSRKIKVRRVLAGTYMTSLNMPGFSLTLLLLPSASEKAPYSANEIL
FT                   EYLDTPASAPGWKWHAGREPGTLDVKAEEAPIPVQKDNAVLPSTDAKGFLAAIARACKA
FT                   LIAAEPELTEQDQIAGDGDAGLTLEAGAKGVLKAIEEGRLKGENVVQDVKVIAEIVEDD
FT                   MGGTSGALYSIFFAGLGKSLRDAATNGAKSTSPEVWSKAAAEALATLYKYTRARPPSRT
FT                   LVDPLDAFVASLPSKGLSSAAEDALAAADKTKELVAKAGRGAYVNQEDLKKREVPDPGA
FT                   WGIWRILDGLRGFEA"
FT   CDS_pept        join(complement(1280095..1280158),
FT                   complement(1278125..1280031))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093616"
FT                   /locus_tag="CNC04190"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW42358.1"
FT                   /db_xref="HOGENOM:HBG067543"
FT                   /db_xref="HOGENOM:HBG176088"
FT                   /db_xref="UniParc:UPI00004B44A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK56"
FT                   /transl_table=1
FT                   /translation="MLDLSVTPKHGNAGGRYFPHTGHLGVSPVVVQGKVATKLPPVCDP
FT                   LLVKSISLRIKCTEYRTGGAFEGDLQNTLWEQSQLLLAPPDGEKYLNVGDWDQQFKMAI
FT                   PIEAATQGRSTMCIREYKVVWRMEVVIEHKPIHYVGTSITKAFALNLQNHQAPPLRPLS
FT                   PSPSLCIGSDAYVSEACLNVPHGVFGPGDSFHVALLIKPENPTTMVKKVTVVLERLIEL
FT                   VDSKSASRRDSFNDRSPSKRRHVHSSRSYSPTQTSRLTSILRRSLSPRPPFHRLQSDPH
FT                   TSVGPSVQHEGQVIRDKITESSTTDMTSGGAGFRCSLPMSLPRRTGKWALGETHQTGLV
FT                   SMSYQLRASITLKGVRRSSPSKTFILPTAPITLISTSTTERLDAVAAAEHKRKKLGSLG
FT                   KGLYLHGENSSIVDSRDPVHPEEPPALSTVIGVATNIKPILLPPDKSQHPPSQSISFSF
FT                   PSPSQRSPTVRSLPIQSLLNPETSKSSSNHQLPSPPPTRQGPSSLDVVADPESGSLLRL
FT                   FHVQGSGRRISTTTSEEEEVQPSRSRQKLRAEPPTTIAEFEWPSLPSLDTLGLGLPHVP
FT                   EDHRPRSRPRTAPIHSTFAMSKNGVPPPLSGAFGGPMSGDQLGQRPMTSAGASRGWREE
FT                   EDAATFAFALPEDKGHIDMRR"
FT   CDS_pept        join(1281932..1281973,1282030..1282170,1282228..1282332,
FT                   1282390..1282416)
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807656"
FT                   /locus_tag="CNC04200"
FT                   /product="Thioredoxin (Allergen cop c 2), putative "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="AAW42360.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000042FE43"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK55"
FT                   /transl_table=1
FT                   /translation="MVKAIESYDEWKTLTSGSDVVVVDYWATWCGPCKMISPHFAKLEG
FT                   KFPNVKFAKVDVEEQEDIAKEAQIKAMPTFVAYKDGKVIETVTGAVPAKINALLDKVAA
FT                   "
FT   CDS_pept        join(complement(1283655..1283738),
FT                   complement(1283361..1283603),complement(1283127..1283300),
FT                   complement(1282550..1283065))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093617"
FT                   /locus_tag="CNC04210"
FT                   /product="Inositol/phosphatidylinositol kinase, putative "
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="AAW42737.1"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG067542"
FT                   /db_xref="HOGENOM:HBG176089"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI00004B44A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK54"
FT                   /transl_table=1
FT                   /translation="MSPVSICKPQATMAQLTRLWITGTCTKFPTTQEEIQFYENINDFD
FT                   FLIEHPGLVKIKPFIPTYKGCVDRSSYIRSDDSIQTEDAEEVPVYGEGGEVIGYKENIA
FT                   KKHTQSIVLSNLLYGLLNPIVADFKLGKRWWGSRSGRAKRLRHDKSCAATTSGTTGIMF
FT                   AGAHTWVPGKETCVSTTKSYGYSLRDDNLSDSMACVFPSVTDWHLFSKKPHLTLRTDPS
FT                   SRLQRKPSSDCMADMLSRTLKTIESVTDIRTAMKESGWSYPGSSLLIAHGVSEFTGKTE
FT                   VRCALIDFAHAHEHNDELPPDGVDDGLETLSKLLKDRANYLQSYRSTTTRCDDTAEL"
FT   CDS_pept        join(complement(1287032..1287127),
FT                   complement(1286622..1286950),complement(1285855..1286563))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636880"
FT                   /locus_tag="CNC04220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42362.1"
FT                   /db_xref="HOGENOM:HBG067540"
FT                   /db_xref="HOGENOM:HBG176091"
FT                   /db_xref="UniParc:UPI00004B44A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK53"
FT                   /transl_table=1
FT                   /translation="MSLYPIMSSLPQKPTENTFQSSSAAGPSKICASRDSCSGIRDPAK
FT                   FVPLNQYGQGVWSSDYTLLEEGRRQIAGWGKGIKIEEVNGGVVSSRGRGRGSRAPKGQR
FT                   RSKTDGLRRELERYGCRAEFMPEGMGRKKTNQSSWNPKTEQLHLTVHLIIPSNLILPSP
FT                   DSTIITSTSFKTITHPRVLFHAREAESLPTISSLLPSLTIPLSEIRFCQPFHSTPFRPA
FT                   PSHQPNQKIFYPPLDANKPLKDVLKGSAWVEFPEIQLMARENWEEMVDKGEAIITEIEA
FT                   ISQVSGRERDSGWGAKRRLNEVAEGKVQHNGTKRLKSESNQGLLALGEYDSEEGSDAEN
FT                   GAEEADDVSAEEAQDQDPSPEILAAVGRALMADLEEA"
FT   CDS_pept        join(1287882..1287914,1287972..1288031,1288089..1288140,
FT                   1288269..1288347,1288445..1288529,1288589..1288921,
FT                   1288976..1289053)
FT                   /codon_start=1
FT                   /gene_family="HOG000125184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789546"
FT                   /locus_tag="CNC04230"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbonate dehydratase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbon utilization"
FT                   /protein_id="AAW42364.1"
FT                   /db_xref="GO:0004089"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015976"
FT                   /db_xref="HOGENOM:HBG189808"
FT                   /db_xref="HOGENOM:HBG711150"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="UniParc:UPI000042CFE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK52"
FT                   /transl_table=1
FT                   /translation="MSHSSLDYPEMKELFNRNLKWSENVWARDPSFFPHHFPGQRPEIL
FT                   WIGCSDARVPETTILGCQPGDIFVHRNIANLYSPQDDSLNAVLMIALFNFNVKHIVVTG
FT                   HTNCVGCLTALNVSRLPATPPTTPLQRYVKPLATLARTLYTPDGPPTLDLLVEENVVQQ
FT                   VKNLVESDIIKGVSGVYIQLKRKNADISLQNWKKRGADGVVIHGWVYHLEDGTIRDLNV
FT                   SVGPSGHIPGKKVKSLF"
FT   CDS_pept        join(complement(1292266..1292331),
FT                   complement(1292148..1292212),complement(1291816..1292081),
FT                   complement(1291059..1291740),complement(1290668..1291006),
FT                   complement(1290459..1290612))
FT                   /codon_start=1
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807657"
FT                   /locus_tag="CNC04240"
FT                   /product="Di-, tri-valent inorganic cation transporter,
FT                   putative"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW42366.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG317426"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00004B44A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK51"
FT                   /transl_table=1
FT                   /translation="MGLSRQARIITLLVIDSVFFLIELITGYAVGSLALVADSFHMLND
FT                   VLSLIVALYTIRLATSPSSSANSYGWQRAEILGALINGVFLVALCVSIGLEAVGRIFSP
FT                   PEISNAQLIVVVGSLGLLSNIVGLFLFHDHGHSHGGHTHGAVALPNDEDETSSLISRDD
FT                   SVSELYQHPAQTRAQVIETAQEFGYGGTQLSSSLDSRAGHLAKSPNAGGHGRTGSASRR
FT                   TKRGSFSRAGGHSRLGSANIVPPVPGQNDVLPPVGGDGNSTSSSTVIDNGKKKASKKDD
FT                   HDQDHGREREQGSDSGKKLAGNASDAESGHTHGSPAEHGRHGGHGHSHGAMNMRGVFLH
FT                   VVGDALGNVGVISAGLVIWFCQGRWTLYFDPGVSLVITCIIFSSALPLVKSASYILMQG
FT                   VPSHVSLDAVRQCIYEVPGVDSVHELHIWQLSESTVVASVHVMIEAGRDYMVVASGIRE
FT                   RMHSHGIHSVTIQPEFYCEETDPQDTEACLIRCPPGQCSGDTCCPPGVKITGPEGDEGN
FT                   GHDHEH"
FT   CDS_pept        1292835..1293890
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807658"
FT                   /locus_tag="CNC04250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42368.1"
FT                   /db_xref="HOGENOM:HBG067539"
FT                   /db_xref="HOGENOM:HBG176092"
FT                   /db_xref="UniParc:UPI00004B44A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK50"
FT                   /transl_table=1
FT                   /translation="MYPIHTAPVYYSYSRPPSPSNGPAAPPFEFSGVTIPPRLKSIGRQ
FT                   LSQLGNDFLTTQPDQEPKSQPRGDGKAPDIPGMGDDPILCPYCDKPLPPSLFAQVAEHS
FT                   HRHQTLGPSRPSSVPSSAVSAKLGPTPGHKSADKTTSDALSATVRNGDAANHSAVVNTI
FT                   SPADIARWSSLAGISITMPEPSGPSQGIHKAKDADAKPFPMIPPPPPPNKLTRPPPASR
FT                   HNSADSGSRFGFFRRDSKREDDSDGEGEDRGSGYAKLGAGGSDDEEEVTSGKKEQHDGV
FT                   NEGDDDAKVEDNASLDLGDQDKNGQVEDEGRPESTAKDPGEVSSVDSNSDLKNVMQEIL
FT                   TKVNQMVSRPH"
FT   CDS_pept        1294340..1295242
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807659"
FT                   /locus_tag="CNC04260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW42370.1"
FT                   /db_xref="HOGENOM:HBG067538"
FT                   /db_xref="HOGENOM:HBG176093"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="UniParc:UPI00004B44A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK49"
FT                   /transl_table=1
FT                   /translation="MAVPYGGALPEGRPMPARSATHSGQLATGVSKSLGADSILSKQSS
FT                   TRPSTPTQTPGPVPVSNAELASLRTAYSSALSKLSSLTAELTDLKRTNSAMEAELESLS
FT                   QALFEEANKMVADERKRRAEMEENLKEVREEREALKETVKVLGGKVSPPNEDADAKPPK
FT                   KNEPEEVEEENIIPRDLDKHYAALRKSIHNVASPPISPPADASRLPATFELPESGLASR
FT                   ASPEEVGRPLSVSLPDESNPWASSANSAAAAAAAAPVGLGLGVDEEGSVPTEFRLSVVT
FT                   PSPRKEKTGEGLESGAGLS"
FT   CDS_pept        join(1295562..1295883,1295940..1296557,1296614..1296668,
FT                   1296725..1296810,1296866..1297728)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789547"
FT                   /locus_tag="CNC04270"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW42372.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG067537"
FT                   /db_xref="HOGENOM:HBG176094"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00004B44A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK48"
FT                   /transl_table=1
FT                   /translation="MHKNETTSHPPPETTSSTIHQALPPDSLQDHPDTHPVNPLGLFIR
FT                   PHPTRGNGLFSPRPIPAGTVVEESPVLVLTKEQWEQGQMDGTILGEYGFCWSAGGMAIG
FT                   LGLASLFNHSSRPNVNFIRSPSTKTIRFVTAKHISPGEELCICYTADESKLWFTPARGE
FT                   EEDEVLGGESEGEGDGLPDDVDGLVEDVQQAKLNSSEPTLQAPRPVHISSLPSYPSSSS
FT                   SSPAPQHTIPPSSLPAPLHSSGHKASGQRHLSKHRQPATLVDDLAWQEDEWKDEKGRDH
FT                   VGEGKKAGEDWGEVIRVKGPAERENDGNDRELMQVWILEFSDAKLTKTALNFSKEIWPN
FT                   DVNERLRHLKRVCRRNEDGKEICRIALCPLDEHSADSLSSLMTAFSPLLSSLTPKSWSV
FT                   PSSGARTQEQLKWKHHIWPVSFSPAPIIPADSSSWPISRKAWVAAGIKRVLKLAVNAKQ
FT                   KSELPVATFCTSAPPCFWPTMDGFIPPTLNLRASSCDTRISESHPLRHATLNCVASIAH
FT                   LRTVPPFTDVPPTRNGADYLLTSLSLFISHEPCVMCAMALLHSRVREVFYVFPRKKGGG
FT                   FEYNEGNEYGEGSPVHQHDEGAGTREDISGQGGFGIHARRDLNHRFEVWKWNGHVDEDV
FT                   RKELEIDENLQL"
FT   CDS_pept        join(complement(1301494..1301616),
FT                   complement(1301411..1301440),complement(1300944..1301361),
FT                   complement(1300355..1300890),complement(1299694..1300308),
FT                   complement(1299334..1299644),complement(1298469..1299282))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807660"
FT                   /locus_tag="CNC04280"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /protein_id="AAW42695.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG176095"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000042D4BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KK47"
FT                   /transl_table=1
FT                   /translation="MTTDISTRPDFKADDLVSAMGEVTLNGSGRNGHEALDLAETAEVS
FT                   NQAVQERLEQKRLEHERARLAQRAKFEQQMRELEANQLAEERQLMSATSPLPAGEAASA
FT                   PTTPPGHASLGSSVHDLHKEAPAPIGSLVPGPREGLNGAKSMPGSRRTSTYGGTFGMEK
FT                   MSLSVMTDGSRREWRQED