(data stored in ACNUC8465 zone)

HOGENOMDNA: CRYNJ_6

ID   CRYNJ_6; SV 1; linear; genomic DNA; GRV; FUN; 1347793 BP.
XX
AC   AE017347_GR;
XX
DT   19-SEP-2006 (Rel. 59, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 67)
XX
DE   Cryptococcus neoformans (strain JEC21) chromosome 7, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Cryptococcus neoformans (strain JEC21)
OC   Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
OC   Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
OC   Filobasidiella/Cryptococcus neoformans species complex.
XX
RN   [1]
RX   PUBMED; 15653466.
RA   Loftus B.J., Fung E., Roncaglia P., Rowley D., Amedeo P., Bruno D.,
RA   Vamathevan J., Miranda M., Anderson I.J., Fraser J.A., Allen J.E., Bosdet
RA   I.E., Brent M.R., Chiu R., Doering T.L., Donlin M.J., D'Souza C.A., Fox D.
RA   S., Grinberg V., Fu J., Fukushima M., Haas B.J., Huang J.C., Janbon G.,
RA   Jones S.J.M., Koo H.L., Krzywinski M.I., Kwon-Chung K.J., Lengeler K.B.,
RA   Maiti R., Marra M.A., Marra R.E., Mathewson C.A., Mitchell T.G., Pertea
RA   M., Riggs F.R., Salzberg S.L., Schein J.E., Shvartsbeyn A., Shin H.,
RA   Shumway M., Specht C.A., Suh B.B., Tenney A., Utterback T.R., Wickes B.
RA   L., Wortman J.R., Wye N.H., Kronstad J.W., Lodge J.K., Heitman J., Davis
RA   R.W., Fraser C.M., Hyman R.W.
RT   "The genome of the basidiomycetous yeast and human pathogen Cryptococcus
RT   neoformans.";
RL   Science 307:1321-1324(2005).
XX
CC   This Genome Reviews entry was created from entry AE017347.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1347793
FT                   /variety="neoformans"
FT                   /organism="Cryptococcus neoformans"
FT                   /strain="JEC21"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 7"
FT                   /db_xref="taxon:214684"
FT   CDS_pept        join(197..320,365..487,534..705,755..803,850..996,
FT                   1045..1096,1211..1222,1269..1312,1357..1486,1533..1723)
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805568"
FT                   /locus_tag="CNG00010"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44410.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG326782"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4874"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEM4"
FT                   /transl_table=1
FT                   /translation="MDDLDLTTQQFATCVSVLFAGYLPFQIPSNYIISRIPRPGLYICC
FT                   AVVCWGAISAATAAVQSYSALVGVRVVLGAVEAVFFPGVLYYLSAWYTKKELGKRYAGL
FT                   FIGQQLGNGFGGLIAAGVLKLDGKHGIRGWRWLFIVEGVVTVGFGIIFAFVMPEFPHNA
FT                   RVLKPIERDLAVWRLEQEAGAGEAHDDISTTRAYLSALKDPKVYMLIGCMMCSQAMGSV
FT                   APPYIFACFIFAGISWWSDRKQIMYWPIIVCLCIGIVIYIIAMTTLSVGARYFAMMWTP
FT                   VANVVPQLFIYNTLSLHVARPYPKRAAGLALINAIGGTSNIWGSYVWFAPPHFYAGFGM
FT                   GQSPFFQ"
FT   CDS_pept        join(3211..3382,4212..4465,4534..4659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789021"
FT                   /locus_tag="CNG00020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44411.1"
FT                   /db_xref="HOGENOM:HBG068457"
FT                   /db_xref="HOGENOM:HBG177274"
FT                   /db_xref="UniParc:UPI00004B4875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEM3"
FT                   /transl_table=1
FT                   /translation="MVTALVSGQKQHPERFLCQFRGTRPRCSSYVYSSVFKFGEDRGYF
FT                   MVERKILSTPAFPLPLGKPVPAKEGEEKVELSDEGDEDREDLEEENDEDFDEDEDEDDE
FT                   DEDENENENENEDEDEEDEDEEGDDGIDHKKVLSDFYNTEQVDEEDDEDVIEGKEDAGV
FT                   SNLKRKADGEEHGEAKKNKA"
FT   CDS_pept        join(5115..5467,5518..5553,5607..5831,5880..6034,
FT                   6110..6200,6251..6285,6339..6430,6489..6620,6677..6697,
FT                   6750..6921,6972..7047,7102..7139,7196..7286,7340..7730)
FT                   /codon_start=1
FT                   /gene_family="HOG000138274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581868"
FT                   /locus_tag="CNG00030"
FT                   /product="Phytase, putative"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="AAW44412.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG068456"
FT                   /db_xref="HOGENOM:HBG176174"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI00004B4876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEM2"
FT                   /transl_table=1
FT                   /translation="MSKSTYSDEPLAAEDYELQPTSNANDPLLPSYSQHPFTSPHQQLQ
FT                   RERRATRLRSVLSRICIAFLIVVPTFAFAACYFGRTTLDKVRTWDSLPPEVQDWLDKIA
FT                   PAKTHADHSNFPTDIGYAGPTPTGSEAALIATAPVVPSHTDVYPLIRPTNKVSKGFSVL
FT                   QHWGNLSPYYSVDSHGLPESGSLIPEQCELESLHWLQRHGARYPTSYPEGPVALASRLK
FT                   SAKGWKAKGDLSFLNDWSYQLGAEILTPFGRSQLFNLGVSARIKYGFLLDKFKGKLPVF
FT                   RTESQDRMLKSAQNFAVGFFGVPADDQYNLEVTIEAPGFNNTLAPFTTCRGTGVDYKSK
FT                   LAEWDSIYLAKAKKRLQENMQGYNLSFMDVKDMMEMCAYETVALGHSAFCDLFTQKEWK
FT                   GFQYRNDIFWWYSSSFGYAPAKAMGMGWVQELVSRLTKTRLTEFNSTTNSSFHDDVHFP
FT                   LGDALYVDFTHDTQFALLLPTMNLTTFAETGDLPTDHIPKHRSFVSSKIMPFATNLQVQ
FT                   VLSCSGEKKLRLILNDAPIPLTGINGCPEDDDGLCPVDTFVAAMKTLIGEIDFAKECAL
FT                   DKETLEEEQEVGEEEMAEVKVDGLQKVEDEEEDNKKGDDDDGDSDSDSDSGSDSDDDDN
FT                   "
FT   CDS_pept        join(5115..5467,5551..5553,5607..5831,5880..6034,
FT                   6110..6200,6251..6285,6339..6430,6489..6620,6677..6697,
FT                   6750..6921,6972..7047,7102..7139,7196..7286,7340..7730)
FT                   /codon_start=1
FT                   /gene_family="HOG000138274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581868"
FT                   /locus_tag="CNG00030"
FT                   /product="Phytase, putative"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="AAW44413.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG068456"
FT                   /db_xref="HOGENOM:HBG176174"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI00004B4877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEM2"
FT                   /transl_table=1
FT                   /translation="MSKSTYSDEPLAAEDYELQPTSNANDPLLPSYSQHPFTSPHQQLQ
FT                   RERRATRLRSVLSRICIAFLIVVPTFAFAACYFGRTTLDKVRTWDSLPPEVQDWLDKIA
FT                   PAKTHADHSNFPTDEAALIATAPVVPSHTDVYPLIRPTNKVSKGFSVLQHWGNLSPYYS
FT                   VDSHGLPESGSLIPEQCELESLHWLQRHGARYPTSYPEGPVALASRLKSAKGWKAKGDL
FT                   SFLNDWSYQLGAEILTPFGRSQLFNLGVSARIKYGFLLDKFKGKLPVFRTESQDRMLKS
FT                   AQNFAVGFFGVPADDQYNLEVTIEAPGFNNTLAPFTTCRGTGVDYKSKLAEWDSIYLAK
FT                   AKKRLQENMQGYNLSFMDVKDMMEMCAYETVALGHSAFCDLFTQKEWKGFQYRNDIFWW
FT                   YSSSFGYAPAKAMGMGWVQELVSRLTKTRLTEFNSTTNSSFHDDVHFPLGDALYVDFTH
FT                   DTQFALLLPTMNLTTFAETGDLPTDHIPKHRSFVSSKIMPFATNLQVQVLSCSGEKKLR
FT                   LILNDAPIPLTGINGCPEDDDGLCPVDTFVAAMKTLIGEIDFAKECALDKETLEEEQEV
FT                   GEEEMAEVKVDGLQKVEDEEEDNKKGDDDDGDSDSDSDSGSDSDDDDN"
FT   CDS_pept        join(complement(9665..9848),complement(9512..9612),
FT                   complement(9233..9462),complement(9015..9174),
FT                   complement(8848..8975),complement(8633..8793),
FT                   complement(8483..8566),complement(8279..8423),
FT                   complement(7894..8209))
FT                   /codon_start=1
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805569"
FT                   /locus_tag="CNG00040"
FT                   /product="Metabolite transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44414.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744844"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEM0"
FT                   /transl_table=1
FT                   /translation="MSTLSYDDKMGYLPEQDIDTTIHAAPLAELETPKKRKWMQTLSVL
FT                   IAGVALFSDGYNIQITGYTNTVMAKLYPTALNSTMKTRLSNSILIGDIFGMILFGLCAD
FT                   RLGRRWGIIGCTFFLVLGVTLATAAHGKSEVGMLWMIVIGRGVAGLGAGGEYAVCTTSA
FT                   VEAADETHTLRKKRGLLVASSTNTAIIAGFVASAIVFLIVLAAYGGEPHVGVWRICFGI
FT                   GIIMPLSIFLFRVRMADSTLYSKHSIKSPKFPYWLAFKRYWKPLLGCSLVWFLYDAVVY
FT                   PFNLLAPTITAGFSSNQSLLASNGWGALVNAFALPGAFFGGFIIDRLGPRQTYAFGLVM
FT                   VAIFGFVIGGAMEPLRNNGTGAFAAFVILFGLFQCFLSVGPGNCNFIVSSESFPTPVRG
FT                   HALGLAAAIGKAGAAVGTQVFPLIEARFATTLKGQQAIFLIGSGICVVAAIVVMTIVPN
FT                   RRAQLEDEDVEFRRYLEENGWDTSDMGSVGRIVSDEVVERGEKV"
FT   CDS_pept        join(10659..10739,10808..11489,11542..12059,12118..12205,
FT                   12262..12569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805570"
FT                   /locus_tag="CNG00050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44415.1"
FT                   /db_xref="HOGENOM:HBG068455"
FT                   /db_xref="HOGENOM:HBG177448"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI00004B4879"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL9"
FT                   /transl_table=1
FT                   /translation="MVKRLLQGLNLGAGLAVKWYAFVFLRLLPAGPRYLPTILSCTLMY
FT                   LASYFSLRSLAQKPIRTSIITPILVLGGLYHPMYRLLSTVGALVTLIAPLMSYDFVYRT
FT                   HLLHPSLHISFARVGWVTETSASLLFRSTFPDRIGVSYWPSHNDSAVSHVGLSQSSVKT
FT                   DFTSPLYIKNLQPGITYFYNSTAGHKGSFTTRRSQHDQKQFSILSTSCQKPNWPYNPLS
FT                   HSLAINGLEHVDNVVRKMKRKPEAMLFLGDFIYSDLPYPIADYTTSYYRRLYRQIYSSP
FT                   SWTPFLRSIPWLHMFDDHEIINDYAPSTSALSNMFIEAIDPFINYQQVVNPPPVSSTQP
FT                   TYFRFGIGDVSFFVLDCRSWRSAQPARPGSNSTAGFGNRTMLGESQFTAVKEWAEEGTR
FT                   DGKLLVLVSGVPITRNWSEGDDEMDSWAGYLDEREEILEMLWSSGGAVVISGDRHEHAT
FT                   TLFPPPPTSPHLSSSSVIEFSTSPLSFFHQPWTREYVPHPDTDIPIHLQWQGDSRFGVF
FT                   EFDTTGERPRVKFELMVDGEKEWEYEWVKGVDVVIPDVWQA"
FT   CDS_pept        join(complement(14682..14822),complement(14486..14631),
FT                   complement(14329..14438),complement(14073..14284),
FT                   complement(13575..14022),complement(13220..13535),
FT                   complement(13043..13172),complement(12879..12992))
FT                   /codon_start=1
FT                   /gene_family="HOG000133030" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI15805571"
FT                   /gene_name="GLF"
FT                   /locus_tag="CNG00060"
FT                   /product="Conserved expressed protein "
FT                   /EC_number="5.4.99.9"
FT                   /function="UDP-galactopyranose mutase activity "
FT                   /protein_id="AAW44416.1"
FT                   /db_xref="EMBL:AAX09636.1"
FT                   /db_xref="GO:0008767"
FT                   /db_xref="HOGENOM:HBG116293"
FT                   /db_xref="HOGENOM:HBG383580"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI000042F7FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL8"
FT                   /transl_table=1
FT                   /translation="MPSRLDFESEPPTPVTAGFDALSDVESATSVEEDFVNVETLIIGA
FT                   GPTGLGAATRLHQLGHSFIIVDAASAPGGLASTDVTKEGFLFDVGGHVIFSHYAYFDDA
FT                   VNRALPAKDDWQTHQRISYVRSAGRWVPYPYQNNVSQLPLDLRVKCIDGLIAAAEQRAA
FT                   TPNYKPVTFDEWIVRNMGEGIADVFMRPYNFKVWGVNTTKMQCKWLGERVAAPNVRTAV
FT                   RNALTMETAPNWGPNATFRFPTRNGTGGIWTAVAKQLPENRFRLGSKGDIQKINASDKV
FT                   AELGDGTRVKYKHLISTMRLDGLLDRMERAANGEEVVKEMKVAAKEGLVHSSTIVLGIG
FT                   IRGERPDRIGDKCWLYFPEDSAPFYRATIFSNYSPYNVPSISTRLPVLQKADPSLPFEK
FT                   DLKGGPYWSLMFEVCQSADKPVDLENLMKETVKGAIATELILPTDDIVSFYERRFDYGY
FT                   PTPTLGRDDSLKKILPKLQQEYGIHSRGRFGSWKYECGNQDHSFMLGVEAVDNALFGTP
FT                   EMTLHETDWVNGRRNIERRLK"
FT   CDS_pept        join(15765..15814,16059..16153,16203..16390,16454..16635,
FT                   16694..16942,17009..17144)
FT                   /codon_start=1
FT                   /gene_family="HOG000160780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093130"
FT                   /locus_tag="CNG00070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44417.1"
FT                   /db_xref="HOGENOM:HBG177460"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI00004B487A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL7"
FT                   /transl_table=1
FT                   /translation="MKQRKRGMRDWSFLTTNFVIQTSDAGGGNHPHFALCRKADQKDLW
FT                   LMPDFGFFSWPEPGVGSYSEVRTKTLDYELDMGLEVDDKLDVTKSDWFNKTQQLFWRGS
FT                   PMVEVRNDLLRASQDQPWSDVQPLDWGKVSQDEAERIKNNGDLKSPAEHCKYAFLAHVE
FT                   GWAYSGRLKYLQQCRSVIVAHPLKYIQHYHHLLNGRDGDPNQNYVEVPLPLEKNLPRAM
FT                   EDLLKEENEEKVQRIADNNWKSMRQGWISPAANECYYRHALRQYASVQTFKPSLEGRAV
FT                   PYESFLLMGKTHWDPHRK"
FT   CDS_pept        join(18851..18973,19114..19270,19330..19436)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805572"
FT                   /locus_tag="CNG00080"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44845.1"
FT                   /db_xref="HOGENOM:HBG177467"
FT                   /db_xref="UniParc:UPI00004B487B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL6"
FT                   /transl_table=1
FT                   /translation="MSFGPYINQTCGMDSLNQAFPRMADIYSAFRGDLCPPIPQLATWA
FT                   GQFVVSKKRILENQLRLYENLREKFHAPPEHWIWKEGWWNSKPSNPTLGHALERSWPVI
FT                   FDCTDYTKAETCGEGHDKTCQCLD"
FT   CDS_pept        join(21369..21610,21677..21888,21952..22147,22206..22461,
FT                   22523..22579,22644..22709,22783..22932)
FT                   /codon_start=1
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805573"
FT                   /locus_tag="CNG00100"
FT                   /product="L-arabinitol 4-dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44418.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B487C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL5"
FT                   /transl_table=1
FT                   /translation="MTIAATSIPTTKYEAHYDPTKVIQHPEFQTLSEDAPELSDPKLNI
FT                   ACAYNPAHEIHMVKKPRFEPGPGEVTIHVRATGICGSDVHFWKHGHIGPTMIVTDECGA
FT                   GHESAGEIVAVGEGVAQWQVGDRVAVEAGVPCGLASCDPCRTGRYNACPAVVFFSTPPY
FT                   HGTLTRYHNHPAAWCHRLADNVSYEEGSLCEPLAVALAGLDRAGVRLGDPIAICGAGPI
FT                   GLVTLLAAHAAGCTPIVITDLFPSRLEFAKKLLPTVKTVQIEKTAKPEEVAKQIKGAAG
FT                   MQLSLAFDCTGVESSIRSAIFSVKFGGKVFVIGVGPSEQSYPFGYCSANEIDLQFQYRY
FT                   NNQYPKAIRLVAGGLVDLKPLVTHRFALKEAVKAFHVAADPSQGAIKVQIRD"
FT   CDS_pept        join(25181..25630,25686..25712,25765..26034,26093..26163,
FT                   26216..26355,26409..26475,26531..26603,26667..26849,
FT                   26903..27859)
FT                   /codon_start=1
FT                   /gene_family="HOG000138273" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581869"
FT                   /locus_tag="CNG00110"
FT                   /product="Ferric-chelate reductase, putative "
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44420.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068452"
FT                   /db_xref="HOGENOM:HBG177215"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI00004B487D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL4"
FT                   /transl_table=1
FT                   /translation="MPLLSRLFSLVWVGLSALPIVLSSDVVQIKPLITDCAGGALDAIG
FT                   LVSFSDYPEGSASYTAYCASEYWKTSIAITVATYCSGEEITKGWALLQRYCENYGLLTI
FT                   EDIDFLVAKVDMSNVSTVDVFQRGQEVFNNTILVDKYSWSMGAKTERVWDREMIFHHAF
FT                   GWTMYLLLGCAIFVGVLNRLVDMYRTHLIVNAGRTMDRSEIPPSNGFFGKVSVYYQKYL
FT                   GIPALFGHKHVHSYNWFCIPTRLESLLVFTYVAFNIIFSFAGYNLFRENLYWPGSYSLQ
FT                   VARYIADRTAIMSFYNLPILWCLAGRNDVILWVTGWSFSSMNIFHRWIAIVTAFQGIAH
FT                   SAAWTWIERDAIALMFQEMYWRAGVFATVTMSLMLPFSIKPIREKWYEFFLIAHIVLAL
FT                   ATLILLFYHVTVYGTDYNGWLWGCVAVWVFDRFIRIVRVQVLSFKAAAGNNAVMVATGG
FT                   EKGLIRLSVTSSIRHTPKPGQHYYLYTPMSITPWENHPFTIGSWEANKSSTTLHFLIGT
FT                   KDGGTRRMRKMVNKAINGQADLRVLTEGPYGHTSPVHRFDNVLFIAGGSGITAALPYLH
FT                   DLVSRLSVGKCVTKKATLVWVVKNSDYAADVLSKELSLSHGLKGLEIDIQIHITSKTGV
FT                   AIPLIEEAEGHALAYNDPSPLPSRTIEKSLPSSSSKASLKETLLIGRPEMRAVLQTSIS
FT                   KLVGSETLAVLSCGPGNMMDDMRAAVVDAYGTGEGKVGSSTLEYFEESFSW"
FT   CDS_pept        join(25526..25630,25686..25712,25765..26034,26093..26163,
FT                   26216..26355,26409..26475,26531..26603,26667..26849,
FT                   26903..27859)
FT                   /codon_start=1
FT                   /gene_family="HOG000138273" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581869"
FT                   /locus_tag="CNG00110"
FT                   /product="Ferric-chelate reductase, putative "
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44419.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068452"
FT                   /db_xref="HOGENOM:HBG177215"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI00004B487E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL4"
FT                   /transl_table=1
FT                   /translation="MSNVSTVDVFQRGQEVFNNTILVDKYSWSMGAKTERVWDREMIFH
FT                   HAFGWTMYLLLGCAIFVGVLNRLVDMYRTHLIVNAGRTMDRSEIPPSNGFFGKVSVYYQ
FT                   KYLGIPALFGHKHVHSYNWFCIPTRLESLLVFTYVAFNIIFSFAGYNLFRENLYWPGSY
FT                   SLQVARYIADRTAIMSFYNLPILWCLAGRNDVILWVTGWSFSSMNIFHRWIAIVTAFQG
FT                   IAHSAAWTWIERDAIALMFQEMYWRAGVFATVTMSLMLPFSIKPIREKWYEFFLIAHIV
FT                   LALATLILLFYHVTVYGTDYNGWLWGCVAVWVFDRFIRIVRVQVLSFKAAAGNNAVMVA
FT                   TGGEKGLIRLSVTSSIRHTPKPGQHYYLYTPMSITPWENHPFTIGSWEANKSSTTLHFL
FT                   IGTKDGGTRRMRKMVNKAINGQADLRVLTEGPYGHTSPVHRFDNVLFIAGGSGITAALP
FT                   YLHDLVSRLSVGKCVTKKATLVWVVKNSDYAADVLSKELSLSHGLKGLEIDIQIHITSK
FT                   TGVAIPLIEEAEGHALAYNDPSPLPSRTIEKSLPSSSSKASLKETLLIGRPEMRAVLQT
FT                   SISKLVGSETLAVLSCGPGNMMDDMRAAVVDAYGTGEGKVGSSTLEYFEESFSW"
FT   CDS_pept        join(30304..30593,30648..30918,30982..31321,31371..32302)
FT                   /codon_start=1
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805574"
FT                   /locus_tag="CNG00120"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44421.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG053487"
FT                   /db_xref="HOGENOM:HBG324157"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042F38F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL2"
FT                   /transl_table=1
FT                   /translation="MGFIQVLTNRRTGRATGITSASSTQINTLDGIQSTAPLESVGSTE
FT                   EKKDVIPDEENVPPTAEPKQDFPDETAQRGVQNAEAITLTWSRTSLIVAYAFMFLLYFV
FT                   NAFQSSITGNLSAYIVSGFSAHSLIPTIGIVSNVMSAATYMPLAKALNLWDRSYGFAFM
FT                   TLLSTIGLILSATCKNIYVYCASQVFYSIGFVGMIFAIDVITADTSHLKDRGLAYAFTS
FT                   SPYIITAFAGSAASEHFYESNWRWGFGTFAIVLPIVAVPLFLVLFLNKRKAQKAGLIVK
FT                   VPSGRTFWQSVWYYIVEFDVLGVFLLAAGLVLFLLPFSIAASAADEWRQDYIIAMLVVG
FT                   LVLLILFVLAERFAAPRPFIPYRVVLSRGVIGAGLLDFTYQVAYYCWYDYFTSYLQVVF
FT                   GTSISVAGYISSIFDIVSGVWLLVVGYAIRKTGYFRWLLMFSVPLYLLGEGLMIYFRKP
FT                   GGHFGWIIFCQVLVAFGGGTITICEQVSVLASASHNDAAAVLAFLGLFGYIGGAVGNSI
FT                   SGAIWTHTFPNALAKYLPAEALPDLDTIYEDLDTQLSFPIGSATRTGIIEAYAEAQEKM
FT                   LIAGTAVMALSLIWIFVIKNINVAKIAQVKGLLF"
FT   CDS_pept        join(32716..32779,32836..32867,32914..33679,33727..33859,
FT                   33910..34079,34131..34523,34581..34597,34655..34708)
FT                   /codon_start=1
FT                   /gene_family="HOG000225275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581870"
FT                   /locus_tag="CNG00130"
FT                   /product="Phosphomethylpyrimidine kinase, putative "
FT                   /function="phosphomethylpyrimidine kinase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="AAW44423.1"
FT                   /db_xref="GO:0008972"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG053028"
FT                   /db_xref="HOGENOM:HBG734716"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI00004B4880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL1"
FT                   /transl_table=1
FT                   /translation="MASRNELSLEPRTRPHVMTIAGSDSGGGAGIQADLKTIEAFGCYG
FT                   SSVLTGLTAQNTLGVQAVHVVPTDFVIQQLQSVISDELPKAIKLGMLTCASTIRALARE
FT                   VSKLNTTIVLDPVMISTSGHTLLPDDAMEALYELYPHVDYLTPNIPEAKNLSGWSHEIK
FT                   NLDDMIELAKKTNETTKSPSVLLKGGHAIVSREEVLKYAGKYELIWEEGDDEDDAVEVY
FT                   NEYKESLDINIKTQKDLVVDLLIKEGEIIAMFVGKKVDSQSTHGTGCTLSAAIACSIAV
FT                   SSEVADAKSLISVFKRAIGYTQSAIATAFPFGHGHGPLNHGHLSMRRALPFPSKHNPHP
FT                   FLTHLIQSDLSLWKSYVRHPFVVQLGKGTLPRKCFEHYIKQDYHYLKHYARAHALGAYK
FT                   ADSFEDIKAFTEISLHIARESTMHVAYCQEFGVSLADLEETPESANCSAYARYVIDIGT
FT                   QGDILDLYMAVASCLVGYGEVGLWLKKQVERGEAKVEDNLYGRWMTDYGGRDFLNAVNR
FT                   GIGNLERRECVRLESGFWDMGLNLL"
FT   CDS_pept        join(32716..32779,32836..32867,32914..33679,33727..33859,
FT                   33910..34079,34131..34523,34581..34708)
FT                   /codon_start=1
FT                   /gene_family="HOG000225275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581870"
FT                   /locus_tag="CNG00130"
FT                   /product="Phosphomethylpyrimidine kinase, putative "
FT                   /function="phosphomethylpyrimidine kinase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="AAW44422.1"
FT                   /db_xref="GO:0008972"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG053028"
FT                   /db_xref="HOGENOM:HBG734716"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI00004B487F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEL1"
FT                   /transl_table=1
FT                   /translation="MASRNELSLEPRTRPHVMTIAGSDSGGGAGIQADLKTIEAFGCYG
FT                   SSVLTGLTAQNTLGVQAVHVVPTDFVIQQLQSVISDELPKAIKLGMLTCASTIRALARE
FT                   VSKLNTTIVLDPVMISTSGHTLLPDDAMEALYELYPHVDYLTPNIPEAKNLSGWSHEIK
FT                   NLDDMIELAKKTNETTKSPSVLLKGGHAIVSREEVLKYAGKYELIWEEGDDEDDAVEVY
FT                   NEYKESLDINIKTQKDLVVDLLIKEGEIIAMFVGKKVDSQSTHGTGCTLSAAIACSIAV
FT                   SSEVADAKSLISVFKRAIGYTQSAIATAFPFGHGHGPLNHGHLSMRRALPFPSKHNPHP
FT                   FLTHLIQSDLSLWKSYVRHPFVVQLGKGTLPRKCFEHYIKQDYHYLKHYARAHALGAYK
FT                   ADSFEDIKAFTEISLHIARESTMHVAYCQEFGVSLADLEETPESANCSAYARYVIDIGT
FT                   QGDILDLYMAVASCLVGYGEVGLWLKKQVERGEAKVEDNLYGRWMTDYGGRDFLNAVNR
FT                   GIGNLERRVAQDPPSPQRLAKLTKIWQECVRLESGFWDMGLNLL"
FT   CDS_pept        join(complement(36979..37293),complement(36917..36928),
FT                   complement(36729..36848),complement(36341..36668),
FT                   complement(36181..36289),complement(35687..36126),
FT                   complement(35485..35629),complement(35231..35417))
FT                   /codon_start=1
FT                   /gene_family="HOG000163825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805575"
FT                   /locus_tag="CNG00140"
FT                   /product="RAB GDP-dissociation inhibitor, putative "
FT                   /function="Rab GDP-dissociation inhibitor activity "
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="AAW44425.1"
FT                   /db_xref="GO:0005093"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG018239"
FT                   /db_xref="HOGENOM:HBG330736"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI00004B4881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK9"
FT                   /transl_table=1
FT                   /translation="MGTQREMETAKINNQAEREVRHVDNAAVSPSLLAGLSWRVGVGVP
FT                   GRLNEIKARDDAGEQRVVVDDQSLCVEAAITWATRAVNRIHLFCSPRFYCKLYTMDEEY
FT                   DVIVLGTGLTECILSGLLSVDGQKVLHMDRNDYYGGDSASLNLTQLYQKFRGTPPPENL
FT                   QLGRDRDYAVDLIPKFILSSGELTRMLVHTDVTRYLEFKVIAGSYVYRDGKISKVPSTE
FT                   MEAVKSPLMGLFEKRRARNFFQYLQNWKEEDPATHQGLDINKCPMKDVYTKFGLEAGTQ
FT                   DFVGHAMALWLDEDYITKPARQTIDRIILYTASMARYGKSPYIYPLYGLGELPQAFARL
FT                   SAIYGGTYMLDKKIDSINVDPETGYFTGVTSEGETVRAKKVIGDPSYFGAGKDEPEGGK
FT                   MRVIETGKVIRAICIMKHPIPGTDNADSAQIIIPQKQVGRKNDIYIAAVSSAHNVAAPN
FT                   VWIAIVSTIVETSVPEREILPGLQLLGNVVDKFISITPLYAPTADGTTDNVFITKSYDA
FT                   TSHFETVVEDVSDVWQRVKGEKLVLKKRETQIEA"
FT   CDS_pept        join(37447..37500,37554..37698,37757..37869,37923..38654)
FT                   /codon_start=1
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805576"
FT                   /locus_tag="CNG00150"
FT                   /product="Casein kinase II beta chain, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="kinase activity"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="AAW44428.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG211728"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI000042DE65"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK8"
FT                   /transl_table=1
FT                   /translation="MIESETASSTQTSTLTWINWYTSLTGHDYFCEVHEEFIEDDFNLT
FT                   GLQSMVPFWKEALDMVLDVEPEEDSSKIPDVSIVESSAELLYGMVHQRFILTKAGLSSM
FT                   VEKYDAGHFGGCPRVFCNATPVLPCGRSDMPGIDTVKLYCPNCGDIYTPPSSKYQNVDG
FT                   AFFGTSFAPLFFQTYPELHSVPFCPSSSSSSSVAAGTNPSSARPSPTPSAALIGGATYT
FT                   NPNPHGGQRPALGRVYQPKIYGFKVSERARSGPRMKWLRERPEKAEELDQVDWKGRWKN
FT                   ESGAYGAGNENGKGDEDEEMEGNLEVRKGKLFDDEDEPEDDDEEEEEEEVGKVVPEAST
FT                   ATFSTRR"
FT   CDS_pept        join(39473..39674,39741..39783,39981..40090,40162..40291,
FT                   40363..40531)
FT                   /codon_start=1
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942113"
FT                   /locus_tag="CNG00160"
FT                   /product="Putative uncharacterized protein "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /protein_id="AAW44436.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG267069"
FT                   /db_xref="HOGENOM:HBG524254"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="UniParc:UPI00004B4882"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK7"
FT                   /transl_table=1
FT                   /translation="MSKISSTCTRQLSSLATKINRPIPQRALHTSSHKPSATSSSFKGA
FT                   SNGRLNVLTSQFGQKRALHSSSPRWHGDLVRPEPGTGIKLIFRDSHGNDVKTVEGNEGD
FT                   DILSLAHEHDIDLEGACEGSVACSTCHVIIDPKHFDMLPEADDEENDMLDLAFGLEDTS
FT                   RLGCQVKLTKELDGMVATLPSATRNMYVDGKSSLVISDLVRQVNGKAGAKARTH"
FT   CDS_pept        join(42006..42123,42191..43609,43657..43779,43827..45821,
FT                   45883..46457)
FT                   /codon_start=1
FT                   /gene_family="HOG000191209" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805577"
FT                   /locus_tag="CNG00170"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase "
FT                   /EC_number="1.2.1.31"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44438.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058757"
FT                   /db_xref="HOGENOM:HBG324699"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014397"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00004302FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK6"
FT                   /transl_table=1
FT                   /translation="MSANASELTPEELNQRLDRWSSRLSALPSLALPTDYPRPSPAKLV
FT                   EAYQSMPIPSALATVLMKLTLEFSTLFPASGLPTPYHILLTSFAILLFRYTPDPSLVIC
FT                   TSANASTKPLLLKLDIAAEMTFFDVLRQIMEREQEAQADDVPITKLVDHIKPEGPLYRV
FT                   RFFDSTQVESDASSSLTTDLTLFLLAAPSDTPATRTSVPPLYLRLTYNSLLFTQSRITA
FT                   TLESLLQLLSSAASHEPAHPIGALPLRTPNQSAALPDPAADLDWCGFVGAIPDIFSANA
FT                   KAHPDRVCVVQSELAEGQTMMDGPSRGRRIFTYKQIDEASNILAHALLKNGLQRGEVVM
FT                   VYAARSVEMVVCVMGILKAGGVFSVVDPAYPPSRQTVYLSVSTPRALLVISSAGSLAPS
FT                   VSDYISDNLSLRLLVPAIQLTSSNVTGSRSDAGEDILAPYQQYAQTPAGVVLGPDSPAT
FT                   LSFTSGSTGIPKGVKGRHYSLTHFFPWMGKRFGLDENSKYTMLSGIAHDPIQRDMFTPL
FT                   FLGAQLHVPTADDIGTPGRLAEWMADSEVTVTHLTPAMGQLLSAQATRQIPTLKNAFFV
FT                   GDVLTKRDCTRLQSLAKNVCIINMYGTTETQRAVSYFAIPSVNEDSTFLATQKDLIPAG
FT                   QGMIDVQLLVVNRTDRNIPCAVGEMGEIYVRSGGLAEGYLDPTATAEKFVVNWFGQNVE
FT                   RPDTLKEKNPAAAEHWFGIRDRMYRSGDLGRYLPDGRVECTGRADDQIKIRGFRIELGE
FT                   IDTHLSRHPLVRENVTLVRRDKDEEKVLVSYFVPIDGDELEGLMSASEAADDDEEIDLK
FT                   TQMIRGVKKYRKLIRDIREYLKKKLPSYSVPAVYFPLHKLPLNPNGKIDKPALPFPDTS
FT                   LLAPAPSASTADHTPTQKTIHDIWLSLLPSPPPHITLDENFFDMGGHSILATRLIFEIR
FT                   KAFVVNAPLGLVFDKPTIAGQAAEIDLLRNADLGGAGDGAIEAEKAVDYAKDVELLSKE
FT                   LPTFSALPADFATKELTVFLTGATGYLGAFILKDLLSRRVRKVICLVRAKSADQGLQRL
FT                   RDSGEGRGVWDEEWVKQDRIEAVIGDLAEEKFGLSQAEWDRVAEQTDAVLHNGAIVHWV
FT                   YPYPKLRAANVISTVTALQLCAQHHSKQFSFISSTAVLDAEAFVAKADEVVQAGGKGLL
FT                   ENDDLEAGRTGLNAGYGQSKWVAEKIIMEAGKKGLSGWILRPGYVLGHSQTAVTNTDDF
FT                   IWRMVKGCVQLGLIPEINNAIICCPVDHVARLSSLATLSSSASSAFNIMHVTGHPKIRF
FT                   NDLLGSLQLYGYDVKRVEYVHWRTRLEQHVLETQDNALFPLLHFVLDDLPTSTKSAELD
FT                   DTNAQNLAAAAGEVRTSGVTEKEIGLYIAWLIRAGFLESPQKKGKSLPVLEGGAMKAIG
FT                   RTTAGSA"
FT   CDS_pept        join(47191..47289,47348..47663,48214..48377,48424..48654,
FT                   48710..49244,49290..49375,49425..49662,49711..50231,
FT                   50387..50554)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805578"
FT                   /locus_tag="CNG00180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44440.1"
FT                   /db_xref="HOGENOM:HBG068451"
FT                   /db_xref="HOGENOM:HBG177275"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI00004B4883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK5"
FT                   /transl_table=1
FT                   /translation="MQAAVLRSKTSIDRFGSNVDVFWAHDGRGLIVLTDTSHLLFYQLV
FT                   PSSRPSYDSPGPSPPGPGEGDVIMGWELRALGTAFVMGGCESVLPQAHNIMMTLRHPPS
FT                   ILSVPYPAPSQLLTPPNSHFPPPPLDAATESQIEWSSPGQVRSLAWTGDGYCLAAGYER
FT                   GWAAWSMGGRLNGWGVQDKDESEDSGVIDLFWIPGNLELFVLRPYEKGKPQIEVVSFTK
FT                   SATTNQPSPDNTRYAFLQMDDRVMVYRGADQPDMSVINPESDVWQSIKIPTAYIATNWP
FT                   IRYASISSDGKLIAVAGRRGLTHYSAASGRWRLFQDEREERDFTVKGGLLWFHHVLIVA
FT                   VDADKTHQVSIKPIRDPADMLQIRLYSRDLDLSEVLHSQTLPSPVLVMTLLENSLLVYT
FT                   ADNMLYHFLILPTQSSIKLHLCGSISFRGIIEVPTRVRALSWLIPEAQKTHGDPADDLI
FT                   VATIIFLVDGKLVLLRPRRARTDEVRYDMQILADRIEAYWTHLQGVGTLENSLWGFDGL
FT                   NMRIWLDALTIEATRVDLMSDAYENVEESVKLRLDFYPLSILMDKGIIIGVDYESSTRT
FT                   LPFPIHKTFTGTHLFLPQFLRYHLSSSPPSLANALILAHHYQPLVYFAHSLEVLLHSVL
FT                   EDEDLSKSDSNNEDGNSKQGSVLAAVIVFLDYFPESLDVIVRCARKTEIERWPMLFDLV
FT                   GKPRYLFEKCLKDGKIRTAANYLLVLHNLEGLEDADLCKELLRFLHSIDDSGDALRMAI
FT                   AKVGIIEPAGTASGSETPTKSSQPSTPKRTLL"
FT   CDS_pept        join(complement(51897..52309),complement(51572..51848),
FT                   complement(51429..51524),complement(51201..51382),
FT                   complement(51023..51154),complement(50738..50976),
FT                   complement(50668..50687))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636343"
FT                   /locus_tag="CNG00190"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44442.1"
FT                   /db_xref="HOGENOM:HBG068450"
FT                   /db_xref="HOGENOM:HBG177284"
FT                   /db_xref="InterPro:IPR018819"
FT                   /db_xref="UniParc:UPI00004B4884"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK4"
FT                   /transl_table=1
FT                   /translation="MSQSPLARSTRRSLPAFAQPPSKLSRSNVASEDPNSPSPSGSTRT
FT                   PLKKFATPSRESISRYRSVGSSTSTPVTTPIIHYSPYALSTPPQSLSKSASIPFDMVAS
FT                   AKAARRAEEDVKLRGAESSAKKKKFIRKKPLYQRVIGFPQKITDKFLYHTPASILDILP
FT                   DPHMANPIALAIHVVHYLLVAPLFAAKSDDFESVLRTSRTRNDVSSRWDEWENEEKGGK
FT                   SGLLGGRVRAILVLLLMAMAVGNAIYLFTRFRTYDMLLRNAQETVHSPHASPVPAPKVK
FT                   AAKDDDDEKVFEAAPRAKAEPWAPKVLKFTGRSLIFIIKLLIHAVFSAFGRPQGNAPSL
FT                   KDLGQAENKIQSLRVWDPPEFCLAFFCAYPPTAPFITHLFTHINPFLTPVLHVSTTFLL
FT                   SNLAQSYAQLVKDRMLLSAEVMREYDQRFVYKKIFSNKVDRGVSTNESEFVGF"
FT   tRNA            52439..52529
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(complement(53352..53468),complement(53251..53310),
FT                   complement(52969..53214),complement(52780..52926))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805579"
FT                   /locus_tag="CNG00210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44445.1"
FT                   /db_xref="HOGENOM:HBG177290"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000042C215"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK3"
FT                   /transl_table=1
FT                   /translation="MWWLFPPDKLGRVKDENGELIFDVRHLEEEGGAIKVIQEEGEIIF
FT                   VPSGWHHQVVNLDFCISINHNFFASPTLPHIYRTLCISQDRVEDSIADVKGMIIERLGA
FT                   KDDQWEKEWFQEVQNLLEMDAGWGWRGFWETIMKNLKCPPSVNAPTVSQRDDWIGGVIK
FT                   QYKERREWVVLESVRTIVEDIESRIV"
FT   tRNA            54419..54490
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        join(complement(55998..56204),complement(55875..55947),
FT                   complement(55719..55828),complement(55381..55671),
FT                   complement(54962..55329),complement(54822..54897))
FT                   /codon_start=1
FT                   /gene_family="HOG000091644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093132"
FT                   /locus_tag="CNG00230"
FT                   /product="U5 snRNP-specific 40 kDa protein, putative "
FT                   /protein_id="AAW44447.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00004B4885"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK2"
FT                   /transl_table=1
FT                   /translation="MSVRKSPPTAGPGMALSKRARVEDEADENTMVMTVASSGEGQRKN
FT                   ALIRSVKRTSSLEAPIVSLSAAHGGEITACVFDPSGQTLAASSVDRSISLWKSYPPHDN
FT                   YGILPNVHKTAILDIAYSLDSETIYSGAADGTLISTDLRTGERISRYFAHYGPLNSISV
FT                   TISGGRELVLTGGDDGIARVWDFALDGKDPVAEFDDERDCPVTAVEWSSDGNQCFVGGV
FT                   DNTIKVWDLRTNKVLYTLHGHTDTIASLSLSPNGHYLASYALDSALIIYDVRPFSSDPM
FT                   RVYRSLTGAPAGFEQTLIRCAWTRHDGGQRIAAGGGDRTVTVWEVETGKVLYKLPGHKG
FT                   TVTGVDFHPREPIILTGSKDTNMLLGELDAQDFS"
FT   CDS_pept        join(56454..56720,56770..56828,56876..56898,56964..57790,
FT                   57840..57929,57977..58208,58261..59585)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942114"
FT                   /locus_tag="CNG00240"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44449.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG068449"
FT                   /db_xref="HOGENOM:HBG177302"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00004B4886"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEK1"
FT                   /transl_table=1
FT                   /translation="MQTPAHHGHRLHGHGAVIREDFCSFCGGTDAINKQGVQETMVSCA
FT                   ACGRSGHPTCLNMLTPKLRKRVMMYDWHCIECKTCEQCAIKGDDSRLMFCDTCDRGWHS
FT                   YCLNPPLAKPPKGSWHCPKCLSPPAVSSGSISNPRSATRPSKLHPRPSKPGKARPANTP
FT                   NTSNNRRRPKQSLAGDDALFTSHRIKVKVPNPNYQYRDSEEGRGTPMIVRLKVPKRPVE
FT                   EEPEEKKIPYGGVITGDDADTTRTKITEADKEAYQMAKNAAEKQLGGPVPTRETPGPGS
FT                   PLPMASPSGKTTPSSKFPATSRPLRDRLLHQTLPDAYPFPSTPGTTQEVVPWTGSARLE
FT                   KIKTIRFGPYDINTWYSAPYPEEYAYVPDGRLWLCEFCLKYMKSGFAATRHRLKCKSRH
FT                   PPGDEIYREGAVSVFEVDGRKNKIYCQNLCLLAKMFLDHKTLYYDVEPFLFYVMTEVDE
FT                   LGARFVGYFSKEKRSMDNNVSCIMTLPVRQRKGWGQLLIDFSYLLSKKEGRTGSPEKPL
FT                   SGLGAVSYKSYWRLTVFKYLLNAISPSFNHTLELPPVPDATPGPTSELDFNSNTETKPT
FT                   PPRITSKDISKATSMTLEDIFTTLSAEGMINVLDDLTVDAIGKTPNSARTRGRSRGRPN
FT                   VNRRKADLNGSGTLDPQIHQDEDDHVKLPKRYEILLDKAYLQAVVEKHEKKGYLKLAPE
FT                   RLKYHPFLVARQTEEPESGGKKEDENEENGNEKDKEREDESENGVVRFVDSIAEAAHII
FT                   AQSHAHFHTVPSSTISRTSHHPVYPTPTPNHNSIPNRNTTSPARNLRKRKSDVVLETPV
FT                   RKLRSRDNIREGMGTSPRTLRMRNAVALGEGIAEGEEENQGLSKLNQLPVKPVTQFADG
FT                   EIPIDPALLEESVTLDPSMYGSVGEEVYDNDAEGEEYIGEDDDAEGEEYIGEEEDAEGE
FT                   ADEEYIDYDV"
FT   CDS_pept        join(complement(63890..63892),complement(63640..63842),
FT                   complement(63338..63581),complement(63114..63285),
FT                   complement(62933..63051),complement(62685..62879),
FT                   complement(62392..62626),complement(62264..62342),
FT                   complement(61476..62214),complement(61209..61426),
FT                   complement(60659..61160))
FT                   /codon_start=1
FT                   /gene_family="HOG000187967" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805580"
FT                   /gene_name="RIM20"
FT                   /locus_tag="CNG00250"
FT                   /product="pH-response regulator protein palA/RIM20 "
FT                   /protein_id="AAW44451.1"
FT                   /db_xref="HOGENOM:HBG177311"
FT                   /db_xref="HOGENOM:HBG324347"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI00004B4887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEK0"
FT                   /transl_table=1
FT                   /translation="MSNFLPIPTKAATPLPSFAKHLLDYISAHFRDTHSEAFRKDVDVL
FT                   VGMRKDWVEAKLEAHPEIIRAFMRYHAQLAFLSTKFPSDINLPFAYYLPFPATFSLSPD
FT                   APISLSSLTFERACVLFNMTALYASMAAAERRAEAEGIKRALGYLTAAAGVLEYLITSV
FT                   LPTLRSELSSPQAAGYDMTESFLGTLKEFVLAEAQECYWQQAVLQGTYKNGLIGKLSMK
FT                   VSEYYKAALASMNGTDYPSSSYFPLNWTAHMNVKQMHFEAAAQFRLSQEDLEKSRYGEE
FT                   IGRLKVAESLAKKGLDAARKGVADSVVSDLKQLHAAIKSSLERAVRDNDLVYVQPIPPA
FT                   NQLAPIVGVGMVKVNVPAEVAEPVAWLMGGKAGMEPLFSGLVPYGVHLALSIYDDRKDT
FT                   LVRDLDGKREELDGLAASTLQSLNLPGSIQALDRPVGLPPSLLKKSEEVASSGGIERIR
FT                   SLLDEVNRLAHANVQSLNEAMDILDQEATENESLIARQPELQQTRQPSHVANQPLIQMA
FT                   EQYEATIKQAGGSDATVRAKWEEWARLVGILAAGEMEMEDYVPGTTSPSGSLPPSVRPL
FT                   RASLEELDDRIAHRARLVREARQISAADDIRPEVLKEAAKLAHGGSGDVKTEWFEDLFE
FT                   KGLEKYMGVKREMDEEVAKHDELLEQIRTQNESFLSERKDDPIIKERERRLQDMDLAYW
FT                   KWREIVDNAEEGIKFYNSFAEMLHGFKAACGQFLNTRRIDVGQMTTQFQQQMNVSEPQQ
FT                   QPEPRYQSPSPQSFQPSFSPSPSHFQPSAPSSFSSSPVRSPAPSAPARRESPPKTLSFL
FT                   PHPSSSAWQPASVDFLPPPPPPPILRSGGIQSQPKVAPPVTPSITAIRDQTQGTPRRMT
FT                   RAAAAAAERDEATERNKYSSGGPRRKGGGVV"
FT   tRNA            64079..64150
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        join(complement(66574..66813),complement(66295..66525),
FT                   complement(65927..66236),complement(65642..65868))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805581"
FT                   /gene_name="TSC10"
FT                   /locus_tag="CNG00270"
FT                   /product="3-ketodihydrosphingosine reductase TSC10 "
FT                   /EC_number="1.1.1.102"
FT                   /function="3-dehydrosphinganine reductase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44453.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0047560"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177317"
FT                   /db_xref="HOGENOM:HBG398139"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4888"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEJ9"
FT                   /transl_table=1
FT                   /translation="MPTPLALLLSAILIIGTYFAMPFWPFRKSNYDPRGKHCYITGGSS
FT                   GLGKALAERLVKQGAHVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTN
FT                   AIHAACKPHADQAPDYVYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMM
FT                   SKQRRTGKIIFVASFLSYVSFAGYSSYSPAKYALRGLSDALRSEMLLHNIDIHIFLPCG
FT                   ISGPGFDAENRTKPAVTKKIEEGDTPITPDVCAAALESGLKKGYYQITDNLVTEPIRLR
FT                   SNGGVPTNNFLLDTLWLIVSSVGVPIWRMTADSAVRSFRAKVEKELEAKGYYVS"
FT   CDS_pept        join(66999..67118,67181..67537,67592..68371)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805582"
FT                   /locus_tag="CNG00280"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAW44455.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG068448"
FT                   /db_xref="HOGENOM:HBG177322"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI00004B4889"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ8"
FT                   /transl_table=1
FT                   /translation="MPKPIPQPVAPFSNPHEDEERTVHTVYEAIAPHFSQTRFKPWPLI
FT                   AQFLSTQPPGSIGLDSGAGNGKYLPVAHQAGCEMIALDRSSGLLSHARKMGFGGLNANR
FT                   QEDDREETGDGNQVAECVRGDMGIDAWRAGVFDFVISIAALHHLSTPERRQHAVQIMLR
FT                   PLRLSSQPPYGRFMIYVWAYEQGESSRRKMGTAVFDAASKPDNEFASSAVSPLQEKKEG
FT                   EEQGKEKIQDVLVPWVLAPKKGETFKKSKQPKQPNPKQPSQSKKRQQDLEEPISRIECL
FT                   HIDSPFQLSGSKPQTETLLSEPTNLSEPQPEPQPIPKPEPQVFHRYYHLFTAGELQSLV
FT                   EAAGRAEGFRVISSQSSGDDGNQADTKGNERDGIEGSVVEREEVVGKWEGGEERKWLRV
FT                   RGVGWEMDNWWLEGEVGKS"
FT   CDS_pept        join(complement(69864..70128),complement(68731..69797))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636344"
FT                   /locus_tag="CNG00290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44843.1"
FT                   /db_xref="HOGENOM:HBG068447"
FT                   /db_xref="HOGENOM:HBG177329"
FT                   /db_xref="UniParc:UPI00004B488A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ7"
FT                   /transl_table=1
FT                   /translation="MPPPLVPQSIRRAPTQIRTLCSSPRPRSVLRGPVPRRQQPSDIPR
FT                   AESSAAAQRREDITRMAVEKVKGIYRQEEVYRTSAKGKERARPENPSSFPPIISRLLSA
FT                   RLYRLATLHLLDTPSLAADEKLVTAMRDHMFLNGAEHLGRRLDRGLERWKRGKEDVIKF
FT                   LPDLKRLKKEVGEGKKLPPECPYPPLPFTNTFLSNLLRKPYSPPTHTHLALPLPLPPPS
FT                   PNLLQVEHLLNLINQLEQEEGFQADRETAVLIFACWLRCVCTKVRDPPEALREMKHPSD
FT                   PANTSNPTRPSIPRPSYAQSDSISNSDSFSDVVSNPLLPPPTPHQILTLFQTLHPHLTP
FT                   SSPTLPEATREEKEWEWDKVVRPFGKAFINSLRVVGSSQSASAWKGIGPFPHGPGVGLG
FT                   LGTRSYGIHGSNKRGWDGGVKEIGVVKRWMKTRKKELLGDDPMI"
FT   CDS_pept        join(70400..70466,70522..71240,71417..71548,71607..71627)
FT                   /codon_start=1
FT                   /gene_family="HOG000210987" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805583"
FT                   /locus_tag="CNG00300"
FT                   /product="L10e protein, putative"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44457.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG232283"
FT                   /db_xref="HOGENOM:HBG601294"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI000042E3C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ6"
FT                   /transl_table=1
FT                   /translation="MGATRANKELYFEKLRALIEKYPSIFVVNIDNVSSQQCHMIRQAL
FT                   RGKGVVLMGKNTMVRRAIRTILPEFPQFEKLMPFVKGNIGFVFTSGDLKDVREIIISNK
FT                   VAAPARAGAFAPNDVYVPAGNTGMEPGKTSFFQALGIPTKIARGTIEIVSDVQVVAAGS
FT                   KVGPSEATLLNMLNISPFTYGMTVVQVYDNGAVFPSAILDIEEKTLVDQFVSGIKTVAA
FT                   ISLATGIPTIASVVHSLVNSYKNILNVSLATDYEFEGSAKIKEYLANPEAFAVAAAPAA
FT                   AAEASSEAAPAAAKEEEKEESDDDMGFGLFD"
FT   CDS_pept        join(complement(75118..76265),complement(74910..75070),
FT                   complement(74765..74860),complement(74418..74702),
FT                   complement(73886..74337),complement(73401..73835))
FT                   /codon_start=1
FT                   /gene_family="HOG000244024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942115"
FT                   /locus_tag="CNG00310"
FT                   /product="Alfa-L-rhamnosidase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW44459.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG087822"
FT                   /db_xref="HOGENOM:HBG696677"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="UniParc:UPI00004B488B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ5"
FT                   /transl_table=1
FT                   /translation="MSVTIVSLQAERHESGFGIAHPTPRLTWRFGSTTLKDWKQASYEL
FT                   IITHPGNHQAEHYIVKSEQSVLVSWPSKSIQSREIVEVKVRSTGTDGSTTNWAGITLEA
FT                   ALLDRGEWKAKFISGPPQEVDAPKPPFRLRKTFVLKSAPIQARLYASALGVYECEINGK
FT                   RVGDQILAPGWTSYKYHLRYQIYDITSLLQQGENTITAYVGEGWYATRLGRPGKRNNWG
FT                   SRLGFLGQLETDGEAEVVTDETWECVDGPIKNSEIYNGEVYDLTYDESKAKISPVEVLS
FT                   FPEAQLIASDAPPIRRVKEVKAVELITTPSGKSILDFGQNLVGFLRIETDLKGKELLLR
FT                   HAEVLEDGELGTRPLRTAEPNDKIILGGKTKGWEPKFTFHGFRYVEIEGIRPTLEDFTA
FT                   IVIFSDMRRTGTFTSSHDMVNRLHENVVWGMMSNFVSVPTDCPQRDERLGWTGDIQVFA
FT                   PTANYLFDTSGFLEGWLQDVAAEQIEWKGVPPTVVPYVPPNKFNDQYPKPQSIWADVVA
FT                   IAPWDLYNTFGDERIMEKQWGSMRMWLDEGVPRGKDGLWSEIAPQYAQYPAHGRTDTHF
FT                   VANAYLVHVTSLVAKIGKLLKKDPEVVKKYEDDATRLHKLFLEEYTTSTGRVVSDTQTA
FT                   LALVLKFNLLKAEQIPRARERLEFLTRWAYFKVSTGFAGTPILLPVLADNGLEHIAYRM
FT                   LQEKDNPSWLYSVGMGATTIWERWDSMLPNGRINPGQMTSFNHYALGAVAKFMHTYIGG
FT                   LSPSSPGWKSALIKPLPGGTITSAQTSFDSPYGPYVCKWKIEGDTMLVDTEVPPNGSAR
FT                   VVLNGIDEVIGSGKKRFKVPYEKDKRWPPKGIRGPQSVFMPDEFVP"
FT   CDS_pept        join(complement(80176..80205),complement(80107..80124),
FT                   complement(79959..80054),complement(79752..79895),
FT                   complement(79574..79673),complement(79233..79515),
FT                   complement(79114..79181),complement(78967..79064),
FT                   complement(78831..78911),complement(78672..78782),
FT                   complement(78514..78615),complement(78403..78438),
FT                   complement(78276..78349),complement(78183..78227),
FT                   complement(78064..78131),complement(77633..78013),
FT                   complement(77500..77580),complement(77144..77436))
FT                   /codon_start=1
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636345"
FT                   /locus_tag="CNG00320"
FT                   /product="Acyl-coenzyme A oxidase I, putative "
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="AAW44461.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG483086"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000042C176"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ4"
FT                   /transl_table=1
FT                   /translation="MAFPRPKPTTVETLAMERANPPFNVRKLSIKMHGSEKALVLKERF
FT                   MAEIARHPAFKLSDIHDLSKDELRERTMEKFASMVYFVTNESLEVFNLRMQLIGIADPS
FT                   FWTRFGVAYGLFLGALRSGATPNQLSYWIDRGVLGLNGVIGCFAMTELAHGSNVAGLET
FT                   TATFDRETDEFIIHTPHLGATKWWIGGAASTATHAAVFAQMIVDGKKYGVKTFVTQLRD
FT                   TKTFQLLPGITIGDIGKKMGRDGIDNGYIQFTYVRVPRAHMLMKHTQVSRDGVVTEPAL
FT                   AQLTYGALLGGRTSMVTDSSNSAKKALTIAVRYAAVRRQFATGKNQLETQILDYPIHQR
FT                   RLMPLLAQAIAIGFTGLKLTKMYEDMTQSLDTMDPSDLKETHATSAGLKAFCTWACLDT
FT                   IDKCRQSCGGHGYSAYSNFPTMYADFAVQCTWEGDNTILSLQAGRSLVGAWGAAIKGKH
FT                   LVSGVAYLNDRSILTAKSDSSLTLSDIKRAWNCVAANVIKKAAEEYVSYLKAGKSKEVA
FT                   MEMCSQSRFIAAKVHTVGYIFTMFKEAVEDMEESAETEILRTVAKLYGLWQIEEQQGYF
FT                   LKYGYFTAEQMDKVQTSVDGLCAEVRTIAVPLVDAFALSDHILNSPLGKYDGSVYESYF
FT                   SQVQAANPLPKEHPYFTRLIKPLLERQNAEMEDPEQAMGLDDELKEIEEERREAAKGKE
FT                   GKVRKEDY"
FT   CDS_pept        join(complement(82008..82479),complement(81163..81956))
FT                   /codon_start=1
FT                   /gene_family="HOG000138272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805584"
FT                   /locus_tag="CNG00340"
FT                   /product="Kynurenine 3-monooxygenase, putative "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44463.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068445"
FT                   /db_xref="HOGENOM:HBG175619"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI00004B488C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ3"
FT                   /transl_table=1
FT                   /translation="MAQERSKIPSHVLILGGGLAGTCFALALSKSGIRSTIFELRSDPG
FT                   DIGGALMLAPNALRVLDKLVGVYEEIKDNGFSFEKLNFYSEDGMKLGGFAQGDQERWGY
FT                   KALRIKRPILHKKLLEACAASDKIDFKYGMIWKSIDESETGVMIHFEDGTRTSGDILVG
FT                   CDGIHSRLRNYLLPDPPTPTYAGLAGIGGEVSRSSLDIPPYMTLPAFIYTRPGMVMLVP
FT                   CDFSGESIGWAAQKSVPDRTRSGWREYEESGDAIKGIKEDYKDVQNETLQSLLKVASEE
FT                   AGQARVWAPYQIPRLPTWHSKRICLIGDAAHAIPPSGGQGAAQAFEDGGLLSMFLSNEE
FT                   AVGKGYEKLFEQFEKKRKKRFEIVESLTKASGSSRQEGMTGLEWFIKKWGMWAYLLTKG
FT                   GYMKDDALMSYDVTKESVVVPS"
FT   CDS_pept        join(complement(84479..84601),complement(84272..84414),
FT                   complement(83817..84217),complement(83690..83753),
FT                   complement(83384..83639))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805585"
FT                   /locus_tag="CNG00350"
FT                   /product="Opsin 1, putative"
FT                   /function="ion channel activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44466.1"
FT                   /db_xref="GO:0005216"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177346"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="UniParc:UPI000042E711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ2"
FT                   /transl_table=1
FT                   /translation="MDYFAEFRPTTTISVNPPGGTNTHHPGPHHSHHLPLPTAPFPSAT
FT                   PRFLHATRVGHVSVWVFTALFIAGLVVALVLTSRTQKKNRLFHGISAVILTVSALTYMS
FT                   LATHIGSTFVPIYGPPGHHEPLVHFFRQVFSIRYIDAAITGPLTILALSRLAGVSPATA
FT                   LSAALAQLVVVYSAWAASVGGGWPWGKHGKGAGTKWAWFAVADLAFLAVWTVLLAKGRK
FT                   ASVHRARPTQGLFYLLSSMIILIHIGQGVIWILTDGINLISVNAEIISYGIMDVAAKIG
FT                   FTHLLLLLHKSDEEGPWTLPAWWAEDPEGAGPDGRGIYGAVTSVGSD"
FT   CDS_pept        join(complement(89037..89440),complement(88887..88982),
FT                   complement(88674..88839),complement(88487..88626),
FT                   complement(88050..88440),complement(87912..87999),
FT                   complement(87738..87861),complement(87629..87683),
FT                   complement(87396..87577),complement(87314..87338))
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805586"
FT                   /locus_tag="CNG00360"
FT                   /product="Serine/threonine-protein kinase orb6, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44424.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00004B488D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ1"
FT                   /transl_table=1
FT                   /translation="MSYRPSQQQQPGPSNFQQQQQHMLNPQNMAGPGRTSPMPTVPQVS
FT                   QPNIGQPGSMRPGEGPTPAVAQANAGGQIQGNGAEGLGSLASDKGPDYVYFERKPGQFS
FT                   EAVQGKAMGAKMKLELFYKEAVEGVVGRKERRTALEKQLAADALTPDSLKARQLINLGR
FT                   RESNYLRLRRTRIGLDDFRTVKVIGKGAFGEVRLVQKADTGKIYAMKTLRKNEMFKKDQ
FT                   LAHVRAERDVLAESNSPWVVQLYYSFQDTQYLYLVMEFLPGGDLMTMLIKYDTFSEDVT
FT                   KFYMAECILAIEAVHNLGFIHRDIKPDNILIDSLGHIKLSDFGLSTGFHKQHDSAYYQR
FT                   LLGGGDVSGSNRHSQTAAGARNSVMVNAINLTMTSKQDIATWKANRRKLAYSTVGTPDY
FT                   ISPEIFLQQGYGKECDWWSLGAIMFECLVGYPPFCSENAHDVYKKIIDWRNYLFFPDDV
FT                   HLSREAEDLIRRMLCEADRRYTVEQLKAHPFFYGVDWATIREIDAPFVPHLRSITDTSY
FT                   FPTDELDQVPDIPVGAETGSDAKKDLAFLGYTFRRYEML"
FT   CDS_pept        join(complement(90564..90596),complement(90366..90511),
FT                   complement(90207..90305),complement(90066..90153),
FT                   complement(89978..90016))
FT                   /codon_start=1
FT                   /gene_family="HOG000138271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581871"
FT                   /locus_tag="CNG00370"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44427.1"
FT                   /db_xref="HOGENOM:HBG177358"
FT                   /db_xref="UniParc:UPI000042F38E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ0"
FT                   /transl_table=1
FT                   /translation="MSSSLPPHDPSIETPQSKLSATGNIEQATRRVNRFAKRDPALYPL
FT                   AFIMTGIFGVAGYMFWKKSVEPEPVKKLVSTGIVNPWDSSDKLDTYPSSVAQFKYRYKT
FT                   RDGHYEDAHPTLNQSMQHLKDNNPHKYRTA"
FT   CDS_pept        join(complement(90564..90596),complement(90366..90511),
FT                   complement(90207..90305),complement(90048..90153))
FT                   /codon_start=1
FT                   /gene_family="HOG000138271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581871"
FT                   /locus_tag="CNG00370"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44426.1"
FT                   /db_xref="HOGENOM:HBG177358"
FT                   /db_xref="UniParc:UPI00004B488E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEJ0"
FT                   /transl_table=1
FT                   /translation="MSSSLPPHDPSIETPQSKLSATGNIEQATRRVNRFAKRDPALYPL
FT                   AFIMTGIFGVAGYMFWKKSVEPEPVKKLVSTGIVNPWDSSDKLDTYPSSVAQFKYRYKT
FT                   RDGHYEDAHPTLNQSMQHVRIFY"
FT   CDS_pept        join(complement(98085..98181),complement(97857..98026),
FT                   complement(97707..97804),complement(97513..97637),
FT                   complement(97445..97451),complement(97099..97134),
FT                   complement(96886..97042),complement(96797..96832),
FT                   complement(96483..96744),complement(96380..96431),
FT                   complement(95584..96325),complement(95076..95524),
FT                   complement(94689..95026),complement(94426..94641),
FT                   complement(93896..94374))
FT                   /codon_start=1
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805588"
FT                   /locus_tag="CNG00380"
FT                   /product="Hydrogen-exporting ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44429.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="HOGENOM:HBG706356"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00004B488F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI8"
FT                   /transl_table=1
FT                   /translation="MMGLKNRKNHKKDPEAGDAETEAKRQEEDKKKKYSGEEYDVLLKY
FT                   VADQQEKIKKGGDDEGKEDEENVKYIRKWYTPWKKTKVETGGKKVPPDWLNTDRQKGLS
FT                   SSEIEERRKHSGWNELESPNENQFLKFISYFRGPILYVMELAVILSAGLRDWIDFGVII
FT                   GILFLNAGVGWYQEKQAGDIVAQLKAGIALKTVAIRDGKEEEIEARELVPGDILVLEEG
FT                   KTIAADAKIIGDYEDKDGSKSKDILDRVEKSKHSKKGDDDDEDDGPDKGPSLCSVDQSA
FT                   ITGESLAVDKFIGDVAYYTCGVKRGKCFGVVTVSAKGSFVGRTASLVSSSNEKGHFQIV
FT                   LGGIGTTLLVMVVAFIFAVWIGGFFRGTGIATPRENNLLVYALIFFIIGVPVGLPVVTT
FT                   TTLAVGAAYLAKRKAIVQKLTAIESLAGVDILCSDKTGTLTANKLSLNEPYIAPDVDPN
FT                   WFMAVAVLASSHNVLGLDPIDKVTIVGLKDYPKAQEMLKGGWKTHKFTPFDPVSKRITA
FT                   EVEKEGKHYTCAKGAPNAILKLTKFDPDTVSAYRAQSQQFASRGFRSLGVAVKEDGKDW
FT                   ELLGMLCMFDPPRIDTAKTIGEAHDLGIQVKMLTGDAVAIAKETCKQLGLKTNVYDSEK
FT                   LIGGGMAGSDIRDFVEAADGFAEVFPEHKYQVVNLLQERGHLTAMTGDGVNDAPSLKKA
FT                   DCGIAVEGASDAARTAADVVFLDEGLSTIITAIKVARQIFHRMKAYIIYRIALCVHLEV
FT                   YLMLSILILNETIRVDLVVFLAIFADVATIAIAYDRAPYAHQPVEWQLPKVWIISTIMG
FT                   LLLAAGTWIIRATLWIDNGGIVQNFGSTQEILFLEVALTESWVIFITRLAQEPGTPNVW
FT                   PSFQLVAAVIGVDALATIFALFGWISGDAPHGGWTDVVTVVKIWCFSFGVVIIILLVYL
FT                   MLNSIRWLDSIGRKSRSKKNEKLENFLTDLQRLTIVHETDHNGSYYRFASTKKDEEGGD
FT                   NGKKDDKKDEAKSGDTKKQEGNAKKGDNEKKKDDSEGEKGATGGEKGDGNGDKGLSDHT
FT                   GKGHEHAQAQNKGAKEVQPDGTQPKSDDQSSEGTHVDPN"
FT   CDS_pept        complement(99736..100812)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093133"
FT                   /locus_tag="CNG00390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44430.1"
FT                   /db_xref="HOGENOM:HBG068444"
FT                   /db_xref="HOGENOM:HBG177378"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI00004B4890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI7"
FT                   /transl_table=1
FT                   /translation="MLRAISFCFRLHTPPAELNIMDDGHPHASSSQSPYWARALRAKLL
FT                   RNAASLAYTIHHYAHPAAPSATLTKWIDCTLGEKKGKKAIRLDVYVPNGVKLGSADSGN
FT                   RPGVIIFHGGGFVLGQGTDDARWAGAVCEQMGAVAIAVSYRLAPEFPFPTPVEDCASSI
FT                   LHVTEHAKAYGIDPTKLFISGFSAGGNLAFSSHHLLHTPSKWGYSLPIDPLPICGIITF
FT                   YPLLDYSLTRPEKRSACEKPEFTLAPSLTTLFDSSYLPPGVDLLDCRLSPGIAPDEMIE
FT                   KLPSVHLALCEYDMLHAEGIKFKERLESKGINVSVREIKGEKHAWDKPPPMSPKPSVKE
FT                   EYDATITVMKRWLDQERK"
FT   CDS_pept        join(101529..102452,102501..104231)
FT                   /codon_start=1
FT                   /gene_family="HOG000212636" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789022"
FT                   /locus_tag="CNG00400"
FT                   /product="Aspartate--tRNA ligase, putative "
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44431.1"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG051397"
FT                   /db_xref="HOGENOM:HBG330034"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI00004B4891"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI6"
FT                   /transl_table=1
FT                   /translation="MSSTDTTKNPIIKLGRVLKPSHSNSGDRPELPRSATHEKVARHAA
FT                   EKQHEQAKQEAKKERTEHEKHEMQRRRQIADEKAQLEEDSETQASYGDIDGLEEITPFE
FT                   EVIDMPAGTKVNIRGRIHQQRDLSSHLNFILLRQRGLVIQGILSEHASEHMIKWVQHLP
FT                   GEAIVQVSGTLREPPKPITAAVDTPLELNIERLYLVEASHDIPFNLAHGDRPPQSTRLR
FT                   NRTLDLRHPTAQAIFKIRAKVLKVFRDTLDDLGFLEINTPKLQPSATESGAEVFRVNYF
FT                   GRKAFLAQSPQLMKQMAISADFRRVYEIGPVFRAENSNTHRHLTEYTGLDIEMAIQKEY
FT                   HEVFRILDIVLRNIFNALKEMKTELNRIREFFPSDDFQFLEETPIIPFQEAVQMLRDDG
FT                   RDVEEEDLHTPDEIRLGELIKEKLGTDYYVIDKFPVSARPFYTANDGKITNSFDMFIRG
FT                   QEVCTGGQRINDPKELRESMKESRINEDEMAEYLQAFDWGMPPHGGAGLGVERIVTFFL
FT                   NLPDVRLSTLWHRDPHSLPDKPASLPHPDADTLKTIDPNNPPPIENLIANYGDATNTSW
FT                   LDDRFDIWRDRETGAAIGYSTKDTKFCMITGDPLCDDGQKKQVTKRFLDFIRREVKMKP
FT                   IWLLVSEMMEEILAYEFGWRALSCTQEQRSDSDRADSSVIQNSKQKKGVFKVREVEPTE
FT                   KIQRKCDARIEEWSAGRDHKGKQVHLTEIAPWKDTEHRRYFIAESDHEANENGENNKFQ
FT                   SRKGEQTIDTLVVLARLAPSKGYQLKWALDFPGSPNGAIESTVQAALSAVPGEPVTFGT
FT                   AVSESLVTKHGIGGLRASFMERTYRSIVKSLSLDKKAGFREKFGVTGDLTYICYPKGGV
FT                   KAYELKDIVKFFE"
FT   CDS_pept        join(complement(105708..105741),complement(105358..105662),
FT                   complement(104543..105294),complement(104410..104497))
FT                   /codon_start=1
FT                   /gene_family="HOG000046303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805589"
FT                   /locus_tag="CNG00410"
FT                   /product="Putative uncharacterized protein "
FT                   /function="D-amino-acid oxidase activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44432.1"
FT                   /db_xref="GO:0003884"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG112494"
FT                   /db_xref="HOGENOM:HBG735740"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniParc:UPI00004B4892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI5"
FT                   /transl_table=1
FT                   /translation="MSFDAVVIGSGVIGLSIARELHNRGLKVAIVARDLAEDSISVGFA
FT                   SPWAGCNWFSFAEGGTPAAEWDTITFGKLAKLAKDHPHICQKIPFCSVWDLPKSDAESE
FT                   PWFKDLVFDYKNLKSTPGQPLPGGKKFGHSFASYVLHAPNYIRHLSSETRALGIPVHRY
FT                   RLSSLDEAYNLSGIGKVSLVVNASGLGAKALIGVEDEKVYPGRGQTVLVRAPGFKACIM
FT                   HTEGFYADLDESGREVTPPPPAYIIPRPGPEGHVVLGGVYQRDNWSTLPDLKEAERILK
FT                   DCYNLAPELAGPNGKTWKDIEIISHNVGLRPAREGGPRLEIEEREVGTGANEGNAYDVA
FT                   PMIGRIGERRKVAVVHAYGIGSAGFQASLGMAEKASDLTVKYLSGKRSPARL"
FT   CDS_pept        join(106241..106333,106385..106503,106551..106994,
FT                   107041..107141,107188..107411,107457..107656,
FT                   107703..107929,107979..108253,108305..108814)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805590"
FT                   /locus_tag="CNG00420"
FT                   /product="Expressed protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44433.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068443"
FT                   /db_xref="HOGENOM:HBG177402"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00004B4893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI4"
FT                   /transl_table=1
FT                   /translation="MQSEGGSPEIKRKSSKVERGREACTECRRHKIRCNPRPDDPNHLY
FT                   PCSRCERMSLTCEFQKHNRGRKRKHPVALLNGGLIDQGSNGEGSSRGEYISKRERTPPQ
FT                   NSSHSFGDPRFPFISTELAEPTGPRKQSGWHESDLEAYHRHGHQMSLRHMLADEPDDDA
FT                   SVDEEESRDELLDEEADGESSRKRLRVAVQKGSDLVDDPIRAGFVTEEEGRALFHLYLT
FT                   HVNTSLPMLDPSFHTHSYVRESSPFLYTAILCIMSRYLSSVSLSGQAVSPESAQSVHQQ
FT                   ILVLARDHLTWSFAEAVADINTVRAMVILSLHKEPDDDKAGYYVSRAILMGKELNLGRI
FT                   PPKSESDRMTDKELQCLRSRQRVWLCLFFVNSIFNMQFRQPMLILQNDPLVATAHHWLK
FT                   RSRPETLLRDSQLVCSTELRRKYLHYRDLLVGSGPDETTYRSALSLSILTKTMNQDWDV
FT                   TSEAWIRDIIDVGGTSSHVNKPRIWTSALRLNLNLLIVNQTLRLPPEDQLDFGAPSSIP
FT                   AFHHCLNAATTVLVRFEGLDRQQLTFASDTFLHFALYAATLLSTLCRGQHPYKFETVEI
FT                   EHCRRLIRKTADALEGASAYPHDSPALHAYYLRRLNQYLPRPPSQNPGSSSSFSSGSGM
FT                   PKPVANGQTAIDPILQNMSSGTTSLHTALTNALGNELDFLMADFPWMEGSGIEWLNEGE
FT                   TGQEQPQQVHMPPHPQTARMSYETGHFGAMPDNGGF"
FT   CDS_pept        join(complement(109696..110637),complement(109451..109612),
FT                   complement(109206..109382))
FT                   /codon_start=1
FT                   /gene_family="HOG000138270" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22581872"
FT                   /locus_tag="CNG00430"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44435.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG068442"
FT                   /db_xref="HOGENOM:HBG177410"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00004B4895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI3"
FT                   /transl_table=1
FT                   /translation="MLITRADVPYGIDVPRWTDPQSLPEGYKYAEEPFTVDGKYCAQPE
FT                   RTYHQTNSIRDRLGLGKPTENPFFADIYIPSDYPLSSPGERPLLPVRVFIHGGFLQYGS
FT                   TSGQNYNQQFFAAEHYNEVRVLLGHRVSILGFLGCEKPKISGNFGFKDCWLGLEWVKEN
FT                   VASFGGDPNQIHLSGLSGGGHVVHQLVHQAARLAPKPAPFITAHLQSNAILADPLTPTA
FT                   RNAQFTAFCESVGIDPSIPNVLEGLRDTSKFSTDRIIKAVQDMGELCTFRGIVGDDGWV
FT                   RADEMEFQKNGGLAKGLREAGVHCIVVGDVRDEDFFYRGVHPCKKYDDLVPNIARYYPY
FT                   DQSQKFLNSYYPIPMDSSPTELDDRLGRILADGQVHLPVRLLAKDLAAYSFPAVRYAIE
FT                   SVPVAYGTMAKHPMVPIWQFTSCVCRC"
FT   CDS_pept        join(complement(110678..110834),complement(109696..110618),
FT                   complement(109451..109612),complement(109206..109382))
FT                   /codon_start=1
FT                   /gene_family="HOG000138270" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22581872"
FT                   /locus_tag="CNG00430"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44434.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG068442"
FT                   /db_xref="HOGENOM:HBG177410"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00004B4894"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI3"
FT                   /transl_table=1
FT                   /translation="MPIINFPPTTDIGPNDMTGDQLALPIFERVSTITKHGKITGGRVK
FT                   NGCQVFLNVPYGIDVPRWTDPQSLPEGYKYAEEPFTVDGKYCAQPERTYHQTNSIRDRL
FT                   GLGKPTENPFFADIYIPSDYPLSSPGERPLLPVRVFIHGGFLQYGSTSGQNYNQQFFAA
FT                   EHYNEVRVLLGHRVSILGFLGCEKPKISGNFGFKDCWLGLEWVKENVASFGGDPNQIHL
FT                   SGLSGGGHVVHQLVHQAARLAPKPAPFITAHLQSNAILADPLTPTARNAQFTAFCESVG
FT                   IDPSIPNVLEGLRDTSKFSTDRIIKAVQDMGELCTFRGIVGDDGWVRADEMEFQKNGGL
FT                   AKGLREAGVHCIVVGDVRDEDFFYRGVHPCKKYDDLVPNIARYYPYDQSQKFLNSYYPI
FT                   PMDSSPTELDDRLGRILADGQVHLPVRLLAKDLAAYSFPAVRYAIESVPVAYGTMAKHP
FT                   MVPIWQFTSCVCRC"
FT   CDS_pept        join(111654..111881,111936..112108,112161..112487,
FT                   112546..112816,112871..113072,113141..113520)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789023"
FT                   /locus_tag="CNG00440"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44437.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000042F440"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI1"
FT                   /transl_table=1
FT                   /translation="MGASITEDKAYSMGSQEMAVPDLEGQEKIESLERVESARSHVLDD
FT                   LGKGEGISFEDLPIIDVKSEDNRRVLRKLDCLLLPLTMIAYTLQYIDRSAMSYAAVFSF
FT                   RTDLHLVGTQYSWLGSCFFLGYLFFEFPGSYILQRLPLSKIMGTSIVIWGGLLMCLAAP
FT                   RSFGGAAAIRTLLGCSEALVTPGFVLLISRFYKREEQPLRVGLWYCCNGLGSFIGALVS
FT                   YGMGHIHVDSVPNWAWIFIFNGGITVIFGTVFLFLCPENPQTCKVLNAHEKRVALERVR
FT                   TNRSSLGSKIIKWYQVKEALCPWICPQGWSYFFIVMSLSLPNGGIGNFLHLILQSYGYT
FT                   SFQTILMGLPQAAMQVVFPLSGAIIARKVPNARLYVLTAYMLPSLVGVIIQYKTRNSGA
FT                   LLFGYYILGSYVASLGICFAAPGANVVGYTKRVVVGAMVFIAYALGNVAGQFFWKSTES
FT                   PPYRSGMLACMVCFAATIPMGFSLRYYYVYENKRRDRLQAEMGEGAENDQGDFSDRTDV
FT                   ENLSFRYAL"
FT   CDS_pept        join(115118..115170,115237..115324,115388..115536,
FT                   115621..115714)
FT                   /codon_start=1
FT                   /gene_family="HOG000167251" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093134"
FT                   /locus_tag="CNG00450"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="AAW44439.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG036091"
FT                   /db_xref="HOGENOM:HBG499936"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniParc:UPI000042DF18"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEI0"
FT                   /transl_table=1
FT                   /translation="MSAGQTYYEFYRGSRHVHIGTALTDALDELITQGDIPPQLAMRVL
FT                   QQFDKSLTECLQKGVKNKTTIKGHLSTYRLCDDVWTFVVKDPQFKMEGVGAGSEMVTGS
FT                   KIKIVACKSGDAADGKKAGGARE"
FT   CDS_pept        join(complement(117978..118132),complement(117370..117922),
FT                   complement(116688..117237),complement(116377..116614),
FT                   complement(116169..116313),complement(115972..116106))
FT                   /codon_start=1
FT                   /gene_family="HOG000213862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805592"
FT                   /locus_tag="CNG00460"
FT                   /product="Putative uncharacterized protein "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44441.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068441"
FT                   /db_xref="HOGENOM:HBG177434"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00004B4896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH9"
FT                   /transl_table=1
FT                   /translation="MSFPRQISTLVVGGGPAGIVSLKYTVEYGEAWSEGEEPLLIDMES
FT                   EIGGTFRWRGYQNAELVSSKQLTCFSDFRYPLDSPDHPSLPNFVDYLNCYIDHFDLRHM
FT                   IRTSTKLVSLEYASSDSKDLYKHRATIQPLNDNGLPQGDPLIVLAKRVIITTGLHVTPN
FT                   IPLIPGLNSTPCIPEPPKWIHSSAYKSRNQLKDKKVLVLGCGETGMDIGYEAIMAPAKK
FT                   VWLGVRTGFLSFPKLFETAYVHPWVAASHIRWFISDLVIKRLLWVLTGTMAGCNQWAGE
FT                   LPPERQGRAYVFLNKSAKAMQFINRPFYSLSPIHRWIAHYIDPPPPPGDPKIDIVPFPQ
FT                   GFDSEGRAVFPAPPEHRRKETAWKDECKPDLVVLCTGYRQDWSWLGEGYPRGPEDCEIR
FT                   GITSTKDLSIAFIGFVRPGVGAIPPIAEMQAQLFILLTEKRVPIPVSPETYHLLHSPTS
FT                   RIQYGVDYSTYMSTLAKDIGSAPGLLRLWWDYGLFVLFVYCFGAAFPTFYRLTGPFKIT
FT                   KAREIVETELWDTIRRRGVIGNIFMGVIPMVFYAYLNIGAYILEFVWRVVTPIFDLPAS
FT                   PLELFQEKSTTVKSI"
FT   CDS_pept        join(118810..118905,118993..119308,119391..119731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805593"
FT                   /locus_tag="CNG00470"
FT                   /product="Acylglycerone-phosphate reductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44443.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068440"
FT                   /db_xref="HOGENOM:HBG177439"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4897"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH8"
FT                   /transl_table=1
FT                   /translation="MVLDVTDEQNIAQVVKSVSERTGGRLDVLVNTAGIDTLCPLLDTS
FT                   LPALREVLETNTIGPLALIQGFAPLLVKAANEPVPGTNQVRQSVIVNMGSLSKAGFTWK
FT                   GGYSMSKAALECMTEVLRSEMMPLGVQVINCHIGTVNTDMYFNQKIFDSKSPNPTPYYP
FT                   NFSMIADNMTKDSQKAERIIMKADKAGQDIAKIIDKVNPPGFIRAGSYGALFDWAAAIL
FT                   DFIGLKNWFWGRQFYTHLVPKPDPKKTA"
FT   CDS_pept        join(complement(124118..124135),complement(124026..124065),
FT                   complement(123864..123965),complement(123694..123813),
FT                   complement(121827..123646),complement(121052..121777),
FT                   complement(120658..120984),complement(120327..120599),
FT                   complement(120021..120263))
FT                   /codon_start=1
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805594"
FT                   /locus_tag="CNG00480"
FT                   /product="Coatomer alpha subunit, putative "
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="AAW44444.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG028843"
FT                   /db_xref="HOGENOM:HBG328393"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00004B4898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH7"
FT                   /transl_table=1
FT                   /translation="MQMLTKFESKSPRVKGIAFHPKQPLLAASLHNGTIQLWNYQMGTL
FT                   VDRYDEHDGPVRGICFHPTQPIFCSGGDDYKIKVWNYKQRKCLFTLTGHLDYVRTVFFH
FT                   REYPWIISASDDQTIRIWNWQSRTCIAILTGHNHYIMCAQFHPWDDLVISASMDLTVRV
FT                   WDISGLRKKNQASQAPMSAEEQIARASQGQADLFGNTDAVVKYVLEGHDRGVNWASFHP
FT                   TLPLIVSCGDDRQVKLWLMSETKAWEVDSCRGHFNNVSMTMFHPKHELILSASEDKTIR
FT                   AWDMTKRTAVQTFRREHDRFWVLTAHPELNLFAAGHDNGLIVFKLERERPPFSLSGNQL
FT                   FYIKDKVVRMADISSGNSQGICSVRKFGSQYIPPRTLSYNPAERAVIVTSPSDNGIYEL
FT                   ITLPKSTAPTAQDGRDVPSDGKKGTGFCALFVARNRFAVLDKGAQNIEIKDLSNSITKT
FT                   IKCPVQTSEIFYGGTASILLATPSSVVLFDIQQQKIVAEINTPPVKYVVWSTDGNMVAL
FT                   LSKHTITIANKSLSQSALIHETIRIKSAAWDDSGVLIYTTLNHIKYALSQGDNGIIKTL
FT                   EQPVYLTRVKGSVVHCLDRSAKPQAINIDPAEYRFKLALNRKNYDEVLHIIRNSNLVGQ
FT                   SIIGYLQKKGYPEIALHFVQDEQTRFDLAIECGNLAVALEMARAVDRHDVWERLGAAAL
FT                   QQGNHQIVETAYQKTRNFDKLSFLYLITGNTQKLNMMQVIAGKRGDNMSRFQNSLYLGD
FT                   VRSRVVVLRETGQYPLAYYTAKTNGLDDLALEILDEAGLTEDDLPPPPQNSGHSSLAPP
FT                   PITFSQSDSNWPLKDLGESFFDRALANGGVDALIGGEESGEQLDAWAADVPVEEDEGEE
FT                   QAADEDEGWDLDANVEVPDVEEEEFDGEDVLAEADLSQGVEPGASEDEIWQNNSALAID
FT                   HAAAGAFESAMLLLNKQVGVVNFEPLKPLFLQAYQHSHVYVPANASLPPLRLNVRRNPE
FT                   TAELRDALPAVPLNYNELKATEVADANKYFARGKFVEALATFKNVLSKLLLVVVESEED
FT                   AEEIKELVTSCREYIIGLTMEVERRRIAVQDPENVVRNLELAAYFTHCELATQHIQLAL
FT                   RSAMKVFSDAGNTATAAVFARRLIETQPGQAVITQARAVISRGQRNPRDAHEIAYDQNA
FT                   SFNICAATHTPIYEGSPYEESAYSGAKYLPEYKGTVCVVDGLSQVGLAGSGLRNMV"
FT   CDS_pept        join(complement(128308..128436),complement(128172..128261),
FT                   complement(127324..128120),complement(126794..127277),
FT                   complement(126405..126728),complement(124611..126359))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636346"
FT                   /locus_tag="CNG00490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44446.1"
FT                   /db_xref="HOGENOM:HBG068439"
FT                   /db_xref="HOGENOM:HBG177440"
FT                   /db_xref="UniParc:UPI00004B4899"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH6"
FT                   /transl_table=1
FT                   /translation="MSKSKPKASEPPPLVKRVPSGTPPTARKTSQPNLSAPSTPKFYDG
FT                   PTTPRSTSSQNVNQKVTVAANKTAAVAKTLPKRTVATAKRYPWGFFSLVSTIPFLIILS
FT                   LASTVLCPPPGPPSALNKFVLSPLGYPEHQSHPVLCYPANVYHREVLQPYIYPILDDLH
FT                   TKITTSAPYIDYVEPASRQAKQIGVKAWNGPIKPVVNRIRRGVRRFYLTFIQPHIPYFR
FT                   AKYHTFADPYTARISAFASPYVAKANVYANQTRDYVTKFYQYAASHPFTGHAGRYAHKG
FT                   YTISSEKGNQAYQWSKPYALRASVEAKRIATQVLGPRAVRGLEIGAQYISKTWKLFKAH
FT                   ACAQYRVYLEPHVGPYVEQASAFLAPYYALYHKHIHISYVQPVYQAVFPQTPEKPKSLL
FT                   SMLADWLPVTGLTAAESRGGMDDYFGDAEKSKREETREKLKIAKAETKAGPKGKAKSEP
FT                   KKVKEEVKEKPFDRKELDRAVKDLKVKINEEGKKGEAQVKEKIQDLQRDVLNHKLPQFA
FT                   TNMRSEIDREIEYVLKGLDKLYTQSTSLTRDQVKMSSGTSDNRVRKTVEKIQKRLDLLK
FT                   ERVYDERKPIVKDQSDKLDAILGNDYQALAAKMSSSDKTTVKDWDKYHEVRKVADSWKE
FT                   KYAKISEDPTLAKPFAELRLELDDIHEAFRTRIGILKRTAFDRIEAREAVEDSKKEEKE
FT                   KKEKNKEKKPEPGKVSILPVVGEAGAAAAGVAGAAGIIGKGKEQVMSALSAASGETTTA
FT                   GIVEQAKSSVDSILSVASSNVHDATRTIIKAAGGTPTPESPREHGESVYSAANVAVNSV
FT                   ISAASSSLHEATKSVSKAVGATPSPESPKEHIQSVYSAAQVGLQSLAGAASAVVHDATR
FT                   SASLAIGATPTPESLGETVEFVIAAASSAAHDASRVAVSAVGGTPSPESPAEHIESAYH
FT                   AATDSAASVASVITESAASVATDASSSVHSATRSALSAAGATPSPEYAKEYLESIAGVV
FT                   KQGVASIYDTAGSNVHDATRSMVKAAGGTPTPETPGEYAESVYNAASEGVIDAAEAVTE
FT                   QASRLATQIQEVLGAVSTQEPLASSASSYLSSLVSVGSSTAAEALSTGSSILSSLQKEA
FT                   SSSIHSATRSASSILGATPTPETAGEYVEDVKARAASARQAAESLVRKHAEQIKRDLER
FT                   DGKKVEDYSHGHGHKRGKETKDEL"
FT   CDS_pept        join(128761..128847,128903..129431,129483..130371,
FT                   130424..130600,130654..130829,130889..130913,1
FT                   30968..131085)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789024"
FT                   /locus_tag="CNG00500"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44448.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068438"
FT                   /db_xref="HOGENOM:HBG177441"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI00004B489A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH5"
FT                   /transl_table=1
FT                   /translation="MKYGKEFQQLLDSSDFPEEWKSSAIEYRRLKKIIKDVVAELTSMG
FT                   LSPDILNKLLVADNHSVVSDRRNSNSSGTPENELIEFEFESEEGSPSVFRSGRLPLHHE
FT                   PQEVLVDPVLDDDRYLSTDNLHHPHPHKFRLRLLSEASQDAEPCSMADLPTAQNLSQVT
FT                   SAYQNGPLNGRRGSEGSHKNRRVVKRAVSVGHGGIKAEYVVTGAPDHPVPQIRLHLSAL
FT                   TSHLPSPSPPPSFAESEIGTDTETEDEDPPIYSAPRTPRAFDRFCILSPNPSLNRINAA
FT                   KSPIWAIASSRNFDGLADLSLGEAAMEEETLPTPIQQSFKTPEGIPHSEREFIIPLSSD
FT                   FTFFSLLTTALTSLSSFHARQQILFQQSVEKLCEMISKSISPQASIEILPTPLTPSNEI
FT                   TPRMHPSKASRKDLYAWREIFTLWIEAQIFESNSERNRGERTVEEAELRLQKFANQVVK
FT                   RGLGDRRTMKGKKVREAWEEFLRLNVLLLDLKKFQSANIKAARKILKKHDKRTALTAST
FT                   GFQAFVRSTLTAQIDEDGNISTWVFYNTSLPHVLLASLTSTLLPILPSLDDYACLICTS
FT                   IAFKPIRLACGHLFCVRCLVKMQKAGKGKCPLCRSDVILLADKTCLDLTVMNFMKEWFP
FT                   KEVKAKQKENDEEIVKEQARETGMDTRCCIM"
FT   CDS_pept        join(complement(132991..133204),complement(132818..132939),
FT                   complement(132588..132755),complement(132344..132529))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093135"
FT                   /locus_tag="CNG00510"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44876.1"
FT                   /db_xref="HOGENOM:HBG068437"
FT                   /db_xref="HOGENOM:HBG177442"
FT                   /db_xref="UniParc:UPI00004B489B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH4"
FT                   /transl_table=1
FT                   /translation="MTNKTTKFVVNLASCVNHHIGSPQTGEFGTYLEMPSLLIVSGDFE
FT                   ATKQSNLLHHPSLISSVSYKMPRRNQPRQPASQASQPSQPSVSSSRQNDALQEFQARRV
FT                   QRRLDDLERTNPTDIPASSFVPAESSQTPAPGPLQQLPARKKQTANVRRILYNKKSLKD
FT                   WLDELPAEPVPPYLSAIAPAPSIPPRRICSSCGYFGAYKCSRCAEWSCDRVCMEVHERD
FT                   GGCGIGR"
FT   CDS_pept        join(complement(134703..135246),complement(134304..134602),
FT                   complement(133637..134248))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805595"
FT                   /locus_tag="CNG00520"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44875.1"
FT                   /db_xref="HOGENOM:HBG177443"
FT                   /db_xref="UniParc:UPI000042D5DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH3"
FT                   /transl_table=1
FT                   /translation="MTNVKTTESVVKEELPTTSQPLEPSQPSLTSIEIEPTDSAPNVPP
FT                   EPASYTFGTAAGSMNMATRRGARPALLSPHGMRSAQHGVSSTRGLLTPQPSSGFRHLPY
FT                   PSPAPLLTAPISPDSRCFNQSAPADAPATPLQPIQSGKAPNPYQVSLDEIPRSFVMKKL
FT                   VELAPKYWYSPESADCQIVVPTRRTHKVNKAECRPKMPQTAVPIGMSSASFNEQSQMAN
FT                   SNLSLAEQQATRAYWRPIPAGVSDGDLGIKPDVVTSSTTEGHMGASGRRGSLPGYNQVE
FT                   QCLVFPLHKDYLTTQSTLFHSLISSATAHVTTPTQRDQYGRLVWQSPIYRGAKVLPTKH
FT                   GRQRVLYVPLPDPSSFGVLLHWLYWHDAGHFNHCLSRGLATWQGVIRNIEYLGLDNEIK
FT                   LLAGKWWKRWVKPVEADERTNGVQSVSGSKKGKDTATDVEFDDDDEEEAGMDSGADGDD
FT                   EEIGSGVEIVTEDGFADRVSTQLSLS"
FT   CDS_pept        join(complement(138842..138986),complement(138603..138713),
FT                   complement(138368..138545),complement(138045..138123))
FT                   /codon_start=1
FT                   /gene_family="HOG000170196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942116"
FT                   /locus_tag="CNG00530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44450.1"
FT                   /db_xref="HOGENOM:HBG177444"
FT                   /db_xref="HOGENOM:HBG398231"
FT                   /db_xref="InterPro:IPR019721"
FT                   /db_xref="UniParc:UPI00004B489C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH2"
FT                   /transl_table=1
FT                   /translation="MPLKEVPRPYPLIDSDPHFSRVVRYMRPNDYALWAGAAAAGPGLL
FT                   WLYERVDPTRSNPASLRNALRLTGILGFFGGFLLAYQQSTFRFWGWRENAAEVQKDQTE
FT                   LSQRAREGKPLYGESQLDPYLQGVAARNSTWSQLKLHAFPWFNVANHNSHGVDTSKYTS
FT                   DSPNQPS"
FT   CDS_pept        join(complement(141543..142858),complement(139937..141494),
FT                   complement(139754..139883),complement(139616..139689))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942117"
FT                   /locus_tag="CNG00540"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44452.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068436"
FT                   /db_xref="HOGENOM:HBG177445"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00004B489D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH1"
FT                   /transl_table=1
FT                   /translation="MGSSQSQPSPNDRPNGNDGRPASRRTSSNPLRSFRRLSNIGRHAT
FT                   DTSSSQPVSDVGEEQKNNVEVEMERTGSGSGGKRMRQASTVGDTRLSGIERKKPRMGER
FT                   QESGPSSSRTWADREDEPMPSVSTSRTSWSTQPYPQSTSTPGQSATLSPTLSSDDSLSE
FT                   ERFQTLSTIRDTLGPEWPPADSPAAPVVERFLRRHSSQNVVGPTSSTLGTGVGVTAAGV
FT                   GGSTPGNHTVAEARINLQRAMSQARNLADRITSMSARLNAGLLASSSRDFHDPLISQPQ
FT                   PQSLSQHQLPPSTGAADEEVPSSAMEDLAARLREAREELAETERQLNETRERFESTTER
FT                   RRVPTGAVLIVQGLAQTHTFPDMEEAQNRDVNERERAQRNEEDVGFHTTLERDSEDRTS
FT                   SVRPRRASESRVGERVEAPSEDGEGVTLQQQANMISGLLTVAAAATATTLLAPGGNRPS
FT                   LASAVQPQRPSPSSTLESMLSRLRPNRPRQQTDQTVEASLGNYLRNVLRDNRVEGFTSP
FT                   NTTLGTTEISSTAASSPADPPPPSQDPAADAAEEAISSEFQTFLEGLQEELVDAVRAFA
FT                   GPLPEADEEASARDGEDVVRSMADASLDPSTSRADNISVSAGATSTQLTAVENPTSTSN
FT                   SIPTFHSQLGQNLPGVRREVPSVTGGRDGVPRRLNFFRVHTFPAISPITGRRIEGRQVS
FT                   EGGQNNGNEIQTEDDIARTASPQETAEQQTPTIGNNQSRAQPHTRAQTQDDEPLIPCIF
FT                   IGVRSIRHDPAMTTDDLVSHPQFPFVNGEVPPRPPTSEGEGEGTEENAGEEDSQEREGI
FT                   LRDHDQSHEEEQPATISTRQGRAASSPPERDRRSLRERFLSHLRRTTSPASPRTPPSGP
FT                   LNTYLVYVIGGNYPRSHPVLRMPSLIHGGAMTDEELQFVGDLLGSASNQTVEKEKLDNS
FT                   GLQVIKGKEMEDKGETGEVIDSCVEQCLVCLSGYDPEEDCRILGCRHAFHKDCVDQWLT
FT                   TGKNSCPACRTEAVDSKPSWTEENTATAAAGMDDVD"
FT   CDS_pept        join(145705..145911,145970..145989,146049..146463,
FT                   146520..146668,146736..146941,147002..147043,
FT                   147091..147149,147208..147306)
FT                   /codon_start=1
FT                   /gene_family="HOG000204319" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093136"
FT                   /locus_tag="CNG00550"
FT                   /product="Arginase, putative"
FT                   /EC_number="3.5.3.1"
FT                   /function="arginase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="arginine metabolic process "
FT                   /protein_id="AAW44454.1"
FT                   /db_xref="GO:0004053"
FT                   /db_xref="GO:0006525"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG311682"
FT                   /db_xref="HOGENOM:HBG391953"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniParc:UPI00004B489E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEH0"
FT                   /transl_table=1
FT                   /translation="MLSRVSPSLRQVLAAPLRASRMGTSPMQKAFTHSSAPRNHHITAQ
FT                   PSSEKGLTSPTYNYKFLNEPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISALG
FT                   WNVHYESHQNFLDIPYNPLPSSSPVTSTEGPSTHTTTAQGEKMVQRLPDPDIGSMKKPR
FT                   LVSAVNEMVAKEVGDIAEKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADIN
FT                   TPLTTESGNLHGCPVSFLLGLDGCDVEPFNKWLKPCLKPEDIVYIGLRDIDDAEKKILK
FT                   ENNIKTFTMHHVDRHGIGKVMELALQHINPNGDRPLHLSFDVDALDPTVAPSTGTPVRG
FT                   GLTFREGHYITEVVAETGCLVALDIMEVNPSLLDPRSVEMTVAAGCSLTRASLGETLL"
FT   CDS_pept        join(147689..148051,148102..148355,148416..148500,
FT                   148567..148683,148747..149024,149080..149119)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093137"
FT                   /locus_tag="CNG00560"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="AAW44456.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG068435"
FT                   /db_xref="HOGENOM:HBG177446"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="UniParc:UPI00004B489F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG9"
FT                   /transl_table=1
FT                   /translation="MTLIRTSRLALSRGSRATFVSRSLQTSSSVHPLYPDLPVYSYSIG
FT                   LSYAAKYSPPFINPKQDIKPYGFAKQSNDVGKWVQQMLELTAGRGDLKASEEDLAEARR
FT                   RWGAGEDFFGITNARGDLHIAVSDGVGGWSDRVDASLFPQLLCYHYAKAAQELANSSTG
FT                   SVDPRSIMKKAYEDALKDKNVSAGGATMVSARLDEDGQGIFANLGDSGYFILRGDEILE
FT                   FSQAQTHFFNCPTQLSKVPPEMKHQGIVHDTPDMADTKSFELQAGDVIALFTDGFSDNV
FT                   PPSHIPGLSKLLNRILEDPTNKDLSPAERDSERARLFADMLVGYGRTAMTKTGEEKGPN
FT                   GWKTPFEEEATKKVPKWGWKGGKIDDITVVTAVVSELD"
FT   CDS_pept        join(149887..150046,150121..150197,150249..150311,
FT                   150369..150447,150504..150784,150840..150951,
FT                   151002..151180,151233..151429,151493..151910)
FT                   /codon_start=1
FT                   /gene_family="HOG000223743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636347"
FT                   /locus_tag="CNG00570"
FT                   /product="Protein biosynthesis-related protein, putative "
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /protein_id="AAW44458.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG000745"
FT                   /db_xref="HOGENOM:HBG395951"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniParc:UPI00004B48A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG8"
FT                   /transl_table=1
FT                   /translation="MIALLRWGIARPSAPLRWSRCFATSTEKGDEGWQTVIGLEIHAQI
FT                   KTGKKLFSKASTSYGHVPNTNVDVHDAAFPGTLPVLDINAIRLSIMTALALNCQINPRS
FT                   TFDRKHYFYHDIPASYQITQHYNPLAWNGHLEIREGDNGSKRTFNIGIKQLQVEQDTAK
FT                   SQTVGDAVLVDLNRAGTGLMEIVTDPDMRSPEEAGAFVKKLQGLLRRVGSADGDMEKGN
FT                   LRVDVNVSVHRPGMPFGTRCEIKNINSVRFLQAAIESERQRHIAHYCTSPLEPLAQETR
FT                   GFNELTLQTYSLRSKEEATDYRYMPDHNLPAIIIDDGYLDSLWKNLPEMPWQSVERLVK
FT                   TYGVTKRDAETLLGLDEYSAQGIAYFEEVVEQDKKIAKKATNWIAHELLGQLGKAIRPW
FT                   TPTIVPAPLMHELVTAVESREITGTTGKAIVKHFVSLPESASLPPSFAELLAELGLTPS
FT                   AASVEDLTETCKKAMNNQPKAVADFKKGNEKVVMRLVGEVMKLSGGKADAMKAKDILLD
FT                   LLKD"
FT   CDS_pept        join(complement(154480..154594),complement(154163..154412),
FT                   complement(154015..154110),complement(153058..153954),
FT                   complement(152930..153000),complement(152840..152878),
FT                   complement(152730..152790),complement(152637..152679),
FT                   complement(152524..152591),complement(152440..152459),
FT                   complement(152291..152383),complement(152056..152216))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805596"
FT                   /locus_tag="CNG00580"
FT                   /product="Expressed protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44460.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG068434"
FT                   /db_xref="HOGENOM:HBG177447"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniParc:UPI00004B48A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG7"
FT                   /transl_table=1
FT                   /translation="MPSAHYRSPTIQVFSDSEDEDMGKAGNLNNQKRSPKDLQPSRPLI
FT                   NFSNNVPLTPRRTVAFAPTPLKRLNFSTAKIKGTPGKKIPGMKFVKSPAPNKSSFGDLE
FT                   DEDDDGGVDDDVVGTLGFHSLKIETETVTGRDFEDELVENMNEINDVLDSPSMSRTSTT
FT                   STAHISPPPVLKFSSPSAFAHKNLSNKTPPSPPAESESESDWVPTRTPKRTPGKARRVI
FT                   ASDSEEDEELAGPEIQAKFQKIKQVIDLTLSDGEEIAPIVDEENGGYYGPDDSYGSLRD
FT                   FIVDDSEGENYIEAPTTEEEESDVEIWEPTKKTKEIKAVEMKGSDAQSPEEDPEERGWD
FT                   SSSDAGILRYSPPRRPLNLPPLEMLTLTVNADSEPHQDESLTKKVIDKSKTSKLKDGLS
FT                   KKEWALQRVRVANEIFDDLDRRVFESKLGERGAKARLQWNNRLLTTAGMARSKRTMRND
FT                   VSSKEYWIELSEKVLTSEERILNTVAHEMCHLATWIISGDFKNPHGHIFKSWGRKVMHA
FT                   RKDVEVTTKHSYVIEYKYQWKCANERCGQVYKRQSKSIDTSEHACGSCRSKLNPLFETR
FT                   QKAASGFQLYLKENMKSAKAAMPGASHGDVMRALSKRWAEAGEMINSGHEVYWQGMAAK
FT                   NH"
FT   CDS_pept        join(156478..156731,156807..159089,159138..159666)
FT                   /codon_start=1
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805597"
FT                   /locus_tag="CNG00590"
FT                   /product="Folic acid and derivative metabolism-related
FT                   protein, putative"
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="AAW44462.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG181856"
FT                   /db_xref="HOGENOM:HBG677721"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI00004B48A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG6"
FT                   /transl_table=1
FT                   /translation="MRISRPLGQLNLYARTSPRISFPLPSARVISAPLRQSLPPPRLRV
FT                   NTPLASRSFSISSTHLAKMSADVEMTSQSAKIIDGTAIAKQIRTSISQAITDLHASNPT
FT                   FHQPHLVIFQLGSSAASSTYIRMKLKAAEESGMTVEHIKIPSDEESGALKGTGVKRVLE
FT                   AVKKANQDEKVSGILVQLPLEGAGKAEEKAVVDSVDVTKDVDGFHPENIGLLSSRISEP
FT                   FFTPCTPAGAIKLIESTGFNLAGSNVVVLGRSDIVGTPVCALLRKKDATVTQCHSRTKN
FT                   VERIISQADVIVAAIGQAEFVRGEWLKPGAIVIDVGTNYIPDASKKSGQRLVGDVHFES
FT                   ASKVASYITPVPGGVGPMTVAMLMNNTFEAAKRQWSSRRAKQLIPLPLEIKEKVPSDIE
FT                   IAVAQTPKPVAEIAEEIGVHPDEVESYGRYKAKIELSVLDRLKERKDGKYIVVAGITPT
FT                   PLGEGKSTTTIGLAQALGAHLHKTAIACVRQPSQGPTFGIKGGAAGGGYSQVIPMTEFN
FT                   LHLTGDIHAITAANNLLAAAIDARMFHEATQTDKGLFNRLCPPKKGVRTFSKPMIARLH
FT                   KLGINKTNPSDLTEEEAARFARLDIDPATLTWNRVLDTNDRYLRQITVGQAPTEKGLER
FT                   KTAFDIAVASECMAVLALSKDLADMRARLGRMVVASSKAGEPITAEDIGCAGAMAVLMK
FT                   DAIKPTIMQTLEGTPVFVHAGPFANIAHGNSSIIADRIALKLAGVEEGDDESRNGYVIT
FT                   EAGFGADIGMEKFCNIKTRVSGLKPSAVVLVATIRALKMHGGGPAVTPGKPLDQVYVEE
FT                   NLELLEKGCANLGKHIENAKKFGLKVVVAINKFSNDTAAEMALVQEYALKVGADYAVPA
FT                   DHWARGGAGAVDLANAVIEACATPSTFDFLYDLNQPLTKKIEIIAKEMYGADGISLSAE
FT                   AQAEIDRYEKQGYGGLPICMAKTALSLSDDPSKKGVPTGFTLPIRNVRLSAGASFVYPL
FT                   VGDMSTMPGLTTRPGFYDIDLNPDTGEIEGLF"
FT   CDS_pept        join(complement(161282..161699),complement(161038..161169),
FT                   complement(160326..160977),complement(160201..160267))
FT                   /codon_start=1
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581873"
FT                   /locus_tag="CNG00600"
FT                   /product="Mannitol-1-phosphate dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44464.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B48A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG5"
FT                   /transl_table=1
FT                   /translation="MMTISSRRISTFTTALKSIVTRLPPNSTHIRPISTRLSAPFLHHP
FT                   SISATTSRIIHTTRANMSTLSNFTIPKTQIAAVVKTTGAELAIDKEHPVKQASELRPGE
FT                   CLVKISHTGVCHTDLHAKSGDWPIPPSHPLIGGHEGVGTIVAIGDHTAASPVKLGDRVG
FT                   IKWLADSCLSCELCRRGYEMNCPNVKLSGYTTDGTFSEYVVSFVNHVTPIPESLDSAGA
FT                   ASILCAGVTTYKALKVSNTKVGDWVALPGAGGGLGHLAVQYAKAMGLKVVAIDTGAAKE
FT                   KLVKSLGADAWVDFKTSKDIVADIKAATGGDGPAAAVVTAANKTGYSQAIEYLKPSGTL
FT                   VAVGMPDAEMGANVFWTVFKSIRIQGSYVGNRQDAIEALDIAASGHVRVVFEEKGLESL
FT                   KDVYEDLEAGKIAGRVVLKVSDE"
FT   CDS_pept        join(complement(161282..161699),complement(161038..161169),
FT                   complement(160322..160977))
FT                   /codon_start=1
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581873"
FT                   /locus_tag="CNG00600"
FT                   /product="Mannitol-1-phosphate dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44465.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B48A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG5"
FT                   /transl_table=1
FT                   /translation="MMTISSRRISTFTTALKSIVTRLPPNSTHIRPISTRLSAPFLHHP
FT                   SISATTSRIIHTTRANMSTLSNFTIPKTQIAAVVKTTGAELAIDKEHPVKQASELRPGE
FT                   CLVKISHTGVCHTDLHAKSGDWPIPPSHPLIGGHEGVGTIVAIGDHTAASPVKLGDRVG
FT                   IKWLADSCLSCELCRRGYEMNCPNVKLSGYTTDGTFSEYVVSFVNHVTPIPESLDSAGA
FT                   ASILCAGVTTYKALKVSNTKVGDWVALPGAGGGLGHLAVQYAKAMGLKVVAIDTGAAKE
FT                   KLVKSLGADAWVDFKTSKDIVADIKAATGGDGPAAAVVTAANKTGYSQAIEYLKPSGTL
FT                   VAVGMPDAEMGANVFWTVFKSIRIQGSYVGNRQDAIEALDIAASGHVRVVFEEKGLESL
FT                   KE"
FT   CDS_pept        join(complement(167277..167293),complement(167054..167206),
FT                   complement(166913..167003),complement(164183..166855),
FT                   complement(163960..164078),complement(163732..163885),
FT                   complement(163449..163676),complement(163280..163388),
FT                   complement(163194..163217),complement(162937..163108),
FT                   complement(162842..162857))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789025"
FT                   /locus_tag="CNG00610"
FT                   /product="1-phosphatidylinositol 4-kinase, putative "
FT                   /function="binding"
FT                   /function="inositol or phosphatidylinositol kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="phosphatidylinositol phosphorylation "
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /protein_id="AAW44467.1"
FT                   /db_xref="GO:0004428"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0046854"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG068432"
FT                   /db_xref="HOGENOM:HBG177449"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI00004B48A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG3"
FT                   /transl_table=1
FT                   /translation="MSHALLLRLFLSPYFSISIAMQYLKTYPDSIGISHYLCWRMKRMP
FT                   AEEVEFYWPQICHLLLTYPTQSNALESFIIARAEESTHSAMLTFWFMQAALRDLIPTRQ
FT                   TDPVPFAICQRVLHRCHAIIFGDPPESSRSPYRSLPHSPSTSALGVLSSLSGSGSNSTG
FT                   IQIDEGQRQGQRFGQGRVNSHAAAALVGMGVMFAGIPGMPALVPLVGEWALIQGRRPMD
FT                   DLTSGRDRVEVDTGGGADVRPENVERRRKENENEKEEKEDDSESEEEDGRAQSNENTQG
FT                   QGYKSNVKFAKSTVNLAITGPAQTAPNLYSPPRSPSALTPFSVIDMPDEKEREKEKNGG
FT                   ISRRKGSDPFGQLFNDRSPTPPKSVHQPFHSVPSLPRSSSYNPYHYSGGPPTAEAILAT
FT                   YSLSAQRQLLTSHYCRSEVRFLLLLEDISNRLLVIPKPARVSALRAELTSLNHNLPAEV
FT                   CMPLWCTADHTLSPSSSSSTLSPSPSSGSNNPSSSAKNRAYHPRGSAVPGGHSRVVRIS
FT                   PGDSVVLNSAERAPYLLHVEILQGDLDFDPTRRENRELLKKIVVAEDRKRRKRDGTLGV
FT                   DGNGREAGAGARVRNGGYSNCRQEWGLGSKKGKGKGEGFGSLMPDSIPAIPPSPVPAPV
FT                   ANSSKPPSQTPLSTTAATTTTAGTPQPTPPEEVDLVEQLYGTLSIHDEIPDLSEIIPLP
FT                   SGPKNRDLDMKAWDRGSPVPGRITSSGVSVGASAGIGAGAMGDVGQYATSPTGTATGSE
FT                   IGKSGPSTPGFPSVKSGFTSPSPSSSSAFTPGLVQAQGQSPSTPGPKRAITLEDYSERM
FT                   RTAAVMLAQLNASLIPNAPENQSGGGWIPGTGWIRTPGGGGGGGGEETGGKPDGSAGGK
FT                   LKLAAAQAAAIRERIMLEMMALEEERVERMTDRPPGADIHIPTAETSGGGEGGYEHDHE
FT                   HGTAEDEGIVRRELNKADPSAAVFRESWSAKKSRIRAGSPWGHLANWDVISVIVKTGAD
FT                   LRQEQLATQLIERFSRIWKEENCDCWARFFRILITGETSGLVETVTDAVSVHSIKKGEY
FT                   AKRLAEGGPIGHVSLMDHYVNTFGKPDSGRFARAQRNFIRSLAGYSIITYLLQIKDRHN
FT                   GNILVDQDGHLIHIDFGFMLSNSPGNMGFEAAPFKMLMEYVDIMGGLDSPGYAYFKKLF
FT                   KEGFEAARKHSDSLITIVELMQKNSKLDCFALFGDQTAAHFRERFQLGLTTQAVDAYLE
FT                   RLIVTSTGSNYTKLYDTFQYYSQGVL"
FT   CDS_pept        join(complement(171905..172227),complement(171424..171845),
FT                   complement(171120..171371),complement(170667..171058),
FT                   complement(170354..170519),complement(170172..170262),
FT                   complement(170025..170119),complement(169883..169952),
FT                   complement(169364..169819),complement(168966..169311))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942118"
FT                   /gene_name="JHD1"
FT                   /locus_tag="CNG00620"
FT                   /product="JmjC domain-containing histone demethylation
FT                   protein 1"
FT                   /EC_number="1.14.11.27"
FT                   /function="histone demethylase activity (H3-K36 specific) "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44468.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0051864"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177450"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniParc:UPI00004B48A6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55NZ6"
FT                   /transl_table=1
FT                   /translation="MSEQVGQREAVDSPQATGVKTPPEPCPLCRETGPPQPPSITEEGK
FT                   TNEDIDFIWVACNKCDEWYHSACLFLGDEKWRGTIPKEIISTVETNFGDEGAWTNWVEW
FT                   IGKWYCAPCLARSTSPSNPRPPRHPLVATMKRASIQPKDIDQAGKPLKRSASTSAPLLK
FT                   SNIKRPRTSTKGQETASPEIDMKSEREQQAESTAGTPASDAPQGRPKRKTAQIDYRNLN
FT                   NSIATPTHQWLELIADPEKYGRTILDANYPALPGKLLTRAWLESQPLPGQPSSISPDLL
FT                   PTRFWGPDREPLIVRPENGGFSSLGGHLPSKDLTVQDVANLVGPDRMVDVIDVSSQHSS
FT                   QWTLQKWAEYIQSSSGNTSVRNPKVYNVISLEISGTELAKKVKPPKIVREIDWVDNFWR
FT                   FNAGAGGKDVKEKGRGNDSREGSEIRKEGSHLTEGDNGGEIEEDLEGLKEKTNTPYPKV
FT                   QLYCLDWHVDFAASSVYYTIHSGAKVKLSCFVSFFSPGSYHSQVFFFVKPTEQNLKAYA
FT                   EWSGSYEKQQDTWLGDMVDEVRKVELHAGDTMIIPTGYIHAVYTPMDSIVFGGNFLHSY
FT                   NVDTQLRLRQIEIDTKVPQRFRFPMFDRLCWYVAEKYCSDLRHLRAYRPRATTTPKPPH
FT                   FRVLQCLSYLANFLVSQTGILEDPEAEDKARKLVHDRIPGDIVKDPEGLAKELKWRVER
FT                   ELGALGLLGEEASGVEAEEFKSNGTANGSVKIKGKEVSRKRDRLSKVFDKKAISRTWDF
FT                   HPPAWSENRQSPQIETTTVQLPRPSTSSSDAISGSGPGASPGASANGGANENEQAELTT
FT                   MLVKQTRKRMRELDDGTVIEESQETTFVEKKTIWGPKLDKEKISQPQGKVEEDMDIDH"
FT   CDS_pept        join(complement(173503..173610),complement(173279..173429),
FT                   complement(172583..173217))
FT                   /codon_start=1
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636348"
FT                   /locus_tag="CNG00630"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAW44469.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG002633"
FT                   /db_xref="HOGENOM:HBG532399"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B48A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG1"
FT                   /transl_table=1
FT                   /translation="MKVFLTGASGYIGSHVTALLLEAGHQLTAIARSDASAKKLERQGV
FT                   TVILASLEDTEVLTKAASEADAVIHLAYIHDFSDYGGKPAQIDYAAIRALASGLKGTNK
FT                   PLVTTSGIPSPGIRICTELDVGKYGPRAEAENVLFEYTSQGVRTAVIRLPFTVHGDFDK
FT                   GFIPLIIDQSRQKGVAAYVGKGDNHWPAVHVKDAAQLYKAVIESKTLEGGKILHGVQDE
FT                   GIPFKQIAEIIGKKLGVETKSVADEKVGEYYSWLGMFVKMDFIGSSKLTREWLGWEPKE
FT                   QGLLADLESSQTYFKE"
FT   CDS_pept        join(complement(175700..175807),complement(175496..175646),
FT                   complement(174781..175427))
FT                   /codon_start=1
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805599"
FT                   /locus_tag="CNG00640"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="AAW44471.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG002633"
FT                   /db_xref="HOGENOM:HBG532399"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000042FBD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEG0"
FT                   /transl_table=1
FT                   /translation="MKVFLTGATGYIGSHLTSILLSAGHDLSALARSDVGAEKLEKQGI
FT                   SVVRGSLEDVDILTKAASEADAVIHLAYIHDFGNHDGTPIRVDNAAIRALAEGLKGTDK
FT                   PLLTTSALPFGTPYATELDPATFGPRAQAERTLLEYTSQGVRTGIVRLPNVHGDNDKAF
FT                   VPHVIAQSRKNGVAAYVGEGKTHWAAVHVKDAVQVYKLAIESKILKGGEVLHAVHDEGV
FT                   ESKKLMELIANKIGVETKSIMPEEAATFYTFLGPFVQADITGTSTLTRERLGWEPKEKT
FT                   LLEDLETSETYFATGSGSKY"
FT   CDS_pept        join(176344..176579,176638..176913,176962..177329,
FT                   177376..178465,178553..179318)
FT                   /codon_start=1
FT                   /gene_family="HOG000138269" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581874"
FT                   /locus_tag="CNG00650"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44474.1"
FT                   /db_xref="HOGENOM:HBG068430"
FT                   /db_xref="HOGENOM:HBG177451"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00004B48A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF9"
FT                   /transl_table=1
FT                   /translation="MQPAPSSHRHFSNGSISPHTSLHGHEELEFEDDFDYLSVATPSRP
FT                   NASKRAAPNKGKAVETTKWKGKGKARNGIPGGECYLLKLPGDLLHTLMSCLSPRTLLRF
FT                   SETCKLLNEQTENDTVWRHSYVNRFLGEGVARDSRRREEIVVLAQSCVNAAGRGWKKEA
FT                   LGREVMLDLWTNSKTSIVMHTPPTGLIHSISLYYPPFLPSNSKSLVIGKNRQSTPKDKV
FT                   AYTSKLGEDGDNVLQPTTPKITHRQKYEAVLAATTRPPPYMLSASLFMGGVVRSDPISG
FT                   KVSKGFWGPGRDANFHIRPHIDPLAEPSAIYLPSRSQSFILWGLQTGSVVFTSVQTRNH
FT                   ATHGGRATSVNVYSDPRKSHEGFVVDIWAPQGQNDTALKWITAGQDGRVKLWELQSGTI
FT                   TKVGKRQASLVDGNIDCVFTSPLAETGFPNRSELVKRRQAGKPDEIVLARYDLQHDIVA
FT                   GVTEDGDLRVWFEASSGNENEVRIDLGSAEIEGEIKVMEMIGYRHQDEVAVAVLIHRRR
FT                   SHILMRHDISKSGNHHITTFYSSVGAPLSCIHPSLFPNLPISAPKHGNSTPMLARIVTP
FT                   GETPDPSPPPLDLPSGGFSSSSTHSEPEYGRYVLAGDEAGFVHLWAWNGEDNERKTIRS
FT                   WEAMEGKITALDMSCGLVAVGSFDGFVKIYDPLPTPPKLLRTFHASHLSPGELLVAGSD
FT                   QPDARFYTVNKIILENDMVVASIGRKVFAWRAGAGKGKHGGKEGKKGGIGKGEGRGGTR
FT                   GIGTSPFPTLPRAVKVPFPRVLIKSVSLVMKALHQAAEEDFAEFAPHAATPRQRLTNPH
FT                   ETLEREAMQEMGLEDGDDALQYALMLSMEEQSHASPPHNDLLNEEPSVSGWVEDEDEEE
FT                   NVDDETAEAIRQVEAFKKAEQENELARMLEMIKQAEKKEG"
FT   CDS_pept        join(176344..176579,176638..176913,176962..177329,
FT                   177376..178465,178553..178848,178927..179318)
FT                   /codon_start=1
FT                   /gene_family="HOG000138269" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581874"
FT                   /locus_tag="CNG00650"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44473.1"
FT                   /db_xref="HOGENOM:HBG068430"
FT                   /db_xref="HOGENOM:HBG177451"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00004B48A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF9"
FT                   /transl_table=1
FT                   /translation="MQPAPSSHRHFSNGSISPHTSLHGHEELEFEDDFDYLSVATPSRP
FT                   NASKRAAPNKGKAVETTKWKGKGKARNGIPGGECYLLKLPGDLLHTLMSCLSPRTLLRF
FT                   SETCKLLNEQTENDTVWRHSYVNRFLGEGVARDSRRREEIVVLAQSCVNAAGRGWKKEA
FT                   LGREVMLDLWTNSKTSIVMHTPPTGLIHSISLYYPPFLPSNSKSLVIGKNRQSTPKDKV
FT                   AYTSKLGEDGDNVLQPTTPKITHRQKYEAVLAATTRPPPYMLSASLFMGGVVRSDPISG
FT                   KVSKGFWGPGRDANFHIRPHIDPLAEPSAIYLPSRSQSFILWGLQTGSVVFTSVQTRNH
FT                   ATHGGRATSVNVYSDPRKSHEGFVVDIWAPQGQNDTALKWITAGQDGRVKLWELQSGTI
FT                   TKVGKRQASLVDGNIDCVFTSPLAETGFPNRSELVKRRQAGKPDEIVLARYDLQHDIVA
FT                   GVTEDGDLRVWFEASSGNENEVRIDLGSAEIEGEIKVMEMIGYRHQDEVAVAVLIHRRR
FT                   SHILMRHDISKSGNHHITTFYSSVGAPLSCIHPSLFPNLPISAPKHGNSTPMLARIVTP
FT                   GETPDPSPPPLDLPSGGFSSSSTHSEPEYGRYVLAGDEAGFVHLWAWNGEDNERKTIRS
FT                   WEAMEGKITALDMSCGLVAVGSFDGFVKIYDPLPTPPKLLRTFHASHLSPGELLVAGSD
FT                   QPDARFYTVNKIILENDMVVASIGRKVFAWRAGAGKGKHGGKEGKKGGIGKGEGRGGTR
FT                   GIVMKALHQAAEEDFAEFAPHAATPRQRLTNPHETLEREAMQEMGLEDGDDALQYALML
FT                   SMEEQSHASPPHNDLLNEEPSVSGWVEDEDEEENVDDETAEAIRQVEAFKKAEQENELA
FT                   RMLEMIKQAEKKEG"
FT   CDS_pept        join(complement(183724..183753),complement(183439..183669),
FT                   complement(183197..183390),complement(182917..183148),
FT                   complement(182639..182866),complement(182169..182585),
FT                   complement(181926..182112),complement(181731..181870),
FT                   complement(180894..181673),complement(180405..180834),
FT                   complement(180163..180343),complement(179955..180096))
FT                   /codon_start=1
FT                   /gene_family="HOG000170596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805601"
FT                   /locus_tag="CNG00660"
FT                   /product="Vesicle-mediated transport-related protein,
FT                   putative"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="AAW44476.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG315674"
FT                   /db_xref="HOGENOM:HBG354594"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI00004B48AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF7"
FT                   /transl_table=1
FT                   /translation="MATQMRGLTQYISDLRACRVRELEEKRINREMAHIRQKFKDGNLD
FT                   GYQKKKYLAKVVFTYILGYKVDVGHMEAINLISSQKYSEKQIGYLALTLLMHENSDLAR
FT                   LVINSLHKDLEDQNEVNNCLALHAIATLGGKEMAEALAESVYRSMISATSSTFVKKKAA
FT                   LTLLRLYRKHPSVMPIKEWAARIVSMMGDRDPGVVLTITALVTTMAQAELEAFSGSYQK
FT                   AVDILDRIVFEGHYPAEYVYYKVPNPWLQTKLLRLLQYYPPPGTYFFSPIQNPADNYLD
FT                   NPQVVEMVNSIIQAIIDSSQDTPRNVQHNNAQNAVLFESINLAIHIDPSSQVVQNASVL
FT                   LGRFILAKETNVRYLGLDAMAHLAATSNSLGAVKKHQNVIIQGLKDRDISVRRRALDLL
FT                   YSMCDTSNAKVIVGELVRYLQVADYNLREDMVLKIAILTERFATEYEWYVDTILQLIAA
FT                   AGDHVGAEVWYRVVQLVVNNEGVQDYAVRAVYKHLQATACHENMIRVGGYIMGEFGHLI
FT                   ANDPGSSPIEQFQALHSKVNLCTAPTRALLLSTYIKWVNLFPEIKEHLINIFERYTHVL
FT                   DAELQQRACEYLALARRSESDDLLATICDEMPVFPERESALLSRLHRKGEMAQDKRTWV
FT                   IGGREENNLREAERFKAFRKGTGDSGGIVSGSPAPASTAPSPAATAGTSAVTPSPAPDS
FT                   YSAPQRHASVNTETMMGVASSGPSEDIISSLSDLDLTGSHVQNQPLLTSAPTGAYSQEL
FT                   AGLQMQPTGAGGAPLLNGQADGSNGINGMNGDRGLAYSATLGGVNPALLAPLTVADGVE
FT                   KWFERLSFSNEGVLYEDTLIQIGVKAEYHGHLGRIALFFGNKADQPFTSFSALIDNPSP
FT                   SAINIHFHDSPVGEVRAKAQIQEMIHVECREVFFREGGTPLLRLSFLVGEERKILVLKL
FT                   PVFLSKFAEGVHLESGPFFERWKIIGGPPREAQQIFPIKLTANGMVDIGRNQRVITGNK
FT                   LSVLPDIDHKPENIVFAGVLHMSSAGKVGILGRVEPNKDAKLCRLTVRSTNEHVSAEIL
FT                   SLTSKPLNADIAASL"
FT   CDS_pept        join(184192..184436,184503..184535,184589..184835,
FT                   184885..185181,185232..185335,185389..185424,
FT                   185469..185565,185618..186051,186105..187146)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805602"
FT                   /locus_tag="CNG00670"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44478.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068429"
FT                   /db_xref="HOGENOM:HBG177452"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00004B48AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF6"
FT                   /transl_table=1
FT                   /translation="MAKAKTTKQKTVPKAPPTITPPDPAHAIAHVPTHTTDEKREQQAS
FT                   SKGSVTTPAEVEEDVCFICAEPITFWSAGVCGHKTCHVCAVRLRTFYKKTDCTFCKTPL
FT                   PTVLFSRSPDTPFPNESHLEPSPPNVIAKAQEEAKKGERWDKGLTLPGTLDLGAFPYVD
FT                   EKLGVVFEDEDMMESILTLLRFNCPYPECSFQAVNWPSLERHTLSTHGKVICALCRSQL
FT                   SRFAHEQVLYTPHLLPLHDPSRLKRGQRPPKPRGPKEEEEVKSWEAPHPMCEFCHKAFF
FT                   GPDELFKHMRSDHEECHVCREQGNRHVYFENYHKLEQHWRDEHYPCTQPQCIEDRFVVF
FT                   GSELDLRAHMMEVHGNQMSARDRANARHLPVDFNIPSSGARGANHSGGGRGFSLGQSSV
FT                   PGAGRDSSAPSRMRANDSPHVQALDDTPAMTPAQIAQQRRQIQADRAESVAAGQNMGRR
FT                   RGFATGLSREGEAAPSPASMSAPASGYNTPREDVDEATASRHAELLSRVSMLTNDSATK
FT                   LASFRSAVRSFKSNESGARDMVDSIFNVFERDLDVTVGIAREVAKLFGAEGDKDKEKDL
FT                   IEALNTLRVEQRDQFPSLGSAPSGLGTNWSGVASGTILNAKRATRTSGTNRAVWDRVEA
FT                   AAASQPVNKPRATTGVGGRWVPGAGGSRAQLTSESAFPTLGAASSSAGPSRAAGSSSST
FT                   SSGAYATPWAAGGAGPSSRTPSALAGPQIRSVHNPAAATTKKSKALSSAAFPALPASSG
FT                   SRTMTAEERKALFSKPTPREESIRRITGQANAPPPLNNWTAGSNNGRGEEDAMEGLSLE
FT                   NQTTMRGQGQQQGAGKKKGKQKQLLFSVSARP"
FT   CDS_pept        join(complement(188729..188756),complement(188310..188639),
FT                   complement(187982..188187),complement(187346..187927))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805603"
FT                   /locus_tag="CNG00680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44480.1"
FT                   /db_xref="HOGENOM:HBG177453"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniParc:UPI00004B48AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF5"
FT                   /transl_table=1
FT                   /translation="MGSRHAWPENYLNYPGREVTYRIWSKAQKRGYSAQPQSRHKERRR
FT                   QLTTIQVSKAAPPHYSTGPAAPSSSLHQCWPSEEISLTSLIKIAAGVPDIRMMSYKCLL
FT                   METQSGGHLIPLAFHRSCAQYAAFKMRIHLPLDPIQFNVTPTNASSPPLAQLGGNLVLV
FT                   ELQGELTWEGEKSNGVVGVLGLDTPDKPTLHLGPHHLLHGKFANLQKPYVVIRRVTGDL
FT                   LANGGKAEDAERIKGIAVQGDAVDEESSDEEEEEDDEEGPLFEKDEDAETTPTEDREAP
FT                   GSSSPFYPPSTPKDYSSDIEMSSPAQSQIDDFGFPKRGREQDQDEDEEDISTERRKRRK
FT                   LEDAKEKEKRERRKKRQGRKERTRHYAVVGIVRKKVVFALR"
FT   CDS_pept        join(189265..189343,189384..189475,189538..189674,
FT                   189734..189851,189905..189985,190040..190111,
FT                   190166..190234,190287..190400,190455..190694,
FT                   190748..190927,190987..191199,191252..191282,
FT                   191348..191692,191744..191760,191821..192108)
FT                   /codon_start=1
FT                   /gene_family="HOG000215465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093138"
FT                   /locus_tag="CNG00690"
FT                   /product="Trehalase, putative"
FT                   /function="alpha,alpha-trehalase activity"
FT                   /biological_process="trehalose metabolic process "
FT                   /protein_id="AAW44482.1"
FT                   /db_xref="GO:0004555"
FT                   /db_xref="GO:0005991"
FT                   /db_xref="HOGENOM:HBG177454"
FT                   /db_xref="HOGENOM:HBG738237"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI00004B48AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF4"
FT                   /transl_table=1
FT                   /translation="MILSGNGLTSKTDICRQGIVHLVILGAKTLNETLSAWEALGDNVT
FT                   VGDVETFVEQYFKGEGLELSQVELENFVEDPAILDNITDPVFRAWVKIVNGYWTLLARE
FT                   TNQSALCNGDCESSLIPLNHTVIVPGGRYREIYYWDSFWVLEGLLKSELYDYAWDLLQN
FT                   FMDLIDIYGYLPNGGRKYYLNRSQPPVFVQMIDAYIKATNSITLLERALPVASSELEWW
FT                   ANNRTSNFTSPFTNQSRTIAQYSVTNSAPRPEGYVEDFETVMGASPALNETEQAELYSE
FT                   LATGAESGWDYSSRWCEQPLLNTTDNNPSLRTLKVKSIIPVDLLSLMAGDHALLANLYE
FT                   LYANSTGGGEGTGNEEMSKRDGESDDAASKIAYHRQMAQEFSDSILDLCWDPEKSWFYD
FT                   FNVTSNSRSNIFHAGGTWPLWQNITPSEIMGNESAALSLVSGFRFLLGHYSGVPSVATL
FT                   LFTGLNWDFPNAWPPHAYTAIKAFETLGRVLPNATVLSNLTIPFDSVTENQLGLSESEL
FT                   QPQPQSTIGNVSLNTETSQDKPWPLALSIEFANRYLGAAFCSWYSTGGQISGLLTQLPL
FT                   SDLNATGTYTSEQSGVMFEKFNVTDTDAAGGGGEYTVQVGFGWTNGVALWAAGEYGQYI
FT                   PAPTCPLIPIIEVNGTAGSNTSDSSVYKSTDKDGGPTASDTTTSKSLFVGYRIPRE"
FT   CDS_pept        join(195528..195795,195850..196429,196478..196911,
FT                   196964..197591,197790..198113,198161..198472,
FT                   198524..199450,199501..200204,200250..201409)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805604"
FT                   /locus_tag="CNG00700"
FT                   /product="Putative uncharacterized protein "
FT                   /function="acetylglucosaminyltransferase activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44484.1"
FT                   /db_xref="GO:0008375"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG068427"
FT                   /db_xref="HOGENOM:HBG177455"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="InterPro:IPR013994"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniParc:UPI00004B48AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF3"
FT                   /transl_table=1
FT                   /translation="MLTHLFYVVVVSVLSLVSQAQDDGWHLDYTYTLVNEELDPIISPN
FT                   QQSSHMHKIIGGSRMAAYYNFDDYSAAKCSSLRIQADKSNYWMPQLYFVDNSTNKFVPI
FT                   PAKIRFYYFLGRSSTAEPVISFPKGLRMLAGDPFNKAPTDVASFTCHINEGFIDSLAAD
FT                   NFNFDRDCPYGMKTELFFPPCWDGYNLYKSDGSHMAYPSQNARDGRCPWTHPIRLPAIQ
FT                   LEYTWRTSYYNPGTVLNGHLAWANGDTTSYGIHGDFVNGWDLDVLNAALKDPSCVGINM
FT                   SIPMDDCPTLFAQFDDAAASTCVPERGVLTETFGNTDLVPIDRLPGCNPLWSDGDKPTC
FT                   DPPIAGLDVSAFTGTDGLYIADVEDQKNFIWPTEPGWTNIACLHDVSSLSGGTSYADQS
FT                   ITVESCTSSCLKSGYNFAGTGQVGTYWTCVCGTSISSNAYVEPGMCTSACPGNSSEACG
FT                   GSYRFNIWYAPNGTISNWGTSRDDGSEYLGCYDDPTTASDGLLGQATYSFQSASMTTEV
FT                   CIEACAQAGNRWAATLLGRNCYCGDEFYYGKGTFMPDSYCTVSCTGNSSEICGDFYKSS
FT                   VYNITGVQAAKASDSHLTGYQGCYEDKSGHLALTNNSWTSTSLTPLTCINGCSELGYSY
FT                   AAVEGGNTCYCGSKVSSTVTVLPASQCQTACTGNSSDSCGGIQALDLYTMAAATDTPAT
FT                   IRASHPAGYLGCYKDAGSNMAFSNYYTYHIASMTVETCKAACVELGYLYAGVTNGYYCQ
FT                   CGDNYPETTQMVGDLYCTTPCYGNASETCGAGGYLEGYDLSDMTAAPEMSGTSMNSYIG
FT                   CYDNSNRGLTNYSYVDGAMTVEACRTTCSEFGYSLAGVYYGSYCGCGDAWTGATQKYPS
FT                   SACQYYACKGNSSEWCGGTTQLAMYNASDVVVTYDKPSGWLSCWSDSAASRSLTGYFYS
FT                   ANPMSAHACRTACNQQGYTYAATEAGNQCLCGNTLGGEKAPTSYCKTVCSGNANETCGG
FT                   SNYMDLYNATGATASNGIAGYLGCFTDNYSLNTASYVSDYMDVDICSRWCYARGAAYAG
FT                   VRVSSGSNMQCKCGTSSPSLVTTLSACATPCTADSSQPCGSTTAIGVYQLSQTSITSGE
FT                   FPISSNSSGYVGCYRDGSTRMLPSYSFSLSTMSNPLCISNCKALGYDLAGTEYAEQCWC
FT                   ANALNATSGGYKVQESDCSTTCSGGAGICGASGTLSVWSTVNASSDSVAVEGYKGCYSV
FT                   GDFVSSTPLTYWGDYMTTDLCRRTCRSAGYAIAGLTNANICVCGDSANYGAQAAPATCD
FT                   APCKGNTTQTCGAKYSKALTIFDTTGAGAQVPSGFAANYVGCVSDGSPLKLSAYSFKNG
FT                   GMTNDMAFKICSAASYPAYGTENGNEGHCGTSKLSVALLPDSYCSTACAGLATTWCGGG
FT                   GRLSYFYLDATTNDTWSTTLASSTSAVANSTSSAFINATAILSTRTTSNTATATAIVTS
FT                   PMPHTNVTPSSTSRNSSISATASVSPFSASGSTSVTSLLSGTVSSSSASTDISPAVPLT
FT                   STASISNIASFIASQADAYSTSTETILSASSTEAGPSGEILVPSSTSSSLSSSFTASAP
FT                   ATSLPISSEAYPSSLYSMNSSTASASISIVTSVITMYISTSASSDTLGSSTSTSAAAVQ
FT                   TSSVSLGCYSGSSSSFSNAKMTSHDDLTASMCQIWCNANYYIYAGLTNGTTCGCSNELD
FT                   GMPSTSDDACTTVCSGDASQACGGDGSVYSVYTAVAASQQRRRSEVEQPAARGETNKGE
FT                   KMIFHGRRVNRRTTASWAAGLL"
FT   CDS_pept        join(203796..203894,203952..204049,204110..204152,
FT                   204214..204429)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636349"
FT                   /locus_tag="CNG00710"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44486.1"
FT                   /db_xref="HOGENOM:HBG177456"
FT                   /db_xref="InterPro:IPR018858"
FT                   /db_xref="UniParc:UPI00004B48AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF2"
FT                   /transl_table=1
FT                   /translation="MREPGYGDMTFMRALPIITELLDDHNFKAELRKMKQDQDALERRL
FT                   WAKGEKVKADHERTVKAEKDIAKIARQSITSEKVRQWNKTLANNLDAFYRQQCLPAIDG
FT                   LAVRQRQRLKDLGVPGLGEDGGSGVSDEKVRQRIKRILEVLEAGLEE"
FT   CDS_pept        join(complement(205095..205159),complement(204960..205002),
FT                   complement(204812..204899),complement(204658..204742),
FT                   complement(204484..204601))
FT                   /codon_start=1
FT                   /gene_family="HOG000228131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805605"
FT                   /locus_tag="CNG00720"
FT                   /product="RNA polymerase III smallest subunit, putative "
FT                   /function="nucleic acid binding"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44488.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG067622"
FT                   /db_xref="HOGENOM:HBG717463"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="UniParc:UPI00004B48B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF1"
FT                   /transl_table=1
FT                   /translation="MLFCPYCANSLTIGDREDSTDKVCPTCPYQFIIERQISMRTHLKR
FT                   KEVDDVLGGKEAWANVDKTDTACPKCDHRRAYFRQMQIRSADEPMTTFYKCCECGHQWR
FT                   EVSQADFTGHLLTLHSELNSPGIYFNVL"
FT   CDS_pept        join(205407..205729,205782..206367)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805606"
FT                   /locus_tag="CNG00730"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44847.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG068424"
FT                   /db_xref="HOGENOM:HBG177457"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI00004B48B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEF0"
FT                   /transl_table=1
FT                   /translation="MSTLNLRPVSSSASLISKPIPSPSLLKPWDFSYNSSPDRKDRNLL
FT                   IMFHGLGRCKVSREHYRDSQKYMLNNSKLIVRLLGDNKASFFNLAKQLNLPSTAVLSLT
FT                   ALDPIPLMDHPSFSWYQAFDPYFNPLPISSQNPTAPLSKLRKLLETLISPHLGWRLEDI
FT                   HLFGWGQGGTVALELGIDIGKTPLKTNDEKDNGKRLGSIISICAPLLTHPASPLNVSTP
FT                   VLYFTRQSPQSAVQQKTVSGIRRGYREVEVVQGGGVGGRKGEDMPRGKEEWYGLMKFWG
FT                   QVLGKADEGWKGEGEVYEVIQ"
FT   CDS_pept        join(complement(207588..207744),complement(207242..207528),
FT                   complement(207002..207187))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942119"
FT                   /locus_tag="CNG00740"
FT                   /product="Cytoplasm protein, putative "
FT                   /protein_id="AAW44490.1"
FT                   /db_xref="HOGENOM:HBG177458"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="UniParc:UPI00004B48B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE9"
FT                   /transl_table=1
FT                   /translation="MVKNDMHHVGLVVDLNTSGGFTSFGRKKGRTVLGLYVLVFHGPPI
FT                   MASSMPIPDEVSEAGYIGAFSGASIPVIKCETNNLFVPFTSKIVFEGSFPLPKQPLKFH
FT                   WEENARLHLPCDTHNWPVYKANCITHRDDAILPMSACRRLTDETHTMIGTFAAAEIGNF
FT                   VEMLVFGQGCLFPLRNSSHLGCPSVRQLGGVEGDEDHFRGIEKEGR"
FT   CDS_pept        join(212108..212635,212684..212957,213011..213130,
FT                   213183..213328,213388..213530,213582..213700,
FT                   213749..213956,214006..214083,214135..214243,
FT                   214300..214469,214523..214588,214641..214734,2
FT                   14788..214793)
FT                   /codon_start=1
FT                   /gene_family="HOG000182501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636350"
FT                   /locus_tag="CNG00750"
FT                   /product="64 kDa mitochondrial NADH dehydrogenase, putative"
FT                   /function="calcium ion binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44492.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG238038"
FT                   /db_xref="HOGENOM:HBG319217"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00004B48B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE8"
FT                   /transl_table=1
FT                   /translation="MFRLRPAPGSVPHRLSTLRPIRPLPPSTFRSLSNDAGGKVVRPTN
FT                   SALSQNFFAGHHRPSSKPHSQLNLVRTRSTFRISSEEFAGKHPYLSVSIRLVLSSIFGL
FT                   VVLTGAILVHDAFTYSERHVDRVPCNPLSLKPRVGGKKNLPIIEVNLDDEEDDTKRAMR
FT                   GKPRLVIVGGGWGAVSLIQSLPAHAYNVTLISPQTYFAFTPLLPSACVGTIEPRSLVEP
FT                   LRKLIARVRGHYLMGAAVDLDMTERLLEVEVPKEDGEGTMRCYVPYDKLVIAVGSTTNN
FT                   HGVKGLEHCYQLKTVPDAQAIRRKVMNNLELASLPTTTPDERKKLLSFVVCGGGPTGVE
FT                   FAAELADMMAEDVLKYYPKILSSEVEVTVVQSRDHILNTYSEKISQYAEKRFARNDVKV
FT                   IINARVQEVKEGRVILSIKNPKDKDAKPEIKELEAGFVLWSTGIAMQPFTKRLVELLPN
FT                   QYHSKAVEVDGFLRVQGAPQGSVYALGDSATVQTNLMNDLYNLWDKFDINKDGNIDYEE
FT                   WQEMVKYIKKKHPLAHRSLTKMRAVFEEFDRDHDEKLTLNEVAELFAKLSKKVTSYPAT
FT                   AQVASQQGKYLGAKFSKLAKQRDTLSSNGIFDLDDESYYHPFEYRHLGSLAYIGNSAVF
FT                   DYEGWSLAGGLLAMYAWRSIYWSEQTSMRTRLLLMLDWVKRGIFGRDLSKF"
FT   CDS_pept        join(220290..221401,221457..222504)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636351"
FT                   /locus_tag="CNG00770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44850.1"
FT                   /db_xref="HOGENOM:HBG068422"
FT                   /db_xref="HOGENOM:HBG177459"
FT                   /db_xref="UniParc:UPI00004B48B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE7"
FT                   /transl_table=1
FT                   /translation="MSFFETEFSLLDPSSQFDESNFLSFSSLIELCPPTLDSNNLNAKV
FT                   VNSNRSSSTSSPSLSEPSDVLNDDFQPSTPKCGQVGIFHTPPKSTNDYEECDLFTPEHT
FT                   LSSPMDAFITPIKSSKSSVSGYDQYGYITPADSIFLSSTRSNFPWDDVSSNLSGATYQT
FT                   PSVTPRAMRVASNPTLDAPRNPRFVKQVVSMPLLKEEPLNTESDWDNSKSFVMDEQQGM
FT                   DVGFVSSRAPVNGFDNVFGGFNTGENGVNTAASILTFQSPESLDSSTQYTTNTVDIQSI
FT                   PSSSSSMPMLSWQPQTSTMQDHVGLFPAIEISQPDTHVAGPIGDFTINPKAVMCSNEGE
FT                   SLVRPSTAPGFRDQETTVPLGPPISEPMNRSLSAGSYKTSKNGPLRDLFSYAPQQLPTG
FT                   TPGLRPLYTCEPSPLFTHADSSNYPRVMPATPTPKPTRTGNSLFTPTRVVSGQGLGSST
FT                   FPPTPDSPGFPFTPPSSTTAPPMLRIGSNPLPMSLRKMRSLTTNSAFPSRPSTLPVCAE
FT                   EDENEMATKSRKRVRRLSITEADDFQEHQTKIPKVNDPPLFSSLPQLIPGVAPVTAVSG
FT                   PLIPTTSSVTIHPPPMHYPVSNGMPSTPHRVHPPPHPGTDSRPIARFPSPSKRNVFSTL
FT                   PVTPKATPLAKGARSPSSKLKTPSSPQRVSSFGGMTFVNFTSDDADVLLSGVARSGTSG
FT                   KKKRDREDSGDEHLSKRPRSRSDDE"
FT   CDS_pept        join(complement(225309..225499),complement(225207..225234),
FT                   complement(224853..225150),complement(224242..224795),
FT                   complement(223956..224110),complement(223854..223897),
FT                   complement(223738..223804),complement(223652..223674),
FT                   complement(223409..223580),complement(223328..223348),
FT                   complement(223219..223262),complement(223027..223151),
FT                   complement(222727..222972))
FT                   /codon_start=1
FT                   /gene_family="HOG000255713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942120"
FT                   /locus_tag="CNG00780"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="hydrolase activity"
FT                   /biological_process="cellular process"
FT                   /protein_id="AAW44496.1"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG007470"
FT                   /db_xref="HOGENOM:HBG315401"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI00004B48B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE6"
FT                   /transl_table=1
FT                   /translation="MACFLPSSRAPGPIRLEDSLSDIILEKSTNLELPTYDTLDGSEEL
FT                   EQRLKALKDEIQDAKVDWYIVPSEDEHQSEEVGDSEKRRQYISGFTGSAGTALIPSSTS
FT                   QSALLFVDSRYWIQAEQQVPKGWKVVRVGSSSGGGSGRADAQSGWMDWVVNKLEDGSRV
FT                   GIDPKLISLDLVHLIQSRLSSIDSSITLVPLSTNLIDKIRNVPARSLGPISPYPLALSG
FT                   EDTPSKLSRVRKAISQAVGGNRKSKVKEWVYILPTLPAIAWLLNYRCPSDIPFCPVAYA
FT                   YLVLTPSQCAVFVDKRKVENELDERWKGEDVEVRDYGVEEVGKFVKAFVNENSEERNVR
FT                   VFSPAECSWALAEACSPQNFRNAYLRDGRAMVRWLAWLEKMLLKNGKKVGEWAAAQGLT
FT                   RERRKEDYFAGLAYEDISASGPNSALPHYAPQRGKDRLIDPDTTYLIDSGAQYQDATID
FT                   TTRTFYFGSTPSPELKRAYTRVLQGHIAVSMAKFPRGMPGDRLGMLARKALYDDGLDFG
FT                   HGVGHGIGSYLGVHENPMYSHDIAFKPGHITTVEPGYYKEGKWGIRIESVLLCKQVETP
FT                   EDGEASQFLEWERITQVPIQTSLVDWSLMAKYEMRWLNEHNKTVQEALEPLLQGDEDAE
FT                   AREWLKKACKPHKVWPWDGV"
FT   CDS_pept        join(complement(226888..226974),complement(226736..226806),
FT                   complement(226531..226646),complement(226358..226436),
FT                   complement(225939..226298),complement(225802..225880))
FT                   /codon_start=1
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805607"
FT                   /locus_tag="CNG00790"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphatase activity"
FT                   /protein_id="AAW44498.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG001206"
FT                   /db_xref="HOGENOM:HBG324596"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000042C71E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE5"
FT                   /transl_table=1
FT                   /translation="MSAAAAAPESVLPYPPIKKDAKFVVLSDWDGTITDKDSNDFLTDK
FT                   LGFGFEKRRALNLEVLDGRISFRDSFRQMLESIKVPFEECKEELMKNIKLDPGFEKFYT
FT                   WCKQNGVPVVIVSSGMTPNIRGVLSTLLPGPDAEEIDIIANDVKFTDPEGKGNTWEIVF
FT                   RHPTSGFGHDKSQAILPYRDLPHKPTLFFCGDGVSDLSAAKHADLLFAKTMENGHSDLQ
FT                   TYCETQGIRHVPFVDFTKVLEKVQEVVGGKSVDEVLKEEGK"
FT   CDS_pept        join(227179..228283,228341..228426)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093139"
FT                   /locus_tag="CNG00800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW44501.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG177461"
FT                   /db_xref="HOGENOM:HBG738697"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00004B48B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE4"
FT                   /transl_table=1
FT                   /translation="MPKTAAGPSTKKSKSKLSQKGVPKLYSNFLPLPILIPAPIPIPSS
FT                   SSSKPISETKHYLYCRAHKPKASAGAGASASKAKETEEELPEGRTVFVVNLPVDVTDRE
FT                   LRTVFGKYGVVEDVRIGKRETGDVLEGVVRGMEVDQSDEESEDDEDEDEEEDEDVEIGD
FT                   KGDGDDRPEATFKGDLLTKKQRRALRRRNLPTSIPEIDSLPALCPRSTPYLRSGLSSAH
FT                   IIFLDPISVSRLFSSAPEPVSLPKYGKGEPTGLAYYTALYKSLRPPLSAIKSFTDTSMA
FT                   RFDHLHSLLLSSRAKEQGAGALVDEDGFTVVVRSGKYGRAGARGDGFGKGGVGVASRGF
FT                   EKKKGIGGKGSQALPDFYKFQALDRKRQDLAELRQKFEHDKARVEELKKSRRYKPY"
FT   CDS_pept        join(complement(229305..229730),complement(229117..229238),
FT                   complement(228527..229043))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805608"
FT                   /locus_tag="CNG00810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44503.1"
FT                   /db_xref="HOGENOM:HBG177462"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniParc:UPI000042F7FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE3"
FT                   /transl_table=1
FT                   /translation="MSSKLPAAGKATRQFRILALPLARLPRPPPPSRTLPTTPPPSLES
FT                   ASSSHTTPPTPLILFHALQPEPSADSPPSLITKALDKSSETWLKLGEKPKGSWMYWFYE
FT                   KGEKLMDRIEYEEWALKAVREGEGVKVAKDGQVLERIEIPLVLPRLPNQEMPSLLPKLH
FT                   RFLLKRIPHHRKMMYRSILFSPVTWPFAIIPIIPNFPLFYVLWRAWSHYKAWRGATYLE
FT                   QLIKAGLVVEKECPELTEIYAGKGREPLAATAALTDPSGKVKAGTTAQPFPPPAPGPIT
FT                   SQAQHPSLLLSPSQIPLLAKTFALKANEVVDVTRAVEQADFRARKTDQVEAKEAQEKEK
FT                   AREEKEKEKEEEKV"
FT   CDS_pept        join(230056..230391,230435..230623)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942121"
FT                   /locus_tag="CNG00820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44505.1"
FT                   /db_xref="HOGENOM:HBG068419"
FT                   /db_xref="HOGENOM:HBG177463"
FT                   /db_xref="UniParc:UPI00004B48B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE2"
FT                   /transl_table=1
FT                   /translation="MSTAQEPPIDNRGQPPSTLHRAKVNAAYLLYGSKAAVAPASLTTR
FT                   SALTTTRYVLRYVVRRLLRYTKYALIGGCLAAVGGGVLGTIGSGLAFFAAPSIGVGMGI
FT                   GVIAAVLRFGWRHRGNHLRGGIWEGWQGMKTRAQQGKDGAEDEELDATSAEEEELEAEN
FT                   RATRRDVWMRV"
FT   CDS_pept        join(complement(231601..231836),complement(231309..231373),
FT                   complement(231117..231201),complement(230936..231062),
FT                   complement(230803..230883))
FT                   /codon_start=1
FT                   /gene_family="HOG000216886" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15805609"
FT                   /locus_tag="CNG00830"
FT                   /product="Structural constituent of ribosome, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44507.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG177464"
FT                   /db_xref="HOGENOM:HBG324276"
FT                   /db_xref="InterPro:IPR000509"
FT                   /db_xref="UniParc:UPI000042E3C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE1"
FT                   /transl_table=1
FT                   /translation="MENAVRRGAGAGGGKCHIARDEIALLGVLRRDGTGGSFRAGRALR
FT                   NASHTHSPRSKRKSKSVQPNLSSPSLRSSSKSTRWEKNSSTMADVDMSSAPAQRSNLRY
FT                   GMNKGRPTTVIPKTARPSNKKGLKTEKKTFVRSVIREVAGFSPYEKRVMELLRNSKDKK
FT                   AKKLTKKRLGTLLRSKRKIEELSAVIVEQRRAGH"
FT   CDS_pept        join(232398..232461,232534..232670,232725..232787,
FT                   232853..233127,233174..233472,233520..233695)
FT                   /codon_start=1
FT                   /gene_family="HOG000138268" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581875"
FT                   /locus_tag="CNG00840"
FT                   /product="Pyruvate dehydrogenase protein x component,
FT                   mitochondrial, putative"
FT                   /function="acyltransferase activity"
FT                   /protein_id="AAW44509.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG177465"
FT                   /db_xref="HOGENOM:HBG736681"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniParc:UPI000042EC4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE0"
FT                   /transl_table=1
FT                   /translation="MRTTRQIVSVLRNARVVPPRAAVPHVRYATTNMAMPAMSPTMTEG
FT                   GIASWKKNEGESFAAGDVLLEVETDKATIDVEAQEDGVMGKIIVQAGAQKIPVGQVIAV
FT                   LAEEGDDLSSITIPEAAPPAPPAAPAPPQQPEQAKEVKEQKAAEQKAREQPRDERKHHE
FT                   HKEIKHSKPLFPSVSRLLQESSLSTDEISKLKGTGRHGMLTKGDVLLALGKVKNRYGSA
FT                   EKFNVDVMGPSGKRLSEREGVAREVKKEEVLDGPALRRLVVSGMAKATQPAHAIIHHET
FT                   TPLPRSSDFEFDSILAPYGALLPSPQPEVTIPSRAELESSEGHLARPKRDEFAGLY"
FT   CDS_pept        join(232566..232670,232725..232787,232853..233127,
FT                   233174..233472,233520..233695)
FT                   /codon_start=1
FT                   /gene_family="HOG000138268" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581875"
FT                   /locus_tag="CNG00840"
FT                   /product="Pyruvate dehydrogenase protein x component,
FT                   mitochondrial, putative"
FT                   /function="acyltransferase activity"
FT                   /protein_id="AAW44510.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG177465"
FT                   /db_xref="HOGENOM:HBG736681"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniParc:UPI00004B48B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEE0"
FT                   /transl_table=1
FT                   /translation="MAMPAMSPTMTEGGIASWKKNEGESFAAGDVLLEVETDKATIDVE
FT                   AQEDGVMGKIIVQAGAQKIPVGQVIAVLAEEGDDLSSITIPEAAPPAPPAAPAPPQQPE
FT                   QAKEVKEQKAAEQKAREQPRDERKHHEHKEIKHSKPLFPSVSRLLQESSLSTDEISKLK
FT                   GTGRHGMLTKGDVLLALGKVKNRYGSAEKFNVDVMGPSGKRLSEREGVAREVKKEEVLD
FT                   GPALRRLVVSGMAKATQPAHAIIHHETTPLPRSSDFEFDSILAPYGALLPSPQPEVTIP
FT                   SRAELESSEGHLARPKRDEFAGLY"
FT   CDS_pept        join(complement(234331..234559),complement(234136..234281),
FT                   complement(233739..234095))
FT                   /codon_start=1
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942122"
FT                   /locus_tag="CNG00850"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44512.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191785"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniParc:UPI000042FE93"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED8"
FT                   /transl_table=1
FT                   /translation="MSGIFAQPYADSDHLQFYAGQPYDARHAAPYAGAGNMGSMNMASG
FT                   SMLSGPGMLSAGRWWEAFGTGGFDGEPSLMEELGINPSHILQKSLAVLNPASRVDSHIM
FT                   DDADLAGPFVFCFAFAFFLLLSGKPQFSYIYGVGLLGTTAIYLLLNLMSETGIDAYRTA
FT                   SVLGYCLLPMVGLGGIGMGVGIDRPLGYLLSTISIAWCTHSASAIFVAVLRMDRQRLLV
FT                   AYPIGLLYGCFALLSIFNVNK"
FT   CDS_pept        join(234736..234798,234859..235059,235106..235403,
FT                   235453..235963,236013..236166,236220..236403,2
FT                   36455..236477)
FT                   /codon_start=1
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942123"
FT                   /locus_tag="CNG00860"
FT                   /product="Mitochondrial processing peptidase beta subunit,
FT                   mitochondrial (Beta-mpp), putative "
FT                   /EC_number="3.4.24.64"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAW44514.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG407991"
FT                   /db_xref="HOGENOM:HBG476859"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000042EC4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED7"
FT                   /transl_table=1
FT                   /translation="MPARILSRAIARPPVPRVLKPSLARNLAAVHPVTVAADPVTRTST
FT                   LSNGLSVSTETIPGASTATVGLWIDAGSRADAPNASGTAHFLEHLAFKGTRSRSQTQLE
FT                   LEVENLGAHLNAYTSREQTVYYAKAFDKDVPQAVDILSDILQHSKLEESAIERERDVIL
FT                   REQEEVEKQYEEVVFDHLHSVAFQGSALGNTILGPKEHINSISKSDLQSYISKNYTADR
FT                   MALIGAGSIEHDALVKLAEKHFAALPVSANPIPLGGQSHTPAEFIGSEVRIRDDSMDTI
FT                   NLAIAVEGVGWKSPDYWPMLVMQSIFGNWDRSLGASSLLSSRLSHIISSNNLANSYMSF
FT                   STSYSDTGLWGIYLVSENLMNVDDLTHFTLKEWTRMSISPTIAEVERAKSQLKASLLLG
FT                   LDGTTAIAEDIGRQMITTGKRYTPREIERYVDAVTPAEIQRVAQKYLWDKDIAVAALGR
FT                   TDGLFDYTRLRADMSSMIL"
FT   CDS_pept        join(236812..236863,236963..237612,237682..237897)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942124"
FT                   /locus_tag="CNG00870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44516.1"
FT                   /db_xref="HOGENOM:HBG177466"
FT                   /db_xref="UniParc:UPI000042EB6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED6"
FT                   /transl_table=1
FT                   /translation="MFTPLSKGSEHVQDTLWDNSSPRKTRIRPLVSSVLKSNAGSGSGS
FT                   NTVSHTDHGPSVRPGPSLTGTDNRTDNRNRTGNRKRTGDGEGNHHGKTQGTSLPARSSW
FT                   LAPVPRSAGRSRQCKAVAAGVDDGDGDGNGDGDGLVVIAGGKGMEGEGEGEGENGSRNG
FT                   IRRGTTLSPGRRRRRSFSNRGASRTGAGTEMEDEKETLLSLFFQPRRERVEGWMDSFWK
FT                   RHAVLVIVPCLIVWIWLAVPFPVSDPYKDDPFPEIPSWPKRPKNEDGDGGNSSTMNPGE
FT                   RGEGEEGDGTSLPLDVNFYFFLFW"
FT   CDS_pept        join(239365..239380,239445..239480,239544..239629,
FT                   239715..239823,239946..240010)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805611"
FT                   /locus_tag="CNG00880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44518.1"
FT                   /db_xref="HOGENOM:HBG177468"
FT                   /db_xref="UniParc:UPI00004B48B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED5"
FT                   /transl_table=1
FT                   /translation="MVGFLGWLSILHFGPNSQLYPFFRFHPTPEDPYTFPMTFIASCVI
FT                   WSSELVSSFIARQIMSYAFGVNVSQIGIDEMKDYPELGWASVHVSMNILLFLIKLNFR"
FT   CDS_pept        join(complement(245352..246058),complement(244967..245295),
FT                   complement(244293..244916),complement(241942..244125),
FT                   complement(241369..241890),complement(240544..241321),
FT                   complement(240393..240489))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942125"
FT                   /locus_tag="CNG00890"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44520.1"
FT                   /db_xref="HOGENOM:HBG177469"
FT                   /db_xref="UniParc:UPI00004302F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED4"
FT                   /transl_table=1
FT                   /translation="MANPFLLSPNRQSRHSNSLHPTSNQPTGVGNNSGFKASLRKIPSA
FT                   LFHKDKTPVKEKPGRRKLQVHSEQPYSHMGMSPSPRVSRQTIETDNKSKTRTKAKPRKG
FT                   LAELFSWGNHSRTQPAQPDQPIKTLVPVPTPKDSMMFKKHKRPPSTKSNSSHLISLRPP
FT                   VESDMPSRPSMGDDPFVRPQEGAKVVDQVLRHGTPSLRSMTPLDKRSSVTSSMALSCKT
FT                   ALNDERSVKDVHDVPAFNPTIHATQQRRVSATLQTTLKDLHSSAASVIKVTDSASKTFA
FT                   PLPDAPEAPVIVVEPPKKTLRKEKTKSKVWGLLGRSKSKRSKMATEDEALPPVPSVKDT
FT                   WNVTSMPGPAQYSTSLVNKIDEKYPAVTTRSSYSPFQSPIHPLPSLHISQSSAQHPAQN
FT                   RPSDASTVGVAQSQSAVGTPFDSPSRCLLTSGRGGVWESVVGSVVDRPSTDGPRAAIEA
FT                   LMGPTRLPKRKSLSNLFGLGARKSMDKMKRDSPTRAPPSASCISGQLVLKSLTEEVEES
FT                   AEEPRPIPISASSDVFNNRLPSLAQPPKQEKEVIRKGFNDSPTPIRKVRSAMLVNNRSS
FT                   ANSLRPPSVNVSPLKLALHRSQAAANKQAKAEAPERSESMIDSPPRQSMVRKGMRNIFA
FT                   PPSPMVSKNPDSTMLHLATTSITNEAVRMSQILKHTVLCQNNEPLLEVNGTSDVPFDLK
FT                   AVVVNTEAAESGYSPNKTLRLGLPAAPPQNRISPRRPGPSPPALSLPPVPDALLPEIES
FT                   AHCLAPDVTAGCDAHDSIFVDTLSAGFNEYRNSFDFTSEYQALDQGTQRASFVEALRNV
FT                   GSVQMFMGDDLSAVPAAATKTTAISLVDQVPSFHIQKPSDSTTQHIVSHNSDDSDDEDD
FT                   ELGDEEAFEHVAEIHHVMGIAKTSPARREPFKGQVAFQQHMSMKQQPSHASFGAPEAVT
FT                   PMELAPFPTLPPPLVNFEPRGHKRAESSVATMSSIGSVIGTGAEREYTNYFDYVVPSAQ
FT                   SHSRQPSLTGTIEEVANERLPRHSPSRESLASFTFGAQLSSRPVTRRGHHRRNSSIQSV
FT                   DSVGGSDYNSLIGNGPPVSMHNNRRSSYVSKHRRNLSSQSSLGRPDWAAHRRNTSAASS
FT                   TCSNTSVSQILRPGLGDRMFQLDGGVQLTSISGSPPDDAAKASTSCQRSASWDSLFDTT
FT                   CGKIAHDSLFDASRARVVDDSLFNAPSAPRESFMSSADESSRTSIGADSFFGPEQQSAN
FT                   DKFFLRGLRPISTISTDTSNSIADDTFADAMARNVTKRVRELERCLQGSGEDMSNITPL
FT                   GKKKTQAAGARQMLGSSMARPPKPGHRRPAELVFSDVPIDTPGLTSPSASETSSRLSLD
FT                   TNAASFTLGARARGHRRQTSSAQVNIDATIHEMPSLATLRPNRSFTSPARTFAIASQND
FT                   LTIVGVETLEMEEEVNRLDSVRTWVQWEREAMDEFRKAKNVWVDSEESRMAISDWNMPR
FT                   TTDEIAAFLTQSSQAYKPLEQLPVGRIAHRRKSSLNDARSLCSPYGLPLPKPVPVNKPK
FT                   MSLTTKYEKKSSTGSKASTTPSAFSFAFPDDVPEAPASAPIPVISPFATVFAPFARETP
FT                   SSPPPKIAPFKPISPFQLPVLDTFGVRKHLEDKTKAKNVRKAEQQSERKRVDSKAKRQA
FT                   LGWGRKRDSDRREMVVNVNKPGKPEPGSNVSALKPPQLKPLILPAKATARRKDKENVYM
FT                   DEISSSCISGPERAINKPRPLKDRGTNKSPAKRKPIPRYVASQPSGLRV"
FT   CDS_pept        join(248869..249164,249218..249861,249913..250119,
FT                   250170..250305,250357..251171,251222..251313,
FT                   251371..253608,253659..253748,253810..253833)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805612"
FT                   /locus_tag="CNG00900"
FT                   /product="ATP-binding cassette transporter protein YOR1,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44522.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00004B48BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED3"
FT                   /transl_table=1
FT                   /translation="MSPLLPTHSGASAPQNEPTLPSPSHSVSTRVGDEEKVRRSEGSEG
FT                   EDRINLDSNNYEEKGVKEIEEGGDKKQVMAVFDQKNGKELEKPIEEGPFTQPRWRHSLP
FT                   FAKPKHPPPPPPLSLDDAPVTPEVSANFFNLLFFNWISPMMALGSARPLQDADLWKMDA
FT                   ARGAKPLSEKLLASYAARTKKANEYNARLADPNTPLPLSRRIIYSVLPHREQREKDYRE
FT                   KHGKKHASLVMSLLDVFGWFFMSAGFIKVFGDTCQAVTPLVIRTLINWSTEYQAAKNAG
FT                   RDLPSRGPGIGAAIGLLLLLICSSLGMHHYFIRSMGTGVLSRAAIISAVYQQALQFTQK
FT                   SRGQIPNGKLVNHISTDTSRIDFAAGFAHMLWTAPVQMVVIIIILIVQIGYSALPGIAF
FT                   LLIMTPLQARFMKTLFMFRKKAATWTDKRAKLLQEILGGMRIVKYMAWEKPLLERIHAI
FT                   RGMELKYIRLLLVFRSGMTAIAMSLPILAAILSFITYSLTSHSLEAAKIFTVITLFNLM
FT                   RMPLMMWPMTLSSTADALNALGRLEAVFDAELVKEEKKVDPSMDVAIKLENASFTWDSA
FT                   PIEEDNMMSKLTGKYAKALNGGKPVGPPGKKEKKNKPKKVTVAEEIQAETAAGQPGAGE
FT                   ASAEGQGQENPSAPPGIDEGISEKKEMKIFQLLDINLSIPKGSLTAIVGAIGSGKSSLL
FT                   QGLMGEMRRITGSVTFSGSTSLCAQTPWIQNATVRENILFGQPWDEERYWAAIRDSSLE
FT                   ADLELLEDGDGTEIGEKGINLSGGQKQRVNIARAIYYNADIIALDDPLSALDAGVGKAV
FT                   FFNAILNALSGKTRVLVTHALHLLPYVDNIIMMEDGKIGEVGTYQELKERNGAFAKLIK
FT                   EFGNEELAEEKMENEEEAIENSGPTAIHDRANMMSKGSAHTLMQTEERNVGALKKGTFF
FT                   DYLKAGKGVVMLPLLLFCITVAQSFYVITSFWLVWWEETKWPQPNGFYMGIYAGLGVGL
FT                   AISLFLQGFSNALINYFASVNIHHNAISRVMLAPQTFFDTTPLGRIMNRFSKDTDTIDN
FT                   TLSDAMRMAISTLANIVGSVILLAIIEPYFLIAMAVVSLLYLHNAMFYRRSSREFKRID
FT                   SILRSSLYSHFSESLSGVATIRSYGETERFFEDNIHRVDIENRAYYLTIVNQRWLGLRL
FT                   DFLGSLLSFSVAIIVVCSSSVSASSGGLGLSTIVSVQQAFSWLVRQVAEVENDMVGAER
FT                   IMHYANELEQESPHQIEGTKPPPSWPSEGIIEFKDVRMRYRPELPDVLKGLTLNVGASE
FT                   KIGVVGRTGAGKSSIMVALFRMSELSHGFIKIDGVDVSKIGLNDLRSGISIIPQEPLLF
FT                   SGTLRSNIDPFNTKTDAELYDTLRRSHLIGSSDSSHNSDSQNRFNLDTVIEEEGGNLSV
FT                   GERSLVSLARALVRNTKVLVLDEATASVDLETDAKIQETIRQEFKDRTLLCIAHRLKTI
FT                   LAYDRILVMSDGQVAEFDTPESLFLSDGIFTEMCSKASITLADIKAAAALRF"
FT   CDS_pept        join(complement(256880..257111),complement(255543..256813),
FT                   complement(255312..255494),complement(255036..255256),
FT                   complement(254897..254982),complement(254784..254845),
FT                   complement(254600..254730),complement(254515..254544),
FT                   complement(254389..254458),complement(254271..254336),
FT                   complement(254201..254224))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805613"
FT                   /locus_tag="CNG00910"
FT                   /product="Putative uncharacterized protein "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44524.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG177470"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000042F43F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED2"
FT                   /transl_table=1
FT                   /translation="MPDRTPTSPRAVVIDVNSPQINRSIPTSSPNVLTPSRSIGPPSMT
FT                   HRGSVSRKHRPANDADARERQTQQDIESAMSMSRARSGSMNLPDNSPPISRPSQLHFPS
FT                   TSPIQESHFPMLSEAEEAEMERARRLRPGRDNESDDEHGHGGHYHPHDEERGGEGRERR
FT                   DSITESAGYDSHSRLIHRRGSDSDIHDMDRARHVDLRSLGGHGLKNKFNFSAMEEFAMR
FT                   ERENLFASEGAWAIDGGNGAPRRRSVPHKGAGASEENIHQPGSYDTAFERTNTMSAFGD
FT                   ETEPPFSPERGHGAEDHAQTFQRRRQRKLSQSNPVHRQKKLALFEGFGSSGVTDGESAP
FT                   DAPSTAFKAPRQAKSSFAPYTDAAPGHDRPYRFSFYSNAMPVTIHSRSLAELPAEGQTF
FT                   EDLFKGRNPSGNASPAENDSAPRTEGSDTPNKSAPPVEPSTMASAKTNPSLLSKAVGAA
FT                   MSQQAGFGGQPNGGLDADEDPEQYTWWLDVLSPTDEEMRMLSKAFGIHPLTTEDILLEE
FT                   TREKIELFRNYYLVCFRSFDQDPYSQTYLEPLNMYIIVFREGTLSFHFRGTPHPQNVRR
FT                   RIKHLKDYISVTSDWISYALIDDITDAFGPLIQGIEFEVDSIDELVLILKEAEQSDMLR
FT                   RIGTCRKKVMGLLRLMGNKADVVKGLAKRCNEQWLVAPKSDIGLYLSDIQDHLITMTQN
FT                   LNHYEKILSRSHSNYLAQISIEMTDANNQINDVLSKLTALGTVLIPMNLVTGLWGMNVH
FT                   VPGQDIEEGYTWFGGILGCLCLFAMLGAWATYKCFVVR"
FT   CDS_pept        join(258474..259646,259691..260136,260186..263321,
FT                   263371..263635,263692..263958,264008..264082,
FT                   264133..264210,264263..264399,264490..264540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15805614"
FT                   /locus_tag="CNG00930"
FT                   /product="Osmosensor, putative"
FT                   /protein_id="AAW44526.1"
FT                   /db_xref="HOGENOM:HBG068418"
FT                   /db_xref="HOGENOM:HBG177471"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniParc:UPI00004B48BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED1"
FT                   /transl_table=1
FT                   /translation="MLRPPLSSPSQTAETMISFGSTVSSHQSFSNTALTTPDLGSPGKT
FT                   KSTLEPLVQILERVEESSKPSSPSLNHVSKPSEGSKVYSSGLGISGGLKVKDVASRFEQ
FT                   MRSAQTPSPTPPEHRPLTVPRKSPVARSISPLHTTQNHSPTLRSNSSKSTMRPSTSVYQ
FT                   STDPESSSIPTNPPFAETPYIPSPTLDSAYNNSPVTKNVPTPLRRDRGSTKKMIQRWES
FT                   CSSTPTQPEVHTAFQNAHGVFSREYLDKKPLPPPKDIPDDNVIAGLPRHVTPSRSLPHN
FT                   PLPSSIHNSPNHLRTPTKSGRGQNNNLSPSPSGSHYSPQGSPSEKKQKVSPLKDVLNFL
FT                   GARRKGKGKEKEKEIKKDFGALIDENQDRFGVFIPKDRMGSAEMRWSPDFKPTIRSDPI
FT                   IYLIPTPCSSVSAWDSWLPSWATLTSDALSITYCPVFSTPRTGSLNTPRRCSGSSTKSA
FT                   RGVPFSQISAPNPQTPSDKTFSMQNCLDVRIVKKDELKSKGIPMAPDGVGAEIIELTWE
FT                   DRSRSYIAVEGSEGRNAWLTAIRGILPRTPVLPPITPSETPFGSISSPLRRSSRHSSPL
FT                   SIPHRGSIGTVEDAGFGSLPSIQKVGDEWVAGGPLHTLNNDLESPRSRPRLKEDSPLRE
FT                   SVSLMFADKDPSQTPRRQSSVQQPEVERSTSHASSEASQRILEWQAPVQNQKGLSTCAR
FT                   SRLPPTSFLTPGIDVESTAMPHSDTMLSFDSEDLNPSRSASQVGRAPTDIDKGEITPKQ
FT                   TKTEGRGEVKSRAAAWEARSALSSEQELDPFGAPTHISRITFPKPSVGSASLATSPKIS
FT                   LTPTSYKVDISFGHTKNDNLFNHSTSPSRTMRMALDGLPPSRPVSQFTTQPLRLHKNVG
FT                   SRPNNSHSSSTETLVNTPGREMVMRDEPTDTISRASTLSTPSTYEKENSNEEVISRPTV
FT                   RGPRPVSSNTFGRRVSSRIPSASSQTTPPTRAVTPAVVAQPSTSRDLAMGAVSSPSPMS
FT                   ASGASQRPKHRSSLLSHRVPSKLYLTEEEKKKQNGQKTGEDKAPSPTAELSGLAEVENK
FT                   EEDLAPLFTRAPFPRPASMMTAKSACSPESDTTQSLPGLPVALSLEQEPSPILNDVHPL
FT                   PLTEEPTVPIALPSANLNKILENVQVLMDQSRMISDPETAPYPKALQEKLEALHEDLTA
FT                   VRRSLLETSQEKGLVVEEDNLSPPAGAQEPLDLSKVYGHLESLEGRTTSIADPETAPYP
FT                   KVLEERLNTLYAEVAMIRRLIEETKAQQEIGAIGNVATAEHTANDAAAVSCAPTQVSDA
FT                   SFAGSAMMAMPVPFESKSGNIEMEDTPHLQAVELADLPREKALAAAAPNLRPASPTPIQ
FT                   PPMPGRRWPAHLIMPAPLAPQASQYNTSRSLADAPRSPLNSAVEDKSPPQTSFAVPEGM
FT                   QNDHPLIMPELFALRTPVEATQKEVVPQPVPSDVSEIHRKLDHLTALYQAFLGRQCEAT
FT                   TSSKETEKVAIVTTDVPGPINFEGKPDGGENGMILSESETPGTDNDPSIERFSTIMRKA
FT                   VESPAAPVTPKTVASRKPVPSFKEETGASNEVENVIVGEHIARPDEKNEEEKYAGEEVA
FT                   KIMGDSSDEPKLLKQQELHVLSNVPTPSERGHNEKDEAPLDQLAVAKSASPTIVPTTAR
FT                   FPEETVKKMEEAMGILKELNEARGFQKAQAADIGKYLTDLNGWLEKFVQNSSAELGTMS
FT                   KRLDTLVGPESSDGSQGLPALVADMHSMLVEQKHRNEVDGMTGQRLDTLVMMMGQDQQR
FT                   QANQESATAEILQVLERQRHENEMLLRAVATDLTEEIRGDKMRFLESMQKATTVNVMLH
FT                   IEEFKRLLNAEVNKSMNELGKVREEKRALEQQISDLFALKAKHGAPAAPAGPLPPPSNH
FT                   P"
FT   CDS_pept        join(265072..265161,265218..266076,266128..266240,
FT                   266291..266770)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789286"
FT                   /locus_tag="CNG00940"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="cellular process"
FT                   /protein_id="AAW44528.1"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG068417"
FT                   /db_xref="HOGENOM:HBG177472"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniParc:UPI00004B48BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KED0"
FT                   /transl_table=1
FT                   /translation="MGLGFFAPSQHQQQQGIHDSLLIEADLFGKPSETSLGNVEDGHKP
FT                   TRPVSTFGQRVIVAILFLAAFIGALKYMSSASLMGIIASLSTSDSSSLSAAFNRKCEAL
FT                   LTPPPKTYSNRLDSLVSELPQSTVWIAEPGPSASYFIGGFSTQDWWLSERPFFVAIGRF
FT                   SQGSPRIFLVTPEFEALRASLIELPKDLDGLVTWVKWREDQSPYEALKAALDDEINAFV
FT                   LDGLTRQFVAEGLRNVLREEKNYEVLEKIGLIRERKSHWEVGLLRCANQKTLHAIRKTR
FT                   KRMHLGISESKTSRILEEEMAKTGLMGGEGLVLFGENAALPHGSGTDRKLIKSEMVLID
FT                   AGGKWGGYVSDITRTFALANSKIPLSHIEIWEAVHKAQHAPYAYLKTTNTTIPATFAQL
FT                   DKAARSAIDSWAGSTAGTDIPNFDIFTHRLGHGIGIEGHESPYLIQGSLGERQVRSGHV
FT                   FSLEPGIYLPINGKPVNGINGVGVRLEDCFVVTEDEDGGFKGEWLSGPVQSWGDV"
FT   CDS_pept        join(268379..268532,268584..269216,269265..269410,
FT                   269473..269555,269610..270741)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636618"
FT                   /locus_tag="CNG00950"
FT                   /product="Metalloreductase, putative "
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44530.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068416"
FT                   /db_xref="HOGENOM:HBG177473"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI00004B48BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC9"
FT                   /transl_table=1
FT                   /translation="MSSIAATATAVIVNFAKGDGHGSQSAETMTPAQASLQAKMQAEKK
FT                   AQNLLDQQMIQDTWIGLAALFALCWIFILPRFFARASASCKRQRGGGLWTGWLMRGGSR
FT                   SSTDDSRHSSSSDDHDSQSSSDPSPSVQPPAHIRPLLSYIPYASTLFFARPFQRLGYGF
FT                   KSFMKMYEFYLFLFYLLLVLFTLCWKSDLQPKAANSGSGADYKRSGYVAAAHFPLCIAL
FT                   GVRNNILGLLVGKSYERLKIWHKVSGRLMFAATVWHVVAYVVKWAREGDFTAQNAKLYV
FT                   IYGWVAVAAFIIIMITSVPWARNAFYGIFKVAHILGFVAMLVGLGYHIRHQSYAIAITV
FT                   PSALVYAISCFFAMTKTRFATAELVAHPGTDFVTLTIPALRTGWRAGQHVRLRVPATGF
FT                   VHALEGHPFTIASAADAGPAVLLIKDAGDWSRRLCKLATKPTGDAEANGTPRKVTVIVE
FT                   GPYGGFGNMLPGSYSSVLTIAGGSGVTHSLGLVQELVLAAPRGAVRARTVDLVWMVRTA
FT                   AMAAPLMPTIHQLVRDARNWETKCLASKEQKLQPTALRVHIHITQTADDHDIHLLNLHA
FT                   TPALDNEKITTDISRSASSEGISSGSRTPVDLSPELEGDKEKFAYMTDHPASEGDLTSS
FT                   ILSGIVVHPGRPDVGVFVSGIVDETIARYAGTGVSPCGVCVTTCGPDGLLEDVLNAGWR
FT                   LDDKKQRAVGGLEIEEESFGF"
FT   CDS_pept        join(271353..271459,271642..271741,271820..272035,
FT                   272101..272220)
FT                   /codon_start=1
FT                   /gene_family="HOG000186184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942397"
FT                   /locus_tag="CNG00960"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="AAW44532.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG028497"
FT                   /db_xref="HOGENOM:HBG381378"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR016721"
FT                   /db_xref="UniParc:UPI00004B48BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC8"
FT                   /transl_table=1
FT                   /translation="MERTSLHRYADMTIHVIRMPNYSLSHMAPWLSNSLRGYNIGTRLI
FT                   EDFLARTGLQRCQSFGETAEVISKVAFRSFLAITPTVSFPPPTQQPTNNLAQPSEFILT
FT                   FDENPLAEFAELPPDAREGGLWFSNVLCGVIRGALEMIQMQVETRFLSDQLRGDDTTEM
FT                   YVKLVRILEEEQPENDE"
FT   CDS_pept        join(complement(275779..275921),complement(275328..275704),
FT                   complement(274866..275009),complement(274716..274801))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806624"
FT                   /locus_tag="CNG00970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44534.1"
FT                   /db_xref="HOGENOM:HBG177474"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI00004B48BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC7"
FT                   /transl_table=1
FT                   /translation="MQRSPTNISEISNTSSEGTGIDLNDELRDMDDEQRDLPSGWVRCF
FT                   DPNQKHHFYVDEATKRSTWVHPYDDPEFLRTLPKDHPAHPDSKEARAVRKQSEDEELSK
FT                   QKRKEVKSVKGDSKAKGTVGTSAEKEGTDGERNWFQRKKDKMIGTKEEREKAKAEKRRL
FT                   KEEQKKRIQARYGGGYGRRGYGYGYGGGLGGMGMGMPLMMGGGAGLLGGMLMANSLDGG
FT                   YGGGYGGGDMGGGGDMGGGDMGGGGGF"
FT   CDS_pept        join(276454..276552,276614..278188)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636619"
FT                   /locus_tag="CNG00980"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW44536.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG068413"
FT                   /db_xref="HOGENOM:HBG177475"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI00004B48C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC6"
FT                   /transl_table=1
FT                   /translation="MSDTEINVKTLKVAELKEELSKRGLDTKGLKKDLAERLQGALDAE
FT                   ANPPSSEHATAQAEEVPGSRPSTPPVPTVAAPDVVAEPSTSRPQTPPLAQDPSTPLAPS
FT                   TPPLPTSDKGVGSVMVDGYPEALEKQATEVKDDADMVETQPKALDEEVAKEVSKEEGKD
FT                   ALPLTPTPPPRSLSPLPVGEEKNEEQKEEKAERKFDAQSETKPEPSAPVEKDANVQEDL
FT                   QIVPPSPQSPADKKRPLSPSPAPAPPAKKSRTTDGAAIAFSHAIHPPTSTLFISNLKRP
FT                   FMHSALHEYLFSTAPESSPPTLPPARAPFASDEYPGLWLSGVKDHAFAVYPSVEEALAA
FT                   AQRIDNVQWPEDTGSALTIEFIADDKLLALVQEEEHAWTNGRQKLNLKVIKRDDGEFEF
FT                   THEGVGGLGRAPMRGGGPLRGAGMRGGMQGGYPPHHPGGGFGRPQGPPGQFGAVPAGGP
FT                   RGPPRPVPLTGVNAIGVAGGRGGSAIGVRGRGGFGGGPGGHGRMDGPPPHEHGHGHGHA
FT                   MQQRDPVKEELKMRPTRFRPRLFWKKGPGAVEGLARDGGR"
FT   CDS_pept        join(complement(279536..279868),complement(279231..279475),
FT                   complement(279026..279177),complement(278934..278959),
FT                   complement(278626..278878),complement(278324..278568))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942398"
FT                   /locus_tag="CNG00990"
FT                   /product="Platelet-activating factor acetylhydrolase 2,
FT                   cytoplasmic, putative"
FT                   /EC_number="3.1.1.47"
FT                   /function="1-alkyl-2-acetylglycerophosphocholine esterase
FT                   activity"
FT                   /biological_process="lipid catabolic process"
FT                   /protein_id="AAW44543.1"
FT                   /db_xref="GO:0003847"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="HOGENOM:HBG068412"
FT                   /db_xref="HOGENOM:HBG177210"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016715"
FT                   /db_xref="UniParc:UPI00004B48C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC5"
FT                   /transl_table=1
FT                   /translation="MILPPIIAASLPPPPGPHAVGYTFLVHPPLSPFSHSSPTLKSTGK
FT                   PAFQIEEIGYCLFYPGLPEGKRGKEWVSWVPDPFWGVIRGYERFLGGKGGVSWLVKPLG
FT                   YIAGRLQMPLHPRAPLKPTDKPYPLLIFSHGLAGTRHTYSQYCAALASEGYVVLAVEHR
FT                   DGSGPAVVLPPEGESKESRVLYYTGVNDISWAEGEEHPVTHARTLQLDIRTREVYEAYH
FT                   SFKRLLSHEGDLSIKIEGLEGGHSFGGGTILHLLQSPPPSTLLPSLPAKQAISLDPWLE
FT                   PLPAPSDILQTPLPSSLPPTLVINSAGFTEWPEHWEKLVEIMKGKGILITMIGIGHQAF
FT                   SDFPLLSPRGYSHAHSMILKVHELSTAFLNKKLLSGAALAGKTPDKGDYEKDEDGVKIK
FT                   GKAAMKDGDVLLHFADRE"
FT   CDS_pept        join(complement(281862..281962),complement(281712..281803),
FT                   complement(281423..281639),complement(280766..281370),
FT                   complement(280363..280712))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806625"
FT                   /locus_tag="CNG01000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44544.1"
FT                   /db_xref="HOGENOM:HBG068411"
FT                   /db_xref="HOGENOM:HBG177211"
FT                   /db_xref="UniParc:UPI00004B48C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC4"
FT                   /transl_table=1
FT                   /translation="MRTSTSLIALGAAASVATAQSVSIPDLTSSALRLLSSNCRTAVKE
FT                   LISPDSPTGQCLNTTAAESVLNSNGSIVPSVENWLDSICTSNPCSNSTLQNATQTILSQ
FT                   CSTDLQKFGLTNETVQIIVQSYPLAREVVCLKTTDPFTGNSSSDNSGSGGSGGAASSAS
FT                   SWASSDWNSAAPTSSMWYDAGTDSSPSPTYAQESAYRLIRRQDQGSDASATSDIASWTS
FT                   SAASPSSTASGSDNSSSNSTEGTYCVTSLLDELSSYLGTELSLREIATIALGGNATAIQ
FT                   DLESIPPTALCNECIFGALSLIETQYPDVGTSVWIGNSTLNQFLDTTCNSTGLVVSQNG
FT                   TLPENVTASAYNSSFPYSFVNGTSTYLPTSTASTVPIQSIIPHRNVTIGHHTIGFGNDT
FT                   SPSATSSVVSTSGSPVSSLTSTAAAVTSAAASAGSAATSAASNPAAIKARWMGQQ"
FT   CDS_pept        join(complement(284001..284032),complement(283920..283946),
FT                   complement(283567..283791),complement(283305..283515),
FT                   complement(283155..283230),complement(282981..283099))
FT                   /codon_start=1
FT                   /gene_family="HOG000161320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806626"
FT                   /locus_tag="CNG01010"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44545.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG055478"
FT                   /db_xref="HOGENOM:HBG629877"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR016706"
FT                   /db_xref="UniParc:UPI000042E3C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC3"
FT                   /transl_table=1
FT                   /translation="MVDNTHDTIEAFPLRNYLFIEREGQPEEDNSVTNRLKRLEDQYKE
FT                   SGTRRSVEAIMVVTVGNSISPSRALLNLPVQVHGFAHVLVLQVANAFYKLPGGYLDPSE
FT                   SDAEGLITRLNEQLGVPVTTLKGKDEDDLPRTVWLAPEGGRDWEVRDCLSVWYRPHFDT
FT                   FLYPYAPAHVSYPKECKKLYLVNLPPNKTFAVPANMKLHAIPIFEFYDNAARYGPQFAG
FT                   IPYILSK"
FT   CDS_pept        join(complement(285546..285957),complement(285349..285429),
FT                   complement(284398..285278))
FT                   /codon_start=1
FT                   /gene_family="HOG000138267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093383"
FT                   /locus_tag="CNG01020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44551.1"
FT                   /db_xref="HOGENOM:HBG068409"
FT                   /db_xref="HOGENOM:HBG177212"
FT                   /db_xref="UniParc:UPI00004B48C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC1"
FT                   /transl_table=1
FT                   /translation="MSNDDPFAFRRNRLLALGHPGDTRSTSEILNEHRENRAQAAFEAS
FT                   SNFESSSAGARRPTVISVSSSSSDSIPGVGSATGGRNSRPSAAGLGWRAGSSRAASDGV
FT                   QHSRRSGPSGRTVDDEENEIIYAGGSVQGDDGRAAGGWRSSSSRGRNRQHSPRPPNYDI
FT                   IQLNAALDAQARDRQRERPHRRPFFSPSPPPPEPAPPSDPQAEPRRIRLGGALFQAGGA
FT                   RRQYLPSIPSQPPQNHLAAEMNPRELLRELFPANMRHMFFVQAALGNQILAGDAGPARR
FT                   EEDLEEILKNVPVPTYDPPMSGFVRNFDMEMAQPNEAIVIDDNGRVVPSKKRRKPQPHL
FT                   VCANCESALLVSESYRSPTDRVYALRCGHLIDQRCLHDLITPRTPHELASVDRHPDTLD
FT                   EPPTKKRKSGRKPKKVEKIPDEYKWTCPVEGCGQKHTSKELGGAWMNVEGEGAISVFA"
FT   CDS_pept        join(complement(285546..285957),complement(285349..285426),
FT                   complement(284398..285278))
FT                   /codon_start=1
FT                   /gene_family="HOG000138267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093383"
FT                   /locus_tag="CNG01020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44552.1"
FT                   /db_xref="HOGENOM:HBG068409"
FT                   /db_xref="HOGENOM:HBG177212"
FT                   /db_xref="UniParc:UPI00004B48C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC1"
FT                   /transl_table=1
FT                   /translation="MSNDDPFAFRRNRLLALGHPGDTRSTSEILNEHRENRAQAAFEAS
FT                   SNFESSSAGARRPTVISVSSSSSDSIPGVGSATGGRNSRPSAAGLGWRAGSSRAASDGV
FT                   QHSRRSGPSGRTVDDEENEIIYAGGSVQGDDGRAGGWRSSSSRGRNRQHSPRPPNYDII
FT                   QLNAALDAQARDRQRERPHRRPFFSPSPPPPEPAPPSDPQAEPRRIRLGGALFQAGGAR
FT                   RQYLPSIPSQPPQNHLAAEMNPRELLRELFPANMRHMFFVQAALGNQILAGDAGPARRE
FT                   EDLEEILKNVPVPTYDPPMSGFVRNFDMEMAQPNEAIVIDDNGRVVPSKKRRKPQPHLV
FT                   CANCESALLVSESYRSPTDRVYALRCGHLIDQRCLHDLITPRTPHELASVDRHPDTLDE
FT                   PPTKKRKSGRKPKKVEKIPDEYKWTCPVEGCGQKHTSKELGGAWMNVEGEGAISVFA"
FT   CDS_pept        join(complement(287373..287420),complement(286891..287239),
FT                   complement(286708..286832),complement(286591..286657),
FT                   complement(286446..286552),complement(286325..286393))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806627"
FT                   /locus_tag="CNG01030"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW44554.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG177213"
FT                   /db_xref="HOGENOM:HBG271778"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015464"
FT                   /db_xref="UniParc:UPI000042C644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEC0"
FT                   /transl_table=1
FT                   /translation="MSGQGQNFSEEERQAAYYAQQGYTPEQITAALGGSSGAGSSSSYA
FT                   EYSVGPYPSSSYAPTAAATTGPYPAAPSSYQQTLYDSDILQQSSVYTPEGAAEASKHVP
FT                   KKQGKRATVIRKGNGKVWEDPTLVEWDPKWFRLFVGDVSNDVNERTLDEAFAKYPSYCK
FT                   CKVVRDRLSLKAKYAFIAFKDPEDFLKAWKEMDGSTKIGKYVGNRPIRLSKIKDDKYGS
FT                   IKTVEISGKKARALEKIRKNHGKPLNGRPVPF"
FT   CDS_pept        join(287803..287947,287998..288242,288290..288362,
FT                   288412..289916)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789287"
FT                   /locus_tag="CNG01040"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44556.1"
FT                   /db_xref="HOGENOM:HBG177214"
FT                   /db_xref="UniParc:UPI000042FBD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB9"
FT                   /transl_table=1
FT                   /translation="MDAGTMDGILSEDPYLEYQPVLAYTLPIQLVVNGITGTLLCVLLI
FT                   HLLFTTQYHYPLAPLNYFLQLSSIVTVLISVIIKLVIILVHCTSQADMWPYSLDYVAVN
FT                   VPPETWSNGQNAAWCLLQALNAGLSNITHIQFLTLLYPSRTEARLIIFVLGPLALVSSA
FT                   LTFAALTNSQTVLDISDAIRNVFNSTLLLIFTISLAIWGFFVNRRRAWRFDGGTAAFGV
FT                   GSLFLATISTTFNFVAVAEDGIEWLQHLLFAAILWQIWLGWWWWVGSGMGIGEVEDIMA
FT                   KAEKKKRKQAKAAARARAAAARERDALGGLDARKRTNSFAGLADGFTSGVTSILRTSRG
FT                   AGTLTRRQTRRSMADEGLAEEGAMELDDLGEGGRRRHDGRTSPIPPVPPLPGANNSNGS
FT                   NSNNGSSNSPDPHVEFSQPEAGDPASSSSGGGARNMQSTNSETSSTSATPSLHPPQTVG
FT                   QLFSYPTTWLVVYLRRLRRAHQEAAKKAALERAERRERVFAEGHHHRSGERDRGEASSR
FT                   ERAARMGAAIAGGDDVGWGLGKFGIREHEESARRLKRAGEMLNEDRLLGSSSQVGRDRN
FT                   RREQSGREGGGETDGEWEDIVTNSSSNEGKRRKGKKGKGKAGNEDGDHEGGGEALRGQG
FT                   SGWSWWGPLKDWRLNDRQVY"
FT   CDS_pept        join(complement(290723..291113),complement(290172..290671),
FT                   complement(290017..290124))
FT                   /codon_start=1
FT                   /gene_family="HOG000165297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093384"
FT                   /locus_tag="CNG01050"
FT                   /product="Putative uncharacterized protein "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAW44557.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG270150"
FT                   /db_xref="HOGENOM:HBG557481"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00004B48C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB8"
FT                   /transl_table=1
FT                   /translation="MDDADPINTFFPDATESTLPTILYTTLSLTSSASAADIRKSYRRL
FT                   ALQFHPDKHSAKPESEREKLSKQFQRVGFAYAVLSDEGRRKRYDETGRTDERFAGAEEM
FT                   GWDAYFEGLYKRVDRKILDEDKEKYQGSDEEKDDIISAYNSTSGSLPDILSYIPHSSHT
FT                   DESRFITLINSLIADGELESTPKWKKTSTDEKARAKRAKAGEKAAKEAEEAAKELGVWD
FT                   EFYGSGKKGKRQGDKNKEEEGGEATLQALILKRQRERGNAFDAMEEKYRKLEEESRAKK
FT                   KAKKGKGKKEETDEIPEISDADFEALQAKMFGTKDSGDSNKAQKKSKKSKT"
FT   CDS_pept        join(291328..291465,291559..291623,291693..291812,
FT                   291881..291944,292006..292054,292112..292194,
FT                   292269..292382,292454..292516)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806628"
FT                   /gene_name="CPR2"
FT                   /locus_tag="CNG01060"
FT                   /product="Peptidyl-prolyl cis-trans isomerase B "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptide binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="AAW44558.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0042277"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000042CC14"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEB7"
FT                   /transl_table=1
FT                   /translation="MNTSHPIPTTMASKSFLSLLVALFVAICFVLSPGVDAAKGPVITN
FT                   KVYFDIEHGGKPLGRIVMGLYGKTVPKTAENFRALATGKNSDGEDLGYGYEGSSFHRII
FT                   KNFMIQGGDFTKGDGTGGKSIYGSKFPDENFKLKHTGPGVLSMANAGRDTNGSQFFICT
FT                   VKTAWLDNRHVVFGHVLEGMDVVYAMENVKTSRGDKPVEPITIAASGELPIEHEVDEQG
FT                   NQVPFRIEL"
FT   sig_peptide     291328..291432
FT                   /gene_name="CPR2"
FT                   /locus_tag="CNG01060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEB7 "
FT   mat_peptide     join(291433..291465,291559..291623,291693..291812,
FT                   291881..291944,292006..292054,292112..292194,
FT                   292269..292382,292454..292513)
FT                   /gene_name="CPR2"
FT                   /locus_tag="CNG01060"
FT                   /product="Peptidyl-prolyl cis-trans isomerase B "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEB7 "
FT   CDS_pept        join(294323..295213,295268..295907,295965..296122,
FT                   296187..296272,296337..296620,296685..296715,2
FT                   96791..296959)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636620"
FT                   /locus_tag="CNG01070"
FT                   /product="Polyamine transport-related protein, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44559.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG068408"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B48C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB6"
FT                   /transl_table=1
FT                   /translation="MASNPLDLGPEIGLHPAHSTTPPTTSSDPQQTADLSNSEDGQWSA
FT                   GRAPPSLPPNLEHTYSAPVTAPSAAAAAADMPDNANPFGHVASATGENNEGAGQFGEGG
FT                   HGTTGAPAAIAGSDESPTPTLSSMNGAHAAHAAGVKSVSGHEGGYDINEKDHQAGTTGG
FT                   KSGPEFATLAAKDLGLTKEGQEEANEKAEHPSPLTATRKLSRTASGTKHAAHILTASGG
FT                   RTTEGLGMVPLARKMSSPPAVSPFGGVAPSGTDAERGLRAVRSREEEEERDLERELKGP
FT                   DPWAVSFEPGESINPKNWGVGYRWCLTTIAGLLVLNSTFASSSPSGIVKDMMAYFGFGQ
FT                   EVAVLTISLFVAGYCVGPILWGPLSESYGRRPVFIGTFFVYTCFQVGCALSKNTASILV
FT                   FRFLGGTFAAAPLTNSGALLADIWDGDNRGRAMSLFALAPFVGPSIGPIVSGFIQVSGT
FT                   NWRWVYWILTIFAGVCLAIIVLFVPETYAPKILAQKAKRLRKDTQEERWYAPLERQDHS
FT                   LKARLNDILCKPFIILALEPMLQAVTLYMSFVYGVVYLLFEAYPFVFVENHGFNTGEEG
FT                   LAFLGFFLGGCLSVLFFLTVIEPRFLRHAKEVAPNPPKPEKRLELCVISGVSLVIAMFW
FT                   FGWTSYSSIHWISPVLAGGLIGVGVLGMFVSLFNYIIDVYLWSAASALASATVVRSLFG
FT                   AGFPLFAVQMYERLGTQWASSLLGFLALLMAPIPLVLMKYGPSLRAKSKFSPNKISHK"
FT   CDS_pept        join(complement(299645..299779),complement(299554..299563),
FT                   complement(298839..299498),complement(298499..298788),
FT                   complement(298352..298446),complement(297588..298293))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806629"
FT                   /locus_tag="CNG01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44560.1"
FT                   /db_xref="HOGENOM:HBG068407"
FT                   /db_xref="HOGENOM:HBG177216"
FT                   /db_xref="InterPro:IPR013218"
FT                   /db_xref="UniParc:UPI00004B48C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB5"
FT                   /transl_table=1
FT                   /translation="MATRRSTRLSGELDAGNKVVNGKRKGAACGKDDDGEIGTRKKKQG
FT                   GKKSTFQPQPVPLPNSADTPPSPTIPPDLPPPPPSMKIARRRESTRAIRERPLSESPPS
FT                   ISLLQPGIHPAKKQKVARGKSVDPLRGVAGTADDPLNGVEETEAMRNTGSVPFVQYLTF
FT                   SKSSKPRPSAPRPSSPPRRTFASSSAAPSSRTPSASAPTKSGAMGPPTGFVRKTRKSMG
FT                   RVQEVSKDMVMPIMDSETPVIRKNQELRGQQARRSSMDHRGGRASSTFDPYIAMPHKSV
FT                   DHKLFYRHIPTAYPDPIKTRMLLVWCTNRAIDENLKRSSASRKGKGKQKEVMTEEGDRM
FT                   LREVMEEFVQSMNRGSVDTSTYALPGQESVSFSGLQPHPRNVQNRKAEAEMAGAIRKYK
FT                   EEGAQWSAIVNATNNKQQETIRLLEKKMMTNAEPDMSKAAPWMQQALALADSIIAEEDD
FT                   SLQHTDDFEDVEYKVDTLHQTSHIALQYVLQASRFLDGIFSSLTADLRARDRLGLPPDL
FT                   PPHDTDGPDTTALLTSARLSAAPQSSASVSASSSKQPLGKSRPDAMSLLRSLASVESKD
FT                   QNDETVAAAAKVAPMLAISSMTPRRPAAGMTPRRHPLGAATPRGMKGMTPKPERE"
FT   CDS_pept        join(300165..300251,300331..300511,300566..300751,
FT                   300816..300848,300960..301057)
FT                   /codon_start=1
FT                   /gene_family="HOG000187923" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806630"
FT                   /gene_name="GET1"
FT                   /locus_tag="CNG01090"
FT                   /product="Protein GET1"
FT                   /biological_process="transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44562.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG177217"
FT                   /db_xref="HOGENOM:HBG737110"
FT                   /db_xref="InterPro:IPR007514"
FT                   /db_xref="UniParc:UPI00004B48C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEB4"
FT                   /transl_table=1
FT                   /translation="MINLALVIFLCTLLNQIVSWVGKSVLQEIAFTAYSWVFLSGTAAK
FT                   QRKLRKQVLEDKAELGRTSSQDEFAKWAKLRRKLDKGLADLEKTNNTLSSSRSSFSKKF
FT                   STLLWLMTTGAQFLLSWWFRKQPIFWLPEGWVPYPVAWLLSFPSAPIGSVSSGAWGAIS
FT                   TGPVPTGPSSAKNDQPEAKIEALALEHEKLD"
FT   sig_peptide     300165..300221
FT                   /gene_name="GET1"
FT                   /locus_tag="CNG01090"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KEB4 "
FT   CDS_pept        join(complement(302569..302609),complement(302349..302420),
FT                   complement(302262..302286),complement(302169..302178),
FT                   complement(301943..302109),complement(301609..301887))
FT                   /codon_start=1
FT                   /gene_family="HOG000022343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806631"
FT                   /locus_tag="CNG01100"
FT                   /product="Putative uncharacterized protein "
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAW44564.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="UniParc:UPI000042EF9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB3"
FT                   /transl_table=1
FT                   /translation="MATYTLPQIQKPAPNFAGTAVKEGSFEEIKLNDFKGKWTILVFYP
FT                   MDFTFVCPTEILAFNKALDQFAAVGAEVICVSTDSEFTHLAWSQTKRSEGGLGPDLKLT
FT                   LLADRNHAAAKAYGVLLPEEGVALRGTFFIDPKGTLRAMHVHDLPVGRSVEETIRVIKA
FT                   FQFTDEHGEVCPAGWEEGKDTIDTSAPSAYFSKQ"
FT   CDS_pept        join(complement(307630..308159),complement(307525..307583),
FT                   complement(307371..307477),complement(306797..307320),
FT                   complement(306631..306736),complement(306431..306573),
FT                   complement(306263..306380),complement(306030..306215),
FT                   complement(305816..305972),complement(305665..305759),
FT                   complement(305498..305605),complement(305269..305436),
FT                   complement(305143..305209),complement(305060..305080),
FT                   complement(304984..305000))
FT                   /codon_start=1
FT                   /gene_family="HOG000089118" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806632"
FT                   /locus_tag="CNG01110"
FT                   /product="Copper amine oxidase, putative "
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44470.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068406"
FT                   /db_xref="HOGENOM:HBG177218"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015328"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI00004B48C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB2"
FT                   /transl_table=1
FT                   /translation="MRAIALLYLLGTAFAVPSPKISNVKKPGHYHHPHRRDIVTNEVDV
FT                   SASSPTTSAPKDNIWNFLSNDEAAGIIAFLHSQTELNLTAVNDAGDWDNTITVVDLLPP
FT                   NKTEALSYMDGNGTKPERWGIASLLCGATEEPYAQDLVVGPLPVSEVTIYYPYTYGTHA
FT                   PDAKIRVYDMDDNSEFLSDIAMSMKDIISDILNATIDTADDLADTFDIWGIDPLWHQPD
FT                   ENGNDRVIYWAGFWRYPDSLQMENSTINFDGETLLPQGLYIQTDITGRDRSKWALMGIL
FT                   YGDDYYTSVDEFRAAWQKPGFKKFTPNYSGDWIGTDQTGDVMPFETEAPPMNVQPGGQR
FT                   FKVDEDNKYVEWMDFSFYLTFTRDTGMRLYDVKFKGERIIYELGLQEAIAHYAGNDPVQ
FT                   SGTAYLDTYYGFGPYAFSQVPGFDMPLYAYCMNTSFHAAELSTSHRCGISIFEADQNYP
FT                   IQRHSNMNYVSATKNIALTLRSISTVGNYDYNFDYNFYLDGTIETVVRASGYIQSAFYA
FT                   NNTEYGYQIHDSLSGSMHDHVLNFKVDFDIAGVENTLVKHIVEPKEIKYKWNNLTRSTM
FT                   HLVRKEITNEDEGKMNWSHNGQEQVVIVNKDAPNKYGEPKGYKVMPSRGGSGMHLTITN
FT                   SSNLFNSQGFATHQYYVLKRKDSELRASNAWNDYDTQHPMIDFSKYFDGEDIEQEDIVM
FT                   YFNLGMHHVPHTGDLPNTVFSTAQSGMMILPHNYLLSDPSRQATQQIRIDYNVNSTTDV
FT                   YSWASQAATGELDFSQITWDPYTYDGDVSVRKFPYDPQNPFNNTESIV"
FT   CDS_pept        join(310268..310807,310864..311232,311296..312924)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636621"
FT                   /locus_tag="CNG01120"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44472.1"
FT                   /db_xref="HOGENOM:HBG068405"
FT                   /db_xref="HOGENOM:HBG177219"
FT                   /db_xref="UniParc:UPI00004B48CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB1"
FT                   /transl_table=1
FT                   /translation="MPKAPPEDHRPIRACLSAPYPLPFIITTRHSASPTPLGKAQHPSA
FT                   FENTPFSTTCGPSGVRLPTEAPPPISPPKEPANNFFCYDFPTVNLDWKDIEPPYPPIPY
FT                   PPRDSEEIIRKRARRLRLLKEVKGNSESSEWDIITRSGGSYVGKDKGTVEDLDEEMQML
FT                   KTINEIAMVPVGGGDNVGINGPYDTSSGRNNLLRYAFLATVTKDDSVSPPSKGSRTATQ
FT                   AYPVPNTTPEDPKTNGGPNLIPVSVPSKAQSLLPDADHDLYAEKSMQKGPGWDVISAAS
FT                   SFCNEESKAEEADEECYDESPTSARLVTPAAALRRIRRPRKVAKALSLGLTNQSPSTYF
FT                   PPPKLLHQAQQSSIGDSDITSRPAPHALFDAMGGYGSESGSTRTVTQIKRGRWSRMGRR
FT                   TDDLDMMNHGVTTVLSSSGQAYLVQPTHQPRSLDLSTPTFNPTNQLEPSSALQLGDAQQ
FT                   SMLGFERFSFGPLAPLHHPSKFLSGPSFSSAEKRSNRRLSPNEQEQWSSLQPISIDPRT
FT                   AEASGGTSWPHPLPEREQAPSNGGTLRLASLAPEGQVDVPMPTASTAAQGISFGKTCHN
FT                   FLFRRKEAARRKKERMRKMGKDKDKDKRLRLLMPPPPVSMQFQQTHAQQEALMRQQQGY
FT                   TQNFQWFNAQPIWDGNSQQFMQQLPPQTQIPQGYLHIQPNWMPVQQMLMQPVRQSQQLQ
FT                   YFPYQRTIKGQTLQGYPQTLGQISVPIRSLATSQEGRPLRKRRRSLSPSSAYDFLPIHR
FT                   PSFQVPGAPQAHNTLLPPLKIISRLAGPSSKLTRATKHDDEQENGGELWDAALQNGDES
FT                   MDEEERKRMRRDKWVEEERDRMRAMNREKSAFN"
FT   CDS_pept        join(313536..313836,313966..315311,315363..315561,
FT                   315611..316421,316472..316872,316929..317269)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789288"
FT                   /locus_tag="CNG01130"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44475.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG068404"
FT                   /db_xref="HOGENOM:HBG177220"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B48CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEB0"
FT                   /transl_table=1
FT                   /translation="MAPFQPPLRLLLLPLHKPRFLALLILPLIVLLYKNQLSNPPTLKA
FT                   KVKEAHQGGSWEALTDVDDDWGTHEGIWGGDIKDWFGWKDKGRTSILITGGAGQLGQAL
FT                   IPQLINNYTVHVQDIVPRPPSLPSSIIYHRSSSTPPAEAYKSIFASNTFDGVIHLAGIS
FT                   LDVWCAAKEDECHEVNVGGTKALMNEVIAVNNKQFKRGKMWKNVRVPWVILGSTMEVFG
FT                   PEGTNEDSPKHPASALGRTKMEAEQVFEEAILDSPDEEGIRGLILRFPEVYGYHSASSI
FT                   PEAFIPSLLTNSLTFLPIQYSSNQIPYDLLHAEDAIIGFVKAISYIKGTPSGDVSTINL
FT                   ISGQRTPERDIVELVRKETTSMSPVRDIGDNRNPNAHEYFPAKAAEILDWRAEITPPVG
FT                   LGKAITQLTGDISTYFRSYLHEHCPPSADFPAPDGDFAVPFIEDERNKPLWKLDGCTVN
FT                   LGFNHEGWLHHLKCHDGKHCNVDDVKVTALNWNQSTFIIEKVEKKKRERIVRVMLKEQN
FT                   GMGYLGMTQTEGEVGLELYKDPKEGQTVFDLEVRRDSSDLRLLVPDSEMQLHAVSNKTD
FT                   GSTWFTVEPITRWVDPHFDMRINVLCCPFEGDWPLLLDDYESADVRFGSTGEIPFDSTR
FT                   RSHLCTRAEQAVRYNFKHLSTARQAVSKVTGTAGHAFFNETGPKTDPHPHAWALKDLPP
FT                   CWNDCESPTVCVQTGNCKCVQADHCKPRRENPLLKIYPSNSLHPDENKSPVGCLDGHSS
FT                   VLTHAVEAVDWKDVLLPAARAALEAHPDFVKVHVADGYKGQEEIEAAPCHRLQETNCFS
FT                   ADSIMYKSLRHISVPADEAELVVLPVYQQCTGVQFLLHDAMQHASETIPGVKNEEKTVA
FT                   LVLTHDWGICIDSVWDIWSARDQHAFHPDRILNNVLVWSVMGDYDSPCYRPHQDVVVPA
FT                   RTCHTNTLRATFSNVGSIKPMRERLNLLTWSGTYEVAGKSERIRLTCGRGGAGDRELIK
FT                   GGGKQSNFANGDYMNDLNNARFCPQPRGITGWSPQTNDAIYAGCIPVFISEGTHYPFAD
FT                   FLDWSKLSVRVAPTELDKIEKILAAIPLSKVEELQANLVSMREAFLYSGDEKPEEELER
FT                   RGPMFFALHEAGMRIRTRYPVKEEE"
FT   CDS_pept        join(318730..319062,319375..320226,320275..320993,
FT                   321059..322487)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636622"
FT                   /locus_tag="CNG01140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44477.1"
FT                   /db_xref="HOGENOM:HBG068403"
FT                   /db_xref="HOGENOM:HBG177221"
FT                   /db_xref="UniParc:UPI00004B48CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA9"
FT                   /transl_table=1
FT                   /translation="MSGTLDNHTRTSGTAPTSLHLSDSVAARDTMAAPTLPAIPPISPL
FT                   PPPSPSSSFSGLHRPSSALAAIAYASPSGSLTTDRSYQRPLAHSLTVHIPAPLTPSPSD
FT                   TDLPPSPMESHVEPTSSSVPVRTQSQSQPSPPPSSSWPPLNVLRTEPPASSQPMQLPAQ
FT                   HQQVPPTFYHKHQQNKSASSLPVIPGISDAGPYPSSNSIRQPQGPPKPQVQQPKPNLGL
FT                   GRPTAPPNGAGSSRNLQEEVCLECMMRDRDLADVDVQGEDVWDRESDAGFIELVRREEG
FT                   LLRSMGSLDSAETSAAHGKFRSVIDMDDTSSSDECSQNAGSDGPETRRHREEERHRKQA
FT                   VKARHKEADWRVSKEVGWRGFSWEEGQGGEGLPAGFRGGKGGPLTEEGIKSIMAKFPSA
FT                   SAHRYQKLQDFLRNQWLLVLEIRAEAQRLGHFAFPDDLSCDSSLSSHEARFPTGATSSA
FT                   SYSYRRPLLPEQTGGLRQSPSSPANLLASPVAPIATSRSNPQRPMTQYLPRREPAREFR
FT                   TPRGYDSSSVGKRGHSKNTSSTSALEPLTINTNVKGTGDDGRRIDDDDLWTPDQPQGLR
FT                   PFSFAVRAGAAAAREGSEGHGSVRDGSGQRKSLWGRWGGSVTSFFGGSQGGSGSMVDMH
FT                   LGLDNERRSRAISQVYPRAISLASPTRPSFFSRDSRGSSVLDHEPRMSRVISQSRLSQV
FT                   HTGGEGDMEDDGKAEKKKGIKGFFKKMKPKGSRKNSKAESPNLSNYRQSSSTQEYNPRP
FT                   SASSVPSAPETPLALPPPISVLVRGGDRGHARTGSGSSSSMLTDGQESVSNRLSGSHLY
FT                   GSRSVSAPFGSTSTSDVSMGQSASPGSSKFATTTSAAKRESYASGGNRRSTTIGEMGED
FT                   RRSVVEILSNANGANGDRLMCDEPMPVRPCAARPHNKTSTSLSASSQTMLETPPPINYS
FT                   NANAFFNHQQHIRSSSIDTGGSLSPNRYKNLPPLPPPGSNDNLHIVHPKGSTASPDSFS
FT                   AVFPDQELSQNKASFYSYPQPQPVAQPSYRQYPQRFHQQQHFQPTVSYAPGYGYGGRAS
FT                   LDQRGSRPRVEKQRAVQTMYGHPMMGMDGMNGMGGTAEVGEVEKKKKGLKSFFGVNKAG
FT                   RMA"
FT   CDS_pept        join(323292..323325,323393..323428,323482..323500,
FT                   323552..323591,323643..323728,323782..323929,
FT                   323983..325008,325058..325458,325505..325736,
FT                   325796..325870,325951..326100)
FT                   /codon_start=1
FT                   /gene_family="HOG000135922" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806633"
FT                   /locus_tag="CNG01150"
FT                   /product="Spermidine synthase, putative "
FT                   /function="binding"
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="AAW44479.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG177222"
FT                   /db_xref="HOGENOM:HBG736226"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000042D02D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA8"
FT                   /transl_table=1
FT                   /translation="MAVSQSHPNIVDGWFREINTQWPGQAMTLKVKQVLHQEKSLFQDV
FT                   LVFESETYGNVLVLDGVIQATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIRE
FT                   VLKHKSVKKVTLCDIDEAVIRVSKQWLPLMSDCYKDPRVEVHIGDGFKFLPEHKNEYDV
FT                   IITDSSDPVGPAEALFQPPYFQLLKEALKEGGSVSTQAECLWIHLPLIKTLKETCSKLF
FT                   PVVKYGFTTIPTYPAGQIGIMVCTKDSTRDLTVPLRAVPDTRYYNSEVHRAAFTIPEFG
FT                   RAMLEDGVNVLPKFSGARPTTTKKKVLLLGSGLVAGPAANYIARHNHELTIACRTLASA
FT                   EELASGLPNATPMSVDVSSADALRQAIKGHDVVVSLIPYTHHAQVMEAALEEKVHVVTT
FT                   SYVNPQMRALEQKFKDAGLICFNEIGVDPGVDHLWAVKVFDEVKKAGGKIKSFYSFCGG
FT                   LVEPAAADNALGYKFSWSPVGVLMALNNDGKYLKDGKVVEVAGKDLMSTAKPYYFTPAY
FT                   NLVAYPNRDSTVFREFYGLEGVQNLCRGTMRYAGFCEVITAWKEIGLMSDAQVDYLAQG
FT                   AAPITWIKVISQLLGVEAKEAAIIEKLKTLKSFETESRVLISKFRDLGLFSEEQVAQRG
FT                   SVMRALSALLEEKCAFKEGEVDLVLLQHTFEIINADGSEQTITSSLEAYGDRNGGPSAM
FT                   AKLVGVPCGMAVQFILEGVLNKPGVFAPYDEETCKLFRERLEKEEGITMVEKLV"
FT   CDS_pept        join(327092..327616,327751..327840,327892..329877)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806634"
FT                   /locus_tag="CNG01160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44481.1"
FT                   /db_xref="HOGENOM:HBG068402"
FT                   /db_xref="HOGENOM:HBG177223"
FT                   /db_xref="UniParc:UPI00004B48CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA7"
FT                   /transl_table=1
FT                   /translation="MPLYEPTTPPTPSPAPRQLVSLPHRAVTQRYPFSRRMPSTRPSSA
FT                   SYSQYRDPDTDASLSFDTDVPIETQSCMSEDYLDSGSDIESVVDAGSDNQLADDEDDEV
FT                   DIDTALQESASLPRTPILFAGKKRARDWEQTLEGDGDDEAEAEVVLGWPVRKGKSGKSK
FT                   AVGRKPNKFAKRLSTSSNEKMAPAQMGRVVSMGGITKGISDLSASSTIISMNVDIAHAN
FT                   PTQDSAHTSEAISRAAGCRITSRRLKNRHNCSNKREKRKRGTRHFQQLTASDDPFVTLP
FT                   VLQNWKGLQRFNTEVSEMDVSEAETDSRYDSDATMKSASDIERSTIDVIVPRAVVKSDV
FT                   RPRYEPEQPLSNKQLASLDCELTKSSRGIQRLPRHRNFPVRAAGQHGTSQLRRTSPTSL
FT                   LPARQVMTRRGSLRAPLRDSFRDYLDNIRPGADRRVPGRCEFTPVMSGELFIALLRAKA
FT                   VARKARRDAIKAFNERTKDGAWRAWVGNYALREFIPPVRQWWLEDLAPQDEEAAVENLL
FT                   PTDEIRELPSSSLADCTYESQPPTRKRTHSETLMSDSMPAEVPAPDRQVRQRTVIEPYN
FT                   ASSLRRQRAFETARRVREAAQQSLLEMLRLEAERIAHEREEEERLREEARSAEFRAAQE
FT                   EADARIARELELEEAAINNGPEVESVDDEPDEPRRAPSPAITEASIRSDPPPYEPPSQP
FT                   RNEPSASPSARYIPYRSRPRTPPRGPESLPTYTLDRWSASSPPPPPPYNAQTDRQTIIA
FT                   PRIVPEEEAPREHEVYHFGGIVRRCSSARRDTSPGPAHRIAGAYPGPSQQVRIIAPVPE
FT                   RPHVDAARAFEVAVDLEEGEDVEQEIWEEERGEDEPQPVGALQRVLRFVWGRRQ"
FT   CDS_pept        join(330746..331127,331187..331763,331824..332360,
FT                   332415..332542,332651..332691)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093385"
FT                   /locus_tag="CNG01170"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44483.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG068401"
FT                   /db_xref="HOGENOM:HBG177224"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B48CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA6"
FT                   /transl_table=1
FT                   /translation="MSNKAQTALFFSVHQLSNQPQHEDPHASYQPSTTSTIAPEIEEKA
FT                   LSTSKTPSLKVDHFSNDAKNEENGGDIDGENDSLRTSGEGQLGITDEKEDQIPSRHGGL
FT                   GIKVSQRKKWGLLALFSLSLVIDQWCLAAFYILTPPITDSMQVPFAQQSWVITSYTVTF
FT                   AATLLFWGRVSDLYSAAPVFSYGIVTLGVLNLIISFLPERYSFFIFRALSGIAGSSSVP
FT                   SAYRLIIAVFEPHELNKAFTIYAMSGALANSTGNIIAGIIMLIPSGGQGEAWRWFFRII
FT                   SAIVLPVGVWSIFWIPRSRGENSDVNDKLARMDLPGCFMMLVAIVLLILSLTLGASNGW
FT                   STPGFIAPLIISAIIFPAFFVWESRIKSTHALLPPSIWHYHNFTLWVVFALLGYTWWSV
FT                   NFFALIEYWLEYMGEKAIIVSLRVLAEGVTPMVVTIVLTKWGRLMEFPRISITFGGLLG
FT                   IAAYIMFIFSGTHVGRDYWRYMFPAMLFGAAGMCIVFTATSVGAMCAVPASIGGVAGAT
FT                   LQVSFQVGAAVSFAVQAGLFTINEEVSGDTERIAAGH"
FT   CDS_pept        join(complement(333645..334137),complement(333406..333593),
FT                   complement(333219..333353),complement(332772..333164))
FT                   /codon_start=1
FT                   /gene_family="HOG000208981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806635"
FT                   /locus_tag="CNG01190"
FT                   /product="Putative uncharacterized protein "
FT                   /function="octanoyltransferase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /biological_process="protein modification process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44485.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="HOGENOM:HBG068400"
FT                   /db_xref="HOGENOM:HBG177225"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniParc:UPI00004B48CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA5"
FT                   /transl_table=1
FT                   /translation="MDHCIECGNDDNETRIVVLFVRFALNSILLGHWHQAWDYYVTQCR
FT                   PSEHLPPLSDPRRTFAQFLCVDLSFRKEIPPHLTMSRSLARLFSSEAKNLSLGPASCPI
FT                   GSSSVSASSSLPPLRYHIFKEPLPYPIGLKLQNDIIDRRLAAKSKDPIGSKGLGDIILL
FT                   LEHTPTYTTGRRDNTPNPNELHPEEKKVQNVGASFFITKRGGQVTYHGPGQLVGYPILD
FT                   LNVMETPTRCYVEFLQAMLGNYVRDTSALDTILAPHPDGHVGVFSSPTEKVASIGIHLR
FT                   HRITSHGFAMNITPEPIAWFDLVMACGLADVRAVSLHNLITRGAMRDRIMPSKLPSVQD
FT                   VARSIMPRFGETFGREIKALDDRDSGEAGEVWGLVQKAEQDAREKNANHGGWPSEPDST
FT                   QRA"
FT   CDS_pept        join(337206..337490,337545..337907,337956..338952,
FT                   339007..339455)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789289"
FT                   /locus_tag="CNG01200"
FT                   /product="Putative uncharacterized protein "
FT                   /function="acetylglucosaminyltransferase activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44487.1"
FT                   /db_xref="GO:0008375"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG067520"
FT                   /db_xref="HOGENOM:HBG177226"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="InterPro:IPR013994"
FT                   /db_xref="UniParc:UPI000042E70D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA4"
FT                   /transl_table=1
FT                   /translation="MYSQLLVLALAFMTSVDARPRLERQSKYHRRSLIEKRATSATSVS
FT                   GWSYIGCYKDNGDRTLNGDKKISTTMTPSVCISYCSGLGYSYAGLEYYDECYCGNSLDS
FT                   SKTSDDSQCQFACAGDSSQKCGGVYQLGIYQLGGSTTTTSSTTTKASSTTSTSAAATST
FT                   SAAATFVGCYKDNGDNRTLNGSKKVSSSVTPSVCNSYCSGLGYTYAGTESYNECYCGNT
FT                   LDSSKAADNSQCQFACAGDSSQKCGGAYYVGVYQLGNSVTTTSTTSKASSTTTASTSVT
FT                   VSANAAVTSTVGVAAVPSASSTKALYAHHMVGNTYSYIQSIWANDISLASAAGIDGFAL
FT                   NYGIDTWQPARIADAYAAAKAQGSFKLFLSLDVSSLSCSTASDAATHVASIATYATHSA
FT                   QATYNGKVLVSTFSGESCTFGQGSVSAGWTYFRSLLTAKGISIYFLPSIFSDISTFSSN
FT                   SWMDGEFNWNGGWPTGSTALSTSSDISYMSALGSKGYMAPVSPCFFTYYSPSSYNKDWI
FT                   YRSDDWLLARRMEQIISMRNSFDMAEIISWNDYGESHYIGPIRADQPNSQGWTAGMPHT
FT                   AWLNLIAYYAPAFKTGSYPSASDQMILWTRPHPKAATPTAPTCARPSYWNNTDDNLYVW
FT                   VALKAAATVTITSGSNTGSWSLPAGVSKIGIASAAGSITGKIVRSGTTVKSYDSSGSFS
FT                   YTL"
FT   CDS_pept        join(340072..340438,340497..340672,340717..340925,
FT                   340977..341526,341575..341660,341713..341968,3
FT                   42020..342508)
FT                   /codon_start=1
FT                   /gene_family="HOG000208954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789290"
FT                   /locus_tag="CNG01210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44489.1"
FT                   /db_xref="HOGENOM:HBG333844"
FT                   /db_xref="HOGENOM:HBG737060"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniParc:UPI00004B48D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA3"
FT                   /transl_table=1
FT                   /translation="MTVDMSTAKEVKLLTLLNVSAVKRPRELDLPGGHRSSPSLKGTST
FT                   QQNSEDGESKKRRKSVVWGGEVGPSGSHYLKGSGKREKGKAKEKTVEMNENSANGDAAE
FT                   IVEDDDEQSDKEEEAITSDLFNIHFSAAPPILTSEALSSAEGNQWKSERKSLKGFGRVV
FT                   ELTPEKSAFGFVENQKTRITPSLLPAIKDSSATIPLLSTYLSHLGTYKDYYLHSLDGEA
FT                   DGSETQLIGQHKEAMRKAAVIHSVNHVLKTRRRIIRNNEKLAHAASSDNSTSVAEPPRD
FT                   QSFIRPKVLFLLPTRSLALSYIKTHLFPLAPAGTQIENQRSFVSSFSLPQDEEDPLANP
FT                   STSADFPIDHLVNFRGNSDDNFRFGIKITRKAWRVVMMPANEEKLIDCDILISSPLGFK
FT                   MAAEREDSTDLLSSLEICIVDGVDVMQMQNWEHVQFIFNNINQIPKSPHGCDFSRVKPW
FT                   YLESQAKYLRQTIIFGRYDTVEARALFNRSCHNLQGKVRSERNDFGGVMDRVRPGVRQV
FT                   FERFDLEGPKGMNGEAAVDEVEKRLKFFTENTIPALLRAAISRQNTLIVIPSYFDFVRV
FT                   TNYLRKADKVSFAAISEYSSNAEISRARTLFFKGKKAFLIVTERFHFYRRYKIRGAKTI
FT                   VFYSLPDHAQFYSEFMDTPFLASKNKSEDEVDIDEAEVSSRVLYSRFDALKLERVVGSE
FT                   NARKLLKTSESRFEFI"
FT   CDS_pept        complement(346430..347464)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636623"
FT                   /locus_tag="CNG01220"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44491.1"
FT                   /db_xref="HOGENOM:HBG068398"
FT                   /db_xref="HOGENOM:HBG177227"
FT                   /db_xref="UniParc:UPI00004B48D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA2"
FT                   /transl_table=1
FT                   /translation="MTLITTSLTTSPIMTHPDVLPVILSFADRQTLSRCMQVSWKFFNF
FT                   ASPYLYSNIRLIPNEADAFLYGASFGPIIMEDGSERDLKRELLAMVKVLNIEKHQGCNG
FT                   FLATACSRWRGLGIEFPSLNVLRVWMGPNMFEGGWFNCPWIPNMSPQKLVMRNVTAISA
FT                   GNSYTFAPRDLLRKVQKVVVVVPKLRNLSEINQDALRSHRRTSESPIEPGTETVIVFWT
FT                   EGPDSGWWAEAPLADYDNIIDQLVMCSLAEADRLTICNAGSIYPVVSENGDCVAYVSYQ
FT                   EREGEVAAAVKRKIEQISRRRGELARLGKRLESLRFMSFGEYLGKEDWKGEFDPEEMAP
FT                   WVLS"
FT   CDS_pept        join(348117..348326,348373..348762,348813..348866,
FT                   348922..349318,349381..349580,349640..349779,
FT                   349821..349935,349998..350191,350250..350364,
FT                   350432..350620,350689..350830,350889..351008,
FT                   351128..351227,351282..351310,351368..351486,
FT                   351542..351562,351617..351715,351779..351783,
FT                   351836..351917,351973..352029,352085..352242,
FT                   352305..352625,352683..352788)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806636"
FT                   /locus_tag="CNG01230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44493.1"
FT                   /db_xref="HOGENOM:HBG068397"
FT                   /db_xref="HOGENOM:HBG177228"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="UniParc:UPI00004B48D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA1"
FT                   /transl_table=1
FT                   /translation="MTSTKYGIHAYPPKFSDPQFIKRLMADYGQRSMPRPGKGPERTET
FT                   SDVDRFQFWPDAIAMGSLKGRQFTQVFGAACIKGYDERSHGRSILAFDLKREVLVIKAE
FT                   MKLDPKILPPALNPLYAELSFDDINHQGIHITKRPLPDGLTQKDALEVTVTVSCRRPPK
FT                   FFAPFDPGDKAPDYMAGTKYLIDRRRATALDFAVSGVNERDANAIPAIPEGPCAYPTFW
FT                   NTYRWVFRMGTRQYDKLLACAHKIRALAQADPEMDLMSLTSERARWTVRVLTGEDFKRV
FT                   YAPPDLSAIPFSTRTLLEGLIGHGIMAPSDTAELIAMLRKVSSSTAFHDRILEALFSQQ
FT                   KIRDIKHLIPKLAAFLRRRPPYIQPHLVLIRTVLVTPTRLLIGPPQYEPSNSVTRRYHD
FT                   KLDGIIRVQFTDEEDRLFIADNMKLIDSINPAVGIMARVRRALQFGLIIGGETFYPVAS
FT                   SASQQKEHAMWFINNKVIDGLELRNWMGTVHETVVAKHAARMGLPFSTSRIVNMKINIG
FT                   EELPDIERNGRCFTDGCGIAGREVLNQAALALNEKVGINSQPSAIQFRLGGAKGVLSDW
FT                   SQLVNEYEIRLRPSMIKFKSDLADLNVIRIAKYQAAFLNRQFINIMCANGVPHELIIGI
FT                   FEDAIADIKGFKDRVWNNAVTENDQQLIALCNDFPLAQLIKSGFNENPLLLDVAAIIEC
FT                   RALQDLKWRARVKLLDGVYLIGIADETGTLKEGEVFCQFQENDESPPKIVVNEVLVCRA
FT                   PACDVRRAWAVDNPELRHLKNVIVFSTQGMRDMPSMLGGGDLDGDDYTLIWDQRFVQSL
FT                   KVYDPMDYEAPDPISVKHVTQKHLNENFVQYILNDVLGQVDNCHLALSDMYTPFDPRCL
FT                   HLSEIHSTAVDFAKTGQAAALDPSLRPKEWPDFMDKDDVKVVYESTGILGKIFRIVQAD
FT                   AHFSPSDLEQMGYPTDPRITRFPLHESLLDRLKPLKASYERDLQYDMRRYRVYEPEIPS
FT                   GIAIRNKRRKRVRDQNLNEPLREAYNLLVNNVRETAQKIVNDFEFKTTLTPMQVVARHC
FT                   YALTYEEVHVRQWEQALAEGKFGEKPEDDEDSERLRPKPLISFAWCFCQELVQIVSQSA
FT                   STPVIPVAVAHSE"
FT   CDS_pept        join(complement(356233..356306),complement(356045..356176),
FT                   complement(355852..355994),complement(355722..355783),
FT                   complement(355554..355669),complement(355417..355500),
FT                   complement(355308..355365),complement(355211..355255),
FT                   complement(354751..355148),complement(354641..354700),
FT                   complement(354482..354587),complement(354037..354420),
FT                   complement(353919..353984),complement(353717..353863))
FT                   /codon_start=1
FT                   /gene_family="HOG000209153" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806637"
FT                   /locus_tag="CNG01240"
FT                   /product="Laccase, putative"
FT                   /EC_number="1.10.3.2"
FT                   /function="copper ion binding"
FT                   /function="laccase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44497.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008471"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068396"
FT                   /db_xref="HOGENOM:HBG177229"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI00004B48D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KEA0"
FT                   /transl_table=1
FT                   /translation="MRGLAKLFFLSCSFVSLVSSEKTDESPTAVSDNYMPKATATIDPS
FT                   VFALSNDFEITDVPTTREYTFDIANAFASPDGYEREVYVVNNMFPGPVIEANTGDTIIV
FT                   HVNNHLDEGQSLHWHGLRQLGTAFMDGVPGITQCPIPPGGSFTYNFTVSHQSGTYWWHS
FT                   HYSNSMADGIWGPLIVHSPNEPLQRGRDYDEDRIVFITDWMHDNSEIIIAALATPEGYK
FT                   GNIAPPQGDAILINGRGQTNCTATGSSSCFYPPPPEIQVPVNCRVRLRFISATAHPMYR
FT                   ISIDNHPMEVVEADGTAVYGPTVHEISIAPGERYSAIINTNEGKEGDAFWLRTSVALSC
FT                   MFGAVSQEGLAVVRYTGNGIVSTEEPQTSAWSDLAGVTVPCTGLDQTYTLSPRDSLSAP
FT                   REPLQSHFFNSERGAFVNVLGNTFQGYGFNNISYQNQIFNPLLSIVQRGGSCENTLVSS
FT                   RTFPDFGPGNIIINNLDTVIDHPYHLHGNEFQVIGRGTGALSIDNLTNIDFTLDNPVRK
FT                   DTLWIQGGSWAVLRITADNPGVWALHCHIGWHLTEGKLAVIVVQPSAIGHMESPESWTN
FT                   LCANTDPNAFGPAKRSSSPSIQSSKTSSFQYLREVKGKVVKRRGAREA"
FT   CDS_pept        join(complement(363291..363317),complement(363123..363238),
FT                   complement(362986..363069),complement(362877..362934),
FT                   complement(362782..362826),complement(362325..362722),
FT                   complement(362214..362273),complement(362054..362159),
FT                   complement(361497..361709),complement(361384..361440))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093386"
FT                   /locus_tag="CNG01250"
FT                   /product="Diphenol oxidase, putative "
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44853.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068396"
FT                   /db_xref="HOGENOM:HBG177229"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI00004B48D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE99"
FT                   /transl_table=1
FT                   /translation="MDGVPGITQCSIPPGGSFTYNFTVSHQSGTFWWHSHYSNSMADGI
FT                   WGPLIVHSANESLQRGRDYDEDRIVFITDWMHDNSEVIVAALISPEGYRGSTVPPQGDA
FT                   ILINGRGQTNCTATGSSSCFYPPPPEIQVPVDRRVRLRMISASSHAMYRVSIDNHSMEI
FT                   VETDGTAVYGPTIHEMSISSGERYSAIINTTEGKEGDAFWLRTSVALACMSQGSTQVGL
FT                   AVLRYTGNGNITTAEPRTEAWTDLARHDTPCVGLDEMYALSPREPLNASKTALQSRVLN
FT                   SKLGTFVDVYGTSFEGYGGSWLVLRIITDNPGVWACHCHIGWHLAKGKVGCNVTSPTDL
FT                   FANCFVQMAVVVVQPKAIEDIQWSESWTNLCANTDPNAFGPARRSFP"
FT   CDS_pept        join(complement(367344..367744),complement(367104..367296),
FT                   complement(365853..367055))
FT                   /codon_start=1
FT                   /gene_family="HOG000138266" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581880"
FT                   /locus_tag="CNG01260"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44500.1"
FT                   /db_xref="HOGENOM:HBG068395"
FT                   /db_xref="HOGENOM:HBG177230"
FT                   /db_xref="UniParc:UPI00004B48D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE98"
FT                   /transl_table=1
FT                   /translation="MSERLAAETSKACSFLPPYGTQEGPDLQDILTQSSNLLSNLTTAL
FT                   NVFAGHQTEMRACLKRVREREEALMELKNRRKSTGAKAETAERKLAKMGPENKSLPHQT
FT                   ELLERLRSDMRQMDQDITTEETKIGDFKRQTLKEALSYKFGGLEELGEKMCIIGELGKL
FT                   LLEEVPLEETPVGYGRAPYTGYEKTENAVREATKCLGTVQFHAASSNPKPPGLPEPGFA
FT                   APLRTPSIPHDEHSIAVANEYADYPANAPTSPESKGKQRETYSVDVAEPYDGIEQNPYA
FT                   SKTTNGQQHIYSEFGGTRQVMFQDSNNDHPSASELAIPPAPGPSGTEHGEEKGHDYEYE
FT                   QQKQMDAEDAWKKLEAEEAAWKSQETAETLPNPHSPTETIPAAVPAPVAQESGDMYAPW
FT                   QPLNLKKENNIESPTTTLHDAPTPVAPAPSFAPIPLGEPTNHAPVQTEVLSSSELIPPQ
FT                   TSWRAGASPTPGASDFHTPLSSPNPGLDNTGLNNGPVDKEAPREYFPSNMGTGGKISAA
FT                   AFRKGTKPKTSMGPEDSPNTSAGSSVVSIGEVRRLPVPPHGPADIELPASPAPGTTKHE
FT                   DGYEEGRVASPPPVYQSEECLR"
FT   CDS_pept        join(complement(368136..368374),complement(367344..367775),
FT                   complement(367104..367296),complement(365853..367055))
FT                   /codon_start=1
FT                   /gene_family="HOG000138266" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581880"
FT                   /locus_tag="CNG01260"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44499.1"
FT                   /db_xref="HOGENOM:HBG068395"
FT                   /db_xref="HOGENOM:HBG177230"
FT                   /db_xref="UniParc:UPI00004B48D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE98"
FT                   /transl_table=1
FT                   /translation="MSIRNTSGKFSLGSFGRKVSGIDRASSPTKDLGSNEDDHSPVRES
FT                   HGAGLDGLGKKLKGSLAHNNLLPALGHKDLRALQDIISSEKGVLQMSERLAAETSKACS
FT                   FLPPYGTQEGPDLQDILTQSSNLLSNLTTALNVFAGHQTEMRACLKRVREREEALMELK
FT                   NRRKSTGAKAETAERKLAKMGPENKSLPHQTELLERLRSDMRQMDQDITTEETKIGDFK
FT                   RQTLKEALSYKFGGLEELGEKMCIIGELGKLLLEEVPLEETPVGYGRAPYTGYEKTENA
FT                   VREATKCLGTVQFHAASSNPKPPGLPEPGFAAPLRTPSIPHDEHSIAVANEYADYPANA
FT                   PTSPESKGKQRETYSVDVAEPYDGIEQNPYASKTTNGQQHIYSEFGGTRQVMFQDSNND
FT                   HPSASELAIPPAPGPSGTEHGEEKGHDYEYEQQKQMDAEDAWKKLEAEEAAWKSQETAE
FT                   TLPNPHSPTETIPAAVPAPVAQESGDMYAPWQPLNLKKENNIESPTTTLHDAPTPVAPA
FT                   PSFAPIPLGEPTNHAPVQTEVLSSSELIPPQTSWRAGASPTPGASDFHTPLSSPNPGLD
FT                   NTGLNNGPVDKEAPREYFPSNMGTGGKISAAAFRKGTKPKTSMGPEDSPNTSAGSSVVS
FT                   IGEVRRLPVPPHGPADIELPASPAPGTTKHEDGYEEGRVASPPPVYQSEECLR"
FT   CDS_pept        join(370065..370163,370214..370230,370302..370331,
FT                   370426..370441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806639"
FT                   /locus_tag="CNG01270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44874.1"
FT                   /db_xref="HOGENOM:HBG177231"
FT                   /db_xref="UniParc:UPI00004B48D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE96"
FT                   /transl_table=1
FT                   /translation="MMPGMYPGAGMGMGMGYPGMGVMPYGMMGGGYGMPRYGGMYGGGY
FT                   GGYGGYQG"
FT   CDS_pept        join(372215..372596,372653..372861,372911..373270)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806640"
FT                   /locus_tag="CNG01280"
FT                   /product="Phosphoglycerate dehydrogenase "
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="AAW44502.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG453194"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B48D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE95"
FT                   /transl_table=1
FT                   /translation="MDLPAVKLTITSPSPTTPSDPPPVSPYLPTPPPEALLPSSLAAVY
FT                   VPTPIHPTALAYAKTKFARVIPSHEMSPEEAWPLTNGVICRANLITREMLDKEGKLMGL
FT                   AIVGVGYDSIDIEGCKEKGVTLMNCPGENSQVVAELTLSLTLALLRRVPELDRRLRAGE
FT                   TMLSINNLGRTLRGKVVGMVGISATARRAAAIFHHAFDCTIRTFSPTSPPTRWSPSHPS
FT                   GPLPHTRHSSLSSMLPLIDILTLHCPLTPSSRNMISTGQLRMMKKGSVLVNLSRGVVVD
FT                   EVALADELRREQNDDAGVRRVWGAASDVFVVEPIR"
FT   CDS_pept        join(complement(375537..375605),complement(375431..375476),
FT                   complement(375326..375378),complement(375177..375266),
FT                   complement(374873..375124),complement(374562..374819),
FT                   complement(374029..374504),complement(373627..373978),
FT                   complement(373568..373579))
FT                   /codon_start=1
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806641"
FT                   /locus_tag="CNG01290"
FT                   /product="T-complex protein 1, delta subunit (Tcp-1-delta),
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44504.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000042D0F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE94"
FT                   /transl_table=1
FT                   /translation="MASAAVAPSGPGASISDSSFTDKGRPTEVRLSNMNAAKAVADAVR
FT                   TSLGPKGMDKMIQTSNGEVVITNDGATILKHMAVLHPAARMLVELSQAQDIEAGDGTTS
FT                   VVVLAGSLLSAAEQLLAQGIHPTTVAQSFQNAASKAVEFLEGISMPVDLNDRESLLRAA
FT                   RTSLNSKIVSQYSSTLAPIAVSAVTRLVTSASSNVDLRDIRIVKKVGGTIEDTELVEGL
FT                   ALNQIAMTNAGGPTRMEKAKIGLIQFQLSSPKPDMDNQIVVNDYRQMDKILKEERQYLL
FT                   NLCKRIKKTGCNVLLIQKSILRDAVTDLSLHFLAKLKILVIKDIERDEIDFIAKSTGAK
FT                   PVADIEAFTEDKLGSAELVEETNQSGAKVVKVTGVKNAGKTVSVVCTGANELVLEESER
FT                   SLHDALCVVRCLVKKRALIAGGGAPEIHVSRLLTDYSHTLKGKEAYCFQAFAEALEVIP
FT                   TTLAENAGLNPIAIVTELRNKHALGDRNAGINVKKGIISNILEENVVQPLLVSTSALEL
FT                   ATETVALILRIDDIQFSR"
FT   CDS_pept        join(375846..375959,376198..376574,376767..376794)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806642"
FT                   /locus_tag="CNG01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44506.1"
FT                   /db_xref="HOGENOM:HBG068393"
FT                   /db_xref="HOGENOM:HBG177232"
FT                   /db_xref="UniParc:UPI00004B48D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE93"
FT                   /transl_table=1
FT                   /translation="MPVVKKEELSQKKDSESEESGVEDEYEVEKVIKHRGKGRIVDLRS
FT                   ASAEEAVAAYWESQDKTAAAPRKRGRQEAYTASQASITPKPESSKQAAKKARTSTAANG
FT                   IKASVDKGEGDEGASDDDIDRQYSGNLDKYNDLKNWENVVQNIETVEQGEGGQLIVYAT
FT                   MWRPVDENE"
FT   CDS_pept        join(377533..377805,377860..377927,377976..378454,
FT                   378514..379135,379188..379614)
FT                   /codon_start=1
FT                   /gene_family="HOG000247211" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806643"
FT                   /locus_tag="CNG01310"
FT                   /product="Arginine-tRNA ligase, putative "
FT                   /function="ATP binding"
FT                   /function="arginine-tRNA ligase activity"
FT                   /biological_process="arginyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44508.1"
FT                   /db_xref="GO:0004814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006420"
FT                   /db_xref="HOGENOM:HBG450640"
FT                   /db_xref="HOGENOM:HBG695395"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniParc:UPI000042F06B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE92"
FT                   /transl_table=1
FT                   /translation="MASLQASDIPQKYSLPTIPEIQGVDPTRSVVEAFKIAAAKLVADA
FT                   WEEDVAKIYPAVEMGKKGADLSVAVVRFKRGKPADLEVWTKKVIDSFKADVFFSGLKSP
FT                   DNKFLHFTFNKESFAYHLLRQINLTAAASVADPSNHTLAYGTTTEGAGKHLVVDFSSPN
FT                   IAKPFHAGHLRSTIIGAVICNLHEANGWKVTRLNYLGDWGTQYGLLSVGFDKYGNEEEL
FT                   VKDPIHHLFQVYVKINNARDEQKKKFEAGETIPDEENIHLLAKKVFKDMEDGEPKAIAQ
FT                   WARFRDLSIEKLKGTYKKLNVHFDVYWGESQVSEESMERAVRIVQEKNLTCEDRGALLV
FT                   DLTKFKMDKAIVRKGDGTSIYLTRDLGGAYDKYQKYKFDKHIYVVQAAQTLHFNQLFKT
FT                   LELMGEPYADKLEHVTFGLVKGMSTRKGTVVFLEDIIAEATDVMHEQMKSNEAKYAQVE
FT                   DPEGTSAIIGTTAVKIQDMAGRRINDYDFDIKRCTSFEGDFGPFIQYSHVRLCSVQRKN
FT                   PNVLVPQSINEIDLSILNEPKVNDIIMHLALYPTHVRNAFLQSEPSQLVTWCFKLGHLV
FT                   GAAWETVKVTGQEEEIAKARLFFYVTTREVLASAMRMLSLTPIERM"
FT   CDS_pept        join(380142..380241,380296..380435,380492..380626,
FT                   380680..381042)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806644"
FT                   /locus_tag="CNG01320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44511.1"
FT                   /db_xref="HOGENOM:HBG177233"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000042D5DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE91"
FT                   /transl_table=1
FT                   /translation="MTSAQEITDCRIEINDTSLSIRIEPEEPNSAHPLTLNLIFEYPET
FT                   YPDVIPELIIEAIDEESGDLTEEEREKVLGELNSIAEESLGMAMSFTIASAAREALGVV
FT                   ISERLRKEKEEDDRRTREYEEAEAARTRGTPLTPDAFNVWRKAFTAELAAKREKAEEDR
FT                   IRALPPKEREDYRKRRERPTGKQLFENSKVLATSDEALYEEGAEEVDFSKYTREEREKE
FT                   RRKEEEEEERRRRGLVEGDSDGE"
FT   CDS_pept        join(386097..386372,386434..387387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806645"
FT                   /locus_tag="CNG01330"
FT                   /product="Pria protein, putative"
FT                   /protein_id="AAW44513.1"
FT                   /db_xref="HOGENOM:HBG068390"
FT                   /db_xref="HOGENOM:HBG177234"
FT                   /db_xref="UniParc:UPI00004B48DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE90"
FT                   /transl_table=1
FT                   /translation="MFLSPIFPSLLLAVCLLSNSASARAVSNFTLGSNERRATASTSSG
FT                   STLKCTTVSGIWLGFKYDFGCLCESDVESFCNNHGISSSWKTVISSHISSTGSSHFYPD
FT                   HAQPVCDGSGGYTCGSLSRSSNGQCGSTTCDLQKTSSNGGCCPRGQTYKDGKCCGTVGC
FT                   KRDGSQCTPALSCSTYTSNGICCSSGTSGWTGYTTVCCPKGQIENGSTGKCITNCQSGY
FT                   EYNSSKGKCEPICDISNGYVYQQTSKGKDICCKSGRKAFQTVCCPVNQPEVGETGVCCP
FT                   SGSQVTNGKCTTPTGKSTNHRRVARQFQEALTASPSYGLAANAKSALCPSGLAACPIGD
FT                   FISSGQYECLDPLADLQSCGGCESMGTGKDCTVIPGARWMGCNQGVCEVYSCNNGWKKS
FT                   ANGTECERLL"
FT   CDS_pept        join(complement(391431..391714),complement(391073..391378),
FT                   complement(390660..391025),complement(388678..390611),
FT                   complement(388480..388631),complement(388154..388420),
FT                   complement(388087..388095))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789291"
FT                   /locus_tag="CNG01340"
FT                   /product="Microtubule motor, putative "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="AAW44515.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG068389"
FT                   /db_xref="HOGENOM:HBG177235"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI00004B48DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE89"
FT                   /transl_table=1
FT                   /translation="MSRRPTTNRSGMSRTAPSTSISMPPPSRIPNRPPSVMSVSQASHG
FT                   RNDGDSRAASPQRKIRKTVNGSITNRKMETPGVGINTDGEINIQVVVRCRGRSQQEVDQ
FT                   ASPVITTTTGPISKMVTVETTPLPSATLSTFATASYGGTHQPATKTYPFDKVFGPEADQ
FT                   TMVFNEVAEGMLGEVLSGYNCTIFAYGQTGTGKTYTMQGDLELTNLDAPKSTAGIVPRV
FT                   LHRLFSILESQADTEYSIKCSYVELYNEELRDLLAPEYRGEQSGTGGLKLYEDGKKGTM
FT                   IQGLEETGVRNLKEALGMLDKGVRRRQTAETKMNTESSRSHTIFSITVHVKESGVQRGG
FT                   EDMLRIGKFNLVDLAGSEAIGRSGATDKRAREAGMINQSLLTLGRVISALVEKGSHIPY
FT                   RESKLTRLLQDSLGGRTKTCIVATISPTRSNMEETLSTLDYAIRAKSIRNRPEVNAHLT
FT                   KAGLLKEYVGDIERLKAELAATREKNGIYIPEDQWREMHENQVKQKSDYDEAKLKASVI
FT                   EVALDTKKKEFDEVSVRLLATVDELAQVREAEKQLTEMLDETKIVLDTIKTRLDEETVI
FT                   SQAYMQGEERLDAVAGGLKKVATESVNDVGGLFEKIGRSAIPSEVFLHSHSGPARKAKV
FT                   LGSNASAATQFGGELQGLSQGLRNGLSQLQSAHDNFGQEIQIEMEAYALKEQQATKHDL
FT                   AALDRSFVAFNDLSQKLAASNEKGQREASDLSKSLLTVKDEVQNSVREWAQGVSERSKS
FT                   MVDELLGHQQQHLTAVGSVLDSTASLVDAIITTAQKHLAAESASALRARDLAIQTSSSE
FT                   ITRLRSQNLLLAKLLSEEKAKTAKLRTELIGNLTSMIESFTDEQDKGLSAVVDKVKMEN
FT                   EKSVEEMEEFGEEARSVWEEGDGRRKLFEDEVRSGGERAVLQKGEGQLALGQVREGLRE
FT                   RLESYGQETMEEAEAHVEVVDGFCVKMAKSATSVANKSTARGKKNSEIIEALARNVKST
FT                   HEASQARSSAMADSIDSLTSTLLTSQSSSSATFSQAYSATESNLNSIMSSTADFLKSGI
FT                   QEDIPTGITPRKKVWNVQAEWERTGPREAVLASWRKRQESAEQSESENGVRDESQGW"
FT   CDS_pept        join(392038..392290,392354..392514,392568..392995,
FT                   393044..393501,393551..393658,393716..393729,3
FT                   93785..393928)
FT                   /codon_start=1
FT                   /gene_family="HOG000259600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093387"
FT                   /locus_tag="CNG01350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAW44517.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG320636"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI00004B48DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE88"
FT                   /transl_table=1
FT                   /translation="MRTTLYFTTVKASSSRVTLAPTARPLANHAAVISLSPGPTHLPCG
FT                   GLSSGAAIRHIHLTGTARREKQSLTSTTTHIVEARASFKDPVTRYEHLVKDKVLRSDPY
FT                   QRGIIQKLQRLWDDLKDYDPGPVPAAAVQPSSSIFSRFFSKGPSQSEVTIPLSNVPKGL
FT                   YLYGSVGTGKTMLMDLFHSTIPKQFRPTSQGGYGSIRIHFHAFMLDVLQRQHKLVVEYE
FT                   KAGLGKKDVLPEVARSLANEGRVLCFDEFQVTDIVTAMILRGLLERLMSFGVVCIMTSN
FT                   RHPDELYINGIQRQSFIPAIELIKERFEVVDLDSGTDYREIPRALSKVYYNPLSPTVKS
FT                   EINKLFDSFASTDPVSSEVVHNRKVHLWGRELNVPESSGSVAKFTFADLCNKPLSAADY
FT                   LEVTSKFGTVFVEDIPRMGLSERDQARRFITFIDACYENKTKLFCSSEVPIFQVFSDKH
FT                   GSAAEDAHMQEVMDELGLDPSAVGSSSLFSGDEELFAFARCVSRLSQMGTKQWSETAGP
FT                   LAGA"
FT   CDS_pept        join(394407..394493,394547..394604,394654..395012,
FT                   395063..396740,396788..397416)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806646"
FT                   /locus_tag="CNG01360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44519.1"
FT                   /db_xref="HOGENOM:HBG068388"
FT                   /db_xref="HOGENOM:HBG177236"
FT                   /db_xref="UniParc:UPI00004B48DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE87"
FT                   /transl_table=1
FT                   /translation="MGPSGLVISKLGIQATASDTHVRGLICLKVSLPKESPGRPGARWV
FT                   LFNSTPPALLSQPTIHPLPLPLPSSQSPHLRIASTLLSLPHSTSYPPAPSQPSILGGKP
FT                   YIDVSSTTGKVFVVVDSLGGSGRRGSFKGKTDSNGSTERERKDWLITMEFQQALESSVE
FT                   DDIYKVLLPIPRCLDNVIRFQILSPSTSTSSMNQVSVLTEPKMLPLPASAFDSDPSPYG
FT                   HDLINGNGKGVMREEGWEDGEDLEDEDYENDDQGSSWLEGRFQRYATLHLSRDMTNALK
FT                   STDILRLEWSFTSTMIDSTIPSLSISPKWDKYRPSMELNYTAVAPGSDTVVSLKVDVPE
FT                   GWAWAELIIESEGLAYWKGVDGEFEDEEREDPDRTAEYQDDDSFATVRPEQSGHLHRRS
FT                   RSRQSILSSNAAAGPSTATYLPRTSGSGSSISLMRQTLPTAGDAIDEFSFEMSSEQSPA
FT                   PKRPNTPLGSRVSLLPTSKPSTPSKRVKQSVSLPVAKSVKQGRLFDLYFYEHSDRAFSL
FT                   RGMLVPISHLALVSQRLPCPIPLVNLPHNGSTQCNIQCNNALYQDQTLPTSEPHLISIP
FT                   SANAFFWSDDSVSNSKRDKESGKVKGDMRIRLRRDIWGVVSMSMLFAFPSRGDEVGFIL
FT                   HPSTPNSNAHDNDIKGRTVRVTRASMNGQPIPRCLHRWQDGKTEVRIGKKEGREDSGLV
FT                   EIILEIVGQEFSLPTFEDAEGMGIVELCGEGWEVVKPIMQTTLTPSPNDTYSYPLSTPC
FT                   SISFQPPSAPQISTTSRARTLFSFSTFFNLFMLWLLLSMGSQIQRLRNEVSYVAGEARD
FT                   LRMYGYNPSSGGTGEDRGDECLDRTLRDGGVKGVKDESTVTLGLTHQIPLDESPSLSSS
FT                   DKLVSEASPQPPSPHPTAPNALAPRQQRHLWAGWDRLVMHPTVKSLTKGVAWLWHAVVW
FT                   LVVPPI"
FT   CDS_pept        join(complement(403593..403696),complement(402840..403537),
FT                   complement(402538..402788),complement(400023..402472),
FT                   complement(399905..399966),complement(399778..399849),
FT                   complement(399636..399727),complement(399461..399585),
FT                   complement(399259..399410),complement(399116..399202),
FT                   complement(398946..399064),complement(398809..398896),
FT                   complement(398632..398754),complement(398258..398575),
FT                   complement(398006..398207),complement(397825..397948),
FT                   complement(397718..397768))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942399"
FT                   /locus_tag="CNG01370"
FT                   /product="ATP-binding cassette (ABC) transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44521.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG734884"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00004B48DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE86"
FT                   /transl_table=1
FT                   /translation="MADSSWVSAASKAISDSSCDKVWDGIDFSSCFREKYLQNVPYLLI
FT                   AASALYLLSTYPSRWARRSQDPLSTSTLVSSSYPSDLANLESSVILDSLATNLLPPWSA
FT                   STPSKPAEKLPEGEAERVIMDFVKHKRRDVTRLQDLRFWIGLLGAVTWFEVELARAVVQ
FT                   GSWKDVIFPAWLSLISIIPHSHITPLLSLHSMTSLIFFRTLIIHPNPSKLHIACFAVEM
FT                   VYCIAMLGLPYHEGLDRLLEGAKSKGGGSLGSFGSKLPKHYEEPASAWSRGTFNFLLPL
FT                   LFKHYLTPITLENIPAIREDDSSAASLGAFRAFSAKRDATYAKKHSGAKRRRNLGLELA
FT                   VFFAPELGWQVLWASIFIFFQYLPPNGLRLLLQYVKQRETNPQPTHVAVLYVAMMVIGQ
FT                   CMSAITLAQALYLGRRLCIRIRAIIIAEVFAKALRRRDVSGDVKKSTSNKSSAAAAGKK
FT                   GNNQAQDGAEGEATAGEGKIANLVSVDAFTISEICAYSYYTVSCPLAIVVNSVLLYQTL
FT                   GTAAFAGIAVLVALMPAQYGMSKLYMSRQKKFMTATDARLEGITEVIAHIKLIKFNAWE
FT                   GKFFDRMMITREKELRMLARRFATTVLFQLLVWSTPVIVTGIAFAVHSLWLKQPLTADK
FT                   AFASLILFNMLKDPLALAQDTVTRLIQASTSCNRIQKYLEEPDTLKYQQLSTPGSNDPQ
FT                   IGFRDAVLGYLTPEEATKLESDQSEPFTLRELNVSFPVGKLSVVCGPVGSGKTTLILGL
FT                   LGETLLLKGQVFMPDDHANRDGCPIDPATGLADTVAFCAQTPWLVGASIKENIVFGSNW
FT                   DKKRYDHVVKACALQRDFEIFELGDETEVGEKGTTCSGGQKARISLARAFYSSAKTIIL
FT                   DDVLSAVDAHTARHLYEQILQGPLTQGRTVILVTHQVNLVSPAAEMVVMLDNGIVTASG
FT                   SPSELTASGALELSEDDSDKASASASTAASTTLGAGSGSPVERDTDDPYIEDQLDSPAE
FT                   EELVEQQKQVDADRAAQTDKTTRLGKQLVAAETSSQGTVQAATYMLYFKALGGITIWII
FT                   VIIVFFGSQMLQVANNAWIKEWANADDRAASGSLLGKAAFTVYQFVIDTRKYVQAEMER
FT                   KHSTAYYLAIYWAISAFYLIAVVGRVGISFIGALRASRHMYDRLLQRILGARMRFFDST
FT                   PSGRILNRLSKDMSSIDQETGEICMYFANSCLSAATVLVVVTVSTPAFLGALVLICFLY
FT                   WVIGSLYVATNREIKRIDSVTRSPIFISFTEVLVGMSTIRSYGDSARFMRKLFHELDQN
FT                   TRCFWYLWQVNRILNNYSNFVGALVTVFAALFALKNKSMDAGAVGLSVSYALSFTEYVL
FT                   WVVRLYAAVEMSMNSVERVGEYLELEVEEESHEKGKEPPAYWPTSDGSIVVENLTCRYA
FT                   PQLEPVLKDISFVIGPKEKIGVCGRTGSGKSTLALSFFRFLFQESGKITIDGEDISKLS
FT                   LNALRSRLTILPQEAQLFSGTVRDNLDPFDQHEDADIWDALAQCGLVGKSRLSSRATSR
FT                   AQSRTDLSALSSSTTKEPNAPLVKSVLKKSLKNAEEGDEEGERVVIRSLEEKVAVGGKN
FT                   FSQGQRQLLALARGLLKLRNSSFLIMDESTANLDHATDATIQNVLRTGLADTQMLVIAH
FT                   RLMTVAGLDKILVLDHGKVMEYGTPWELMQNEGGIFRELCKQSGEETQLWEVAKIVYET
FT                   KQNASSRS"
FT   CDS_pept        join(complement(405255..405518),complement(404967..405194),
FT                   complement(404827..404910),complement(404542..404774),
FT                   complement(404321..404486))
FT                   /codon_start=1
FT                   /gene_family="HOG000161510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806647"
FT                   /locus_tag="CNG01380"
FT                   /product="Hydrophilic protein, putative "
FT                   /function="damaged DNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44523.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG435659"
FT                   /db_xref="HOGENOM:HBG738603"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="InterPro:IPR022658"
FT                   /db_xref="UniParc:UPI000042D02A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE85"
FT                   /transl_table=1
FT                   /translation="MSAPTTAPVLTPDQARLAALNRLKAKNKLTANTTGGNAAGPSNGN
FT                   HGNAGPAYVNRREAIPSSARNMVQQQAEADKAKPLPLRRDPSLGKYFEYDLSKMRNSRG
FT                   GFLTEEDKEGDRIKSVAELAREKERQLQMIREGEEPAIIPDRSPRCVECGTLEINYQFL
FT                   KVFDVRVCKSCEKKLPEKYSLLTKTECKEDYLLTDPELKDVDLLPHLLRPNPHASTYSN
FT                   MMLFLREQVEKVAFQKWGGEEGLDNEWKRREEFKKRKREEKFEQGLRDLRKRTRNNLYQ
FT                   RKQEAQHVHEFEDVEEVYDEQEQTTKLLQRCFGCGSEQEVEVL"
FT   CDS_pept        join(405798..406502,406554..406681,406735..407257,
FT                   407316..407378)
FT                   /codon_start=1
FT                   /gene_family="HOG000176924" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806648"
FT                   /locus_tag="CNG01390"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="AAW44525.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="HOGENOM:HBG589457"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI00004B48DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE84"
FT                   /transl_table=1
FT                   /translation="MAEQEPQVQSQQQKQQKQKPQQPPSGEPKAKSAKELKKEKRAAAV
FT                   ASRAIPTEGGVPEGPQGGKQSSSTATSDGRRSPVVHLNPSSQNPASSAGPSAPRRPPNH
FT                   SEPSAPTLSVIQQNLFFSHLPHQTPADTVSALDTGKIHPIIVRVGVLMNSGQLRGANAR
FT                   TIGMMSAFKEVIRDYECPDQAVLWKDLPVYLSPMIAWLETCRPKGVGGGNAIRWLKSEI
FT                   NRLGEKGDKSEAEQKSYLVDAIGLYLRDRIEFADQVIADSAKEKIKPGDTVVTFARSSV
FT                   VETVLLEAWTSMREQDPDATFNVVIVDSRPLLEGEKLLKVLTAAGLPCTYILLPLLSSI
FT                   LPQADLVLLGASALHSDGALYSRAGTAVVAMLAKEHRVPVVACVETYKFGERVVLDGVA
FT                   TNELGDVEGLLALPTKKPFALGKEGKPLPSNLTPLHVVYDVTPPSLITAVCTEIGFIPP
FT                   SSVPTVLGKSNGVV"
FT   CDS_pept        join(complement(410799..411057),complement(408228..410467),
FT                   complement(407500..408174))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806649"
FT                   /locus_tag="CNG01400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44527.1"
FT                   /db_xref="HOGENOM:HBG068387"
FT                   /db_xref="HOGENOM:HBG177237"
FT                   /db_xref="UniParc:UPI00004B48E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE83"
FT                   /transl_table=1
FT                   /translation="MTVPISVRSPLLTSRTTAVPDFPSVRTSKQQRNYPSDDYKLHNNI
FT                   STTMAAQAESSHCILESSPRVPTPAKQLQVKKRVVNLVNPAVRFFHKKQFRVITPNSSV
FT                   LPPSPAKPPPTPTSSSFFSQLLAVTMSPRRKEPESEPEPVGNEESWEKPGEEGELSLVA
FT                   STGSAGSIIIHGDEDEEDVEEEEPWNGEPQIHSSPLGLPAVPEGNTSKDASYGEFELPS
FT                   VEWHLPEDMSNLLSTKFPEKDSFSVADPTSTSTTASSRDLFADQSSFRDGLTSEAAASR
FT                   SLKHGKVERRAEAEFWGVQPDESAMSELGREDSNPTIRCQLPPLEEQIPTIEEKSETQE
FT                   SPLSIAQPEPPMTAPYSTSSIFADMSAEQAELTWPLTHRPGPDSSSTFQSPSRIQSPEP
FT                   PEVAPETPRTTAGDVTEFYDCTAMVLSPSSDSPLATCSSSAPLTSLLVQPTKALFEAQT
FT                   AHTIALSTELELYKDLTEKLRNEVSERDEVLAKLNMRALEAEMLYSQVQDLKKALAVAN
FT                   AKAQQAEVQAQTAQQQTLPNLDLNSPTPLMRTRSAGLPSDRTMAAQSEARDLEIRLAKA
FT                   LADAAATSRQLEEVKNSRDQQALQLEEARAELRDKDDREKSRLIKASHPEENEEDGEVE
FT                   KMRKEMKELQRKVGEMEGKEEEVQALRQELEEVHRELEEVKDQGSEVQALRTELSSAHH
FT                   QLDEYELMKADVDALQKELADLRHHVQELKQVKAADEEEIETLLDQVAKLEVESRDVED
FT                   LKYHFDQLKQVKTANEEEIENLLRQIEKLKAERRQEDEWKSKVEELSKRVDMEGMRRQN
FT                   VELELEEVRSREIKLEGENRELRKSLQSTREQLVQAQSVPTTSLADAQELQSLRVQIDH
FT                   LKSQSASKDLEITNLQRRKAELKEDREMLNIALDSKQQEVELVSILFHTLDQIKAHWMI
FT                   QMKRKFGVRGVAGSTPLGASQRTNLDQGTTPSMTNESFLPKTLTRRRSSLAIQTPVPDY
FT                   SKRHSLETPLQGNHRHGVQLYPSTKVASRVMQRSESREENIPPSRASVGGSAARYGSLR
FT                   TKEREMTLA"
FT   CDS_pept        join(complement(413131..413212),complement(413058..413068),
FT                   complement(412848..412993),complement(412775..412792),
FT                   complement(412400..412700),complement(411905..412345),
FT                   complement(411834..411842),complement(411655..411788),
FT                   complement(411474..411600))
FT                   /codon_start=1
FT                   /gene_family="HOG000209127" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636624"
FT                   /locus_tag="CNG01410"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44529.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG177238"
FT                   /db_xref="HOGENOM:HBG736678"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00004B48E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE82"
FT                   /transl_table=1
FT                   /translation="MADSPSPLPPYNSVWTKRAAVADEWLRQHKVVVSATSASVISTFA
FT                   GFPLDSLKSRLQSSREKVSIPRLATEVVREEGIGGLWRGFPLPLITISIVRTISFTIYS
FT                   STKRILNSTRLPSGPPKSDHKLTDNGRSGSKDGSDEKGPWINIHLGWFSGDNAKDIGIT
FT                   SLLAGAASGAVVCVGSAPFELVKVRRQLEYQIYRDSHPELFLNPSAATAGSGSKAAGVP
FT                   RTPSFTPPTTLQAVKLIVNSNGLRGLYTGWRLHFVRDTLGTALYFAEYDVMRYYLGRQK
FT                   TKTREDGGGGFGHDVQGDLPDWARAWLPRQAIPFLCGSVAGVSSWALIYPVDAIKTKAQ
FT                   QRALSGLTPRTPTEQFHRLVRGTGKDSPKPLLSGIARLYRGLGISMIRSMLTHGLLWTL
FT                   VDAVGSYIETKPCERYFGVDIPL"
FT   CDS_pept        join(complement(414106..414529),complement(413884..414050),
FT                   complement(413739..413828))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093388"
FT                   /locus_tag="CNG01420"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44857.1"
FT                   /db_xref="HOGENOM:HBG068386"
FT                   /db_xref="HOGENOM:HBG177239"
FT                   /db_xref="UniParc:UPI00004B48E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE81"
FT                   /transl_table=1
FT                   /translation="MAGPPPIPSKTRPSFTNPFYRNSNASSSSTASSPPPSYDTHSSHP
FT                   TQPPRPSTTQQFEPVQYTSLSSLTKNKPKHTHANQPASYEYQPDPSRQGYSTQGFESQG
FT                   RAVNENVNAGRRLPPMPGQGQARTGTPTEPSQRAVHSASAPPPPPPRTGSGLQSYIPSG
FT                   AQSGFDSAAKGVRGATDTVKDGFYSVANQQRKEQVMSGIGKLGVGAVKLAGKGVYQVGK
FT                   FATK"
FT   CDS_pept        join(414971..415107,415161..415262,415322..415429,
FT                   415604..415661)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806650"
FT                   /locus_tag="CNG01430"
FT                   /product="Putative uncharacterized protein "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="AAW44531.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG068385"
FT                   /db_xref="HOGENOM:HBG177240"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI00004B48E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE80"
FT                   /transl_table=1
FT                   /translation="MSANSSTPSRTTQSQVYSAHLRNALLPELENTRQRLSTVETDIAE
FT                   YALLKDKIDGLQKEKGKEVNTMSEMGAGVWVHTTIPDISVITLDLGLNLHLDMPLADAE
FT                   EYVKKKLGILKNSKALWHDHLHPWIPSYHR"
FT   CDS_pept        join(complement(419449..419623),complement(419067..419399),
FT                   complement(418492..419001),complement(418236..418433),
FT                   complement(417666..418171))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806651"
FT                   /locus_tag="CNG01440"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="GPI-anchor transamidase complex "
FT                   /protein_id="AAW44533.1"
FT                   /db_xref="GO:0042765"
FT                   /db_xref="HOGENOM:HBG068384"
FT                   /db_xref="HOGENOM:HBG177241"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniParc:UPI00004B48E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE79"
FT                   /transl_table=1
FT                   /translation="MLLSSLTLLLFAPVFVAAVPSSNSFHESLTLHPLPDGKLSVLFEF
FT                   TTYFTQTKPTSSIPQYHHSITPPSLLLPLQTNDISELSISFVAGRWDQRRSSQSGPLHY
FT                   LSGGGGGEVRGWVRNGNEGGSEEERWGTVTHALGGLFCAGLGPREAGENVKTFGRIYPP
FT                   HRGNPDGLTHFLLSHPHHNLCTENLTPFLFLLPSKGLSGLSALLSQPGIIFSWGFQSEG
FT                   IEVIMPNDDHPEGKWTGWWEGVVDLMPPGAGVKNVKRETGLEKLFKKRLPPSCPETESS
FT                   VIRLILPENEKVNVEPQGRVVGEWRDGKWRQVMEWNAKDREMVGKDLKVWWDEERFEYP
FT                   RTIDPPAISVMKTVIDSQASDGTFQIKISNHENITREAIYSEIWPWWVKGWMSEMAVCI
FT                   EDEGPRADLLKSISYNPSNPPDIPPTTIHLSIQLPPRSTLVLTIPFTKLTLKYTDHRPD
FT                   AERGQEIPAGVLTLLDLVGERGVPEAESEASPSSWTSPQINALRSNRARVYTQRILLDI
FT                   PTPDFSMPYNVIIMSSTVMAVFFGLMHGGLTRRWGWVEVPEDPEEPKEGVRMGEKE"
FT   CDS_pept        join(420095..420640,420700..420747)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942400"
FT                   /locus_tag="CNG01450"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44535.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG177242"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniParc:UPI000042DE60"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE78"
FT                   /transl_table=1
FT                   /translation="MSFLFRSTIRASTSRLPTSLPTPTPRPLAFLPLPLSRFNSSLSTP
FT                   PSPSATKPSSPPQNPINPKFAELTSSLSIPVSSTSKPHAAAAAADPTSEDWWMTLSKKS
FT                   HYNTFSSTKGFHPTKYFSGRSIELNRGTDFLVAYKRMQGVMRMGNMKKEAKLNEFHEKP
FT                   SVRRRRLRSERHRRRFKEMVRSKVQQALAMRSRA"
FT   CDS_pept        join(complement(422170..422241),complement(420949..422115))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942401"
FT                   /locus_tag="CNG01460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44537.1"
FT                   /db_xref="HOGENOM:HBG068383"
FT                   /db_xref="HOGENOM:HBG177243"
FT                   /db_xref="UniParc:UPI00004B48E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE77"
FT                   /transl_table=1
FT                   /translation="MVPPPYAYQSSSSAKRSVMLVFGNVDLQINYIWQLANKPITSLSS
FT                   PSSSSDPSDSSTNDSDHPDSTNILHSATETSSTGPALGPEDFVNAVVRAYTTFLEREVV
FT                   HGPVGERLSSIAEKKRSSGVGQSTAVNGKDVGGPPKVFIAAALPPLIEDEMLPRIPEKY
FT                   VERLEEDFEKQQRMVGRGWKPHQGVGAGMSARADVGGGKDEGDLVDGLSLLRVSDKPVC
FT                   RPEVSPGPSTTASSSIPSPALDTPLTEPTASPTAFSADNGNSNGNGSSKTKTPIASLLT
FT                   HSPPLCTLPVRVRMTDQFNNLLSSFCAQYPDIFTFIDISPAMHLGSEAPSIHGEVDRGV
FT                   WACPVDRTNVHPVWEPTLPLWLEALKREGMDTDTWKMCDDAEETFKAYEIDKRRRTAAA
FT                   GYGGEISMKLRDE"
FT   CDS_pept        join(423158..423284,423360..423430,423493..423688,
FT                   423747..424003)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942402"
FT                   /locus_tag="CNG01470"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="protein targeting"
FT                   /cellular_component="mitochondrial outer membrane
FT                   translocase complex"
FT                   /protein_id="AAW44538.1"
FT                   /db_xref="GO:0005742"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="HOGENOM:HBG037297"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="UniParc:UPI000042DE5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE76"
FT                   /transl_table=1
FT                   /translation="MASISPVKVAGTVAAVAVSGFLGYAVYFDYMRRHSPEFRKSLRKQ
FT                   HKKLSAVAEANAKAEKEKNAKALRDGFLRIQTEAVPMTPDQQEGYFAEAANQGEQLIAQ
FT                   GEEHYVEAALHFFRALRVYGNPGELLAVYQRVVPPPVLDMIIQLIALSTSTATGAGAGA
FT                   RPTAASLETPAPAPASVEDLDEEKPAKEDAPSPNSASQGSGAEWEKVNQEAQE"
FT   CDS_pept        join(427893..427991,428051..428197,428365..428427,
FT                   428503..428723,428780..428948,429003..429650,4
FT                   29707..429922)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636625"
FT                   /locus_tag="CNG01480"
FT                   /product="Hexose transport-related protein, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44539.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B48E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE75"
FT                   /transl_table=1
FT                   /translation="MAPRSSKKALTLCLFQSLAGVIFGWSNSEGSGLFSMSKYQERFGE
FT                   CIDGVCTLSTTRQSAITGLLSVGAVIGAVGSGSIADRFGLRLTCMVFIFIYLCGAAIET
FT                   SAFNTYGQLCVARLLTGLGVGATSGLVPVFQAEASPPRYRGLVTGSFQLCVTLGIWGVA
FT                   MTNWGMSSYAGDVSWRIPVSLQMVWAALLLVGFLFSPESPRFLAKKGRWDHCRKNLANL
FT                   RGLPTDHPDIDTEMEEVREATIKDQERGQASYVECFSTKDRILWRTMIGICVQIGQQIT
FT                   GINFFFSYGVQFAQTAGLDDTYVFQIILASVNVVFSFPGILAVDRAGRRPILLIGGILM
FT                   FIGQIVVGAVSKAYPDDKIAGDVLIAFTCLFIASFASSWGPIAWVVCGETFPIRLSSRC
FT                   VTLGTGANWLFNLIIAFAAPQIQARIGTGITFVWAGCLALAISFAFFCIPETRSMSIEA
FT                   IDALYLSHTPAWRSHKFVDEQLARTQNAQEKHYSRSIHAENEQVKSSQQTSARTSAEDG
FT                   RMV"
FT   CDS_pept        join(432267..432756,432831..433462,433530..433797,
FT                   433886..434037)
FT                   /codon_start=1
FT                   /gene_family="HOG000215020" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806652"
FT                   /locus_tag="CNG01490"
FT                   /product="Putative uncharacterized protein "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /protein_id="AAW44541.1"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG502043"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000042D5D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE74"
FT                   /transl_table=1
FT                   /translation="MPRLSNVYCPKSLLQRQTIQIRSFSQTMSPFKPALTLDTINPAVQ
FT                   AVHYAVRGELAIKADKYVQVLADITHKPLPFEKIVTANIGNPQQQGLDQVPLTYWRQII
FT                   SLLEYPDLMQKHEQLAKQIYPGDVIERARALHNEIGSTGAYTHSKGVLGIRKRVAKFIE
FT                   ERDGYPADPQNIFLTAGASAGVASILGVALRRGDGCMIPIPQYPLYTATLAYLESEPLP
FT                   YYLSEADDWSMNHDSLLKSVEEGKKKGIPIKALVIINPGNPTGACLSQEAMEAVVHLCY
FT                   EEGIVLLADEVYQMNVFDPEQRPFISFKKVLMDMPKEIRESVELVSFHSISKGVSGECG
FT                   RRGGYFECVNIDKDVMDQVYKMASVTLCPPVSGQIGVDLMVSPPKPGDESYPLWKEETD
FT                   LIQNNLKSRSYLMAEHFNKMEGVSCNNAEGAMYLFPRINIPPKAVEAAKKLGKEPDVMY
FT                   ALDLLDATGICAVAGSGFGQEPGTFHLRVTALCPDTAEFIGRFQKFNKEFMEKYA"
FT   CDS_pept        join(complement(435182..435241),complement(435028..435077),
FT                   complement(434708..434954),complement(434595..434621))
FT                   /codon_start=1
FT                   /gene_family="HOG000055226" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806653"
FT                   /gene_name="SNU13"
FT                   /locus_tag="CNG01500"
FT                   /product="13 kDa ribonucleoprotein-associated protein "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAW44542.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="HSSP:1ZWZ"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI000042C170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KE73"
FT                   /transl_table=1
FT                   /translation="MSAQPNPKAFPLANAQLTNQILDLIQQAQHYKQLKKGANEATKTL
FT                   NRGICEFIVMTADVEPIEIVLHLPLLCEDKNVPYVFLPSKTALGRACGVSRPVIAASVT
FT                   TNEARELNAQIQAVKNEIEKLLI"
FT   CDS_pept        join(435581..435745,435796..436235,436311..436454,
FT                   436503..436613,436665..437184)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806654"
FT                   /locus_tag="CNG01510"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44546.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG177244"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00004B48E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE72"
FT                   /transl_table=1
FT                   /translation="MTGGAFFAPAADNDEEYDMGPVGEAHAVQWIGTAGVKGPKWARLP
FT                   LLTVGMLGIQCVWSIEMGYASPYLLELGLSKSFMSLVFMAGPLSGLIVQPLVGIFADRS
FT                   RSPLGRRRPFMLAGCLICVSAMMLLGWSREVAAIFGGGQWLAITLAVWAIYCIDFSINA
FT                   VMSTDRALVVDTLPPREQEEGSAWAGRMFGFGSVAGFFVGNLDLAPVLPFLGKTQLQIL
FT                   SFLTSAVLMVTHSFTSWAVSERVLLRDDRPQSKSSLKSNLKSIWENMFSLPPGIRTVCI
FT                   VQFFASLGWFPILFFTTVWVSEIYKSSVPSDGIDPATFDSRAVRSGARALLLQALVNII
FT                   TSIGMPFLVAESGVQPSESVDGYEAIEGSSSRRVGLETANGDGRSPQASVATPPNSALW
FT                   KRAREDLENGTVFRRFLHSVQSMVNNVKKGELGIPIKGLTLVKVWWISQFVFAAAMAGS
FT                   W"
FT   CDS_pept        join(437486..438002,438083..438474)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789292"
FT                   /locus_tag="CNG01520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44547.1"
FT                   /db_xref="HOGENOM:HBG177245"
FT                   /db_xref="UniParc:UPI00004B48E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE71"
FT                   /transl_table=1
FT                   /translation="MRARRNSSDAQSRPSSALFDAEETSHPIIPPSNTNFSRVSTPLHS
FT                   RHASRTSLVLDRSNRHSRDRTRPSSPSSNLDRPANFDREKFMSHKSNLSLEGEGLSPLV
FT                   IQGDTPVEPAFGSTVVLRHSDEMSRSEGEDDEYEMGQVRGNSSSTHHSPRASGDYDMNG
FT                   TKGTADKAGVILGIHNVFLVLPQFIVTVLSSVIFWLMEPSKSLPTHHPGSVPVTDTNTT
FT                   AAIAAIANSSVLEDAVSATMEVAEQVAKRTVELVSREGVDVDVSSPDAVGLIFRIGGVS
FT                   AAVGGWICWRLARDWARGQGV"
FT   CDS_pept        join(439642..439701,439760..439922,439979..440162,
FT                   440217..440285,440352..440577,440653..440856,4
FT                   40944..441117)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806655"
FT                   /locus_tag="CNG01530"
FT                   /product="Endo alpha-1,4 polygalactosaminidase precusor,
FT                   putative"
FT                   /protein_id="AAW44548.1"
FT                   /db_xref="HOGENOM:HBG068381"
FT                   /db_xref="HOGENOM:HBG177246"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00004B48E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE70"
FT                   /transl_table=1
FT                   /translation="MISISPSSWLLVISSLVAVTSAKPFPRNVPHGHCGSFTSSLTIVE
FT                   TSKDATSAEETVVTSLAIEAALASATSSSSASAATTSSISSVASSVSLSSTFVYELDAQ
FT                   SVTSPEITTDTGLIVNADVYIVDGEGTSEDTIAQYHADGKSVICYFSAGTWEPGRSDAD
FT                   DFDPACVCGTGGSFADNACSSDDNKLSDWDEWWLDIHSASCISKVESIMSARISSFVAK
FT                   GCDGVDPDNVDSFANSDQLHGNTADDQVNYLLWLSSIARGQGLMIDLKNAGSLLVDDNG
FT                   DATSYQSEIVEAFDFVVIESCHEYEECDIYDSFLAAGKPEIQIEYGDITTCPSLQDGQH
FT                   LLVYSQNDLSSALITLECD"
FT   CDS_pept        join(complement(443158..443313),complement(442912..443090),
FT                   complement(441781..442849),complement(441450..441719))
FT                   /codon_start=1
FT                   /gene_family="HOG000235050" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806656"
FT                   /locus_tag="CNG01540"
FT                   /product="Hexose transport-related protein, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44549.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG252803"
FT                   /db_xref="HOGENOM:HBG328634"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B48EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE69"
FT                   /transl_table=1
FT                   /translation="MAGALGNLINKKALANTPKEVFNLYVFFIAFALSFSGGLHGANTS
FT                   NISGILAMPDFIATFNLKHYSASAASDIKGWITSVIVLGGLIGALTSSPFNDRLGRRWT
FT                   LFLNALIYSVGTIVQLVASGNIKQVIGGRAMQGFASGAGTVTGTLFLAEIAPKAIRGVL
FT                   GAFFSFNIMLGVSLGYWVNYIAILHISPSSHWQWRMPVLFQLVSSISLLARTRELKESV
FT                   QQYPGIILLSALPLLPESPRWLILRGKNDQALRALTRIRRLPEDHPYVQDEYKEIASSV
FT                   SAEIEIAHSSSWLGLFRELKNDRTLLRRFVLVMIVQIGFNFSGGNSITYYQTSILSTIN
FT                   VTTTDGAYLFSGIYGLMKVLAVLVYAFLLSERFGRRKMLLIGATINILCVLWIAIYLGA
FT                   LAGHNKAAGWVAIAAVCLFAIGYGIGWAPVAFGLNGEVFPNRIRAKIMSLTIGMQYLAN
FT                   FCLTRFFPNMIANIGSFGPFAIFACVSALIWVYVFVALPETKGLSIEQMSSLFGGHWFQ
FT                   NGFKKADGKVPEPENVTPTEYDGAEEAEKEYSHVEKINTV"
FT   CDS_pept        join(complement(446398..446541),complement(446270..446343),
FT                   complement(445953..446226),complement(445773..445909),
FT                   complement(445322..445722),complement(444625..445123),
FT                   complement(444028..444553))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806657"
FT                   /locus_tag="CNG01550"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44553.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068380"
FT                   /db_xref="HOGENOM:HBG177247"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00004B48EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE68"
FT                   /transl_table=1
FT                   /translation="MPHASSSGSNAMRGKSSPPRTAEGSDERKHKRKRAAYSCTECTKA
FT                   KAKCDRQQPCARCVSRRVPTLCHYLVNGYEDPIELSKDVQTRLIRIESLLLQSMSSQPH
FT                   SLEGKSPPKALVESTPSSVPSLSMNRPKRTGYVTRGRYYGPSAMAYVGDDSAIDIMRAL
FT                   DVPDPETPEAGDGEDKRPPRALVDILHELPQRTWCDELIQLYFDNINLTRYPIRREPFM
FT                   QTYEALWQGLGTFSLDTWIIHRLPLIFIVLAISALSAPLATLHIDSTLSSSQAGEKRLA
FT                   KANELYQASRRASAYSDGLISGRGDIILVMSDLLTVRYLILARRAPDALPALGTAVFRA
FT                   QALEPPLNLDNENIVQPMSNLTLNTFLVCRHSLAHIMSRIAEEAYQLGEPSYDVIDSIE
FT                   DALQNWASNLPYGLRLKSYGQNDDANDDANTHPALIIHRHFASTEYNFARISLHRPYLA
FT                   RPDPDNQYARSREACLQAAMDDLWARTKFTVPGMDNLSTGSYRVTNSLVILGLSLLSNP
FT                   SPDTLRMINQCLSDFMTARKGNSNLLDEVKIKEIAMMEMLRSKTDQGLSHANSRAPSPH
FT                   AHLQANAILSNTLAADEGHSQATLPVVEANASNLAPISDPSVQSMFDQFWGLQPALDLY
FT                   GGGPFGTFRGDYGEISWDNFSTLIENAGGGTGDWRLPTDPPTTFHPPPS"
FT   CDS_pept        join(complement(447715..448047),complement(447036..447659))
FT                   /codon_start=1
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806658"
FT                   /locus_tag="CNG01560"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW44555.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG177248"
FT                   /db_xref="HOGENOM:HBG361897"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI00004B48EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE67"
FT                   /transl_table=1
FT                   /translation="MPSLVSTAPIRTDQPCPPGSWDVHHHIFDLDKFPLAPTRHFTPSS
FT                   APLRSFETFQHSMGIEHACIAHGLSFGTDPSSLLYYLKYFNETGRAYACIDIEKTTDEQ
FT                   IQSMKDQGVKGIRIDYHLHKAQHDKEQQIRCMKRYADRIAPFGWGLQTYHPHPEYYDSL
FT                   APIIASLPVSMVVDHFGGLKTASLLEFQGIDTSSFDVAAQPGLGALCSLLKDNKLWIKL
FT                   SAPYRCSEDPTFEDMKPLVRALVDANPDRVLYGSDWPHTQPFHRRPKGLKGEDVETFLD
FT                   FDDKTWVNKLKTWLSDDEWDKLMVKNPRVFIGYEGKD"
FT   CDS_pept        join(448541..448597,448652..448816,448885..449352)
FT                   /codon_start=1
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789293"
FT                   /locus_tag="CNG01570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44561.1"
FT                   /db_xref="HOGENOM:HBG178104"
FT                   /db_xref="HOGENOM:HBG324715"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniParc:UPI00004B48ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE66"
FT                   /transl_table=1
FT                   /translation="MTSSTKNILSRLAPYGACDVADALTKLKHPAGGFLSGLKLRGPDQ
FT                   NTKIIGRAHTVLFRANSVAPQKKGFKGHYIDSVVPGSVLFMSAPAHLHNAIYGGLMSMR
FT                   AKSLGAVGTIVDGRLRDLAEHRRMNYPVFSRDVGITAGQEVCYSSEINVPVPLRSPHQP
FT                   DVWINPGDIIVGDENGVACIPQDLEDEVANLIPLLAERDRLSMEDLITGMKAEDVFRNR
FT                   RGASSTK"
FT   CDS_pept        join(complement(450523..450615),complement(450152..450462),
FT                   complement(449975..450095),complement(449764..449908),
FT                   complement(449686..449704),complement(449424..449622))
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806659"
FT                   /locus_tag="CNG01580"
FT                   /product="Tricarboxylate transport protein (Ctp), putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44563.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000042DE5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE65"
FT                   /transl_table=1
FT                   /translation="MIMSNSKKQHPSALPLLAGASAGMSESFITYPTEYVKTMSQLGNH
FT                   GHNTTAQISPSVVIKDTLARRGITGFYRGCSPVIAGNALKAGTRFFTYESIRDLLRGPD
FT                   GKLSTASNVLAGVGAGCVESIVAVTPSEAIKTRLIESQRAGVVTQGGSIAIVGSMIRTE
FT                   SITSLYRGLVPTMMKQSANSAVRFTSYQAMKDYAMRKNGGHQPGNATIMAIGAVAGVIT
FT                   VYATMPFDVVKTRMQQSSVRYKSTLDCLVRSLKDDGVLVFWRGASPRVARLVVSGTVTF
FT                   VIYENVLKSLQTLF"
FT   CDS_pept        join(451118..451263,451323..451431,451479..451494,
FT                   451560..451588,451642..451794,451848..452387,
FT                   452451..452832,452880..452959,453008..453302,
FT                   453371..453436,453486..453520,453587..453651,
FT                   453704..453851,453922..453999,454061..454185,4
FT                   54254..454299)
FT                   /codon_start=1
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093389"
FT                   /locus_tag="CNG01590"
FT                   /product="Aconitate hydratase, putative "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAW44565.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG025113"
FT                   /db_xref="HOGENOM:HBG295973"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00004B48EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE64"
FT                   /transl_table=1
FT                   /translation="MLRLIRSHRPLQRRGLATINSRVQGSPLEPSTFIDYERVSQQIAQ
FT                   VRKRHGKPLTLAEKILYGHLEDPNAQELKRGSSQLRLRPKRVALHDANAQMALLQYMTT
FT                   GIPRVRVPTSVHTDHLIIAREGAGPDMDRAIAANKEVYDFLQTACAKYGIAFWKPGAGI
FT                   LHQVIFEQYAYPGGLMIGSDSHTPNAAGLGMLGIGVGGMEAVDVMAGLAYEVKHPNIIG
FT                   VNLTGKLGPWSTTKDIILKLASILTVRGGTGSIIEYFGPGAHSLSATGMGTVGNMGAEV
FT                   GATCSVFPFNQGMADYLELTGRSTIARTAEDYRDDLKADEGAVYDQLIDINLSELEPHI
FT                   NGPFTPDLSWPISGMGEAVKSTDWPTNISAALIGSCTNSSYEDLSRAASIAKQATEAGL
FT                   KAKTDFFISPGSEEIRSTVSRDGVLEELQKAGGMVLANACGACVGQWERPSMKKGMKNT
FT                   IVSSFNRNFVGRQDGNPGTHSFVASPELVTALAFSGNLNFNPMKDNIQLPDGTHFHFAP
FT                   PQGPALPEKGYERTLQFYDEPPVGGSSVDLAVDPNSSRIQLIKPFEAWSGKGEQDLTML
FT                   IKVRGKCTTDHISAAGPWYKYRGHLQNISQNLLIGAINDENGKPNCIRNVDTGEFGTVP
FT                   ATAEYYRDTNRKWAILAGDNYGEGSSREAAALSPRYMGGFAVIARSMARIHETNLKKQG
FT                   LLPLFFRDPADYDKILPGAQLRLTNLQALAPGSPVYLTYTNAGQEHIQIELFHSLTDHQ
FT                   ITWFKAGSALNTLRPKD"
FT   CDS_pept        join(455063..455303,455400..455495,455546..455614,
FT                   455667..455781,455846..456277,456348..456657)
FT                   /codon_start=1
FT                   /gene_family="HOG000031183" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI15806660"
FT                   /gene_name="GMT2"
FT                   /gene_synonym="VRG4-2"
FT                   /locus_tag="CNG01600"
FT                   /product="GDP-mannose transporter 2 "
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44567.1"
FT                   /db_xref="EMBL:AAR96298.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG328976"
FT                   /db_xref="HOGENOM:HBG429711"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000042DE5D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KE63"
FT                   /transl_table=1
FT                   /translation="MASYTPSSSRPHTPLGLSPRGSYTNLASAAYDASSPGGHGAKDEK
FT                   ERLRAEREVQEALLKAQDGVEKAKKEEVCMPASTTVLPILSYCVASIMMTVVNKFVVSG
FT                   RQFTMTFLLLAIQSFVCVACVWLAKRIGVINFRDWDMNDAKAWFPVSSLLVAVIYTGSK
FT                   SLQFLSIPVYTIFKNLTIILIAYGEVIWFGGHVTPLTLCSFFLMVGSSVIAAWADISTT
FT                   LSKLSAGVAVVDPISGADVPLSSISVMDTMNVGYLWMFINCLASAGYVLFMRKRIKVTG
FT                   FKDWDSMFYNNLLSIPVLFVFSLIIEDWGAASFSRNFPEEGRAFLLSAIAFSGAAAVFI
FT                   SYSTAWCVRICGATTYSLVGALNKLPVAASGILFFGDPVNFGNVSAILVGGVSGIVYAV
FT                   AKTNQAKVEKSKQARGGESKA"
FT   CDS_pept        join(complement(458895..459716),complement(457618..458839),
FT                   complement(457037..457494))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806661"
FT                   /locus_tag="CNG01610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44569.1"
FT                   /db_xref="HOGENOM:HBG068379"
FT                   /db_xref="HOGENOM:HBG177249"
FT                   /db_xref="UniParc:UPI00004B48EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE62"
FT                   /transl_table=1
FT                   /translation="MADDCRGSEEETGASRQNILKFLSPSSADPSTGISLDTRRALLES
FT                   GKHTDVEDVFREEFLSVVSQHQHGQGGIGKDEKMTILNLVIPLSTVTGQNATTPTVKRV
FT                   SHLIIDLVPPGSPAKEVQPVVQLFNTFISSLTLAPFPAQQRRENVLDPRVPITFFAKHG
FT                   QATTQLALGNDVPSRNMVEGLKLWVEEALRGGAKGGDGEEEMDVETVREKVVKQILPAL
FT                   LASPLSLVVYLTLTLCLGPQNASKAFTYNRTLEKAGEMFEILFYTVYLFSTNPTDRRTA
FT                   FIPPYAQDELRALAQQAFGLASRARNMPGAGAGAKWGVIRDLLEVLTLRKPLPGAGEGI
FT                   VPTWKYSQVPTQVQPQTQTQTPTPRVSGTTPGEMRRPPPQGPRASLRDGRERGGEREFE
FT                   SYRDRGQRQYPLHFEPRRAQGHTHYPQREREQERERERENKNKEERRPGGRPATPPLPS
FT                   LPPAPAPAPAPASAPSASVPPIPLEPFASASTSAFPAASPGTGLNIRSNTTTAAAATDS
FT                   TTGISINGANKRRREVDTGSDSARPRVGDENGDGDRDADADRDSDRDGGREKKKGRNDI
FT                   DKDGRKGERREGTETSTSMGTVGAGAALLARITGGRGRVHTPPMAQSQPQPHPQDLQTQ
FT                   QQQPKLSLRDRLGPSVTPSPAHSDGKVNIPSSVGMGHISALDRLALAQTQGQAQSKDNA
FT                   AGQGNGTDQTSMSTTKSIKIRRDNRPPPTTLFHRNYSSNNNIEILGSRGEDEKEEEEEE
FT                   EDEPVVKKGRGFVEKQEDVVMFEPPKESGWGTAFRQSSAGGHGGGQGVWRASAHRGGGV
FT                   GPGAGSGMARGMFGARGAARR"
FT   CDS_pept        join(461208..461425,461473..461522,461569..461622,
FT                   461677..461849,461914..463575,463631..463968,4
FT                   64031..465264)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942403"
FT                   /locus_tag="CNG01620"
FT                   /product="Transcriptional activator, putative "
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /protein_id="AAW44571.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068378"
FT                   /db_xref="HOGENOM:HBG177250"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00004B48F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE61"
FT                   /transl_table=1
FT                   /translation="MSTDPPRTSSRPRQKSQRALEHEDTKRYLEQQLDSPAKIPRPRPK
FT                   SKPKHRSYCVCKQDTSGPMIECDVCSDWFHFKCINLAEDDAEKIHKYVCPSCTLSNPDQ
FT                   YTTYSYDIASFPSPSPPPGLELGPAGAGVQEIIKPRPSDGKGKSKHEDQKKKSILAKRK
FT                   SKTETSRGGEDADGTGDGEDDDDDGDKVMATSSAHDSDSASVSASSSDSNPRHPDSDSD
FT                   AASNASGPSRKRPRPRPRVPSKSTNVQRGDEKPSLPSSSSTQPKPKPKPKPKPRSISQS
FT                   HPQPETKHVQAKTLPPIRQYVLSKLTLLFHTLFSSPPSSHPFTEEESARYAADVERAMF
FT                   QAFKDIHPSTASTTTTTFSATATTGVGAAAKESAGTRYKTQFNLLTSSLTKNKHLLRPS
FT                   LLQSILSRSLPPTALALLSASDLASAAQLEEMERAKQAVLESTVKTREEREREREMMSG
FT                   GGGGVRAGRDGLEQLEDTREKEMWEVRKEEERERSEQREREHEQRERRESEVERDSVHP
FT                   DDGSLSKDVKSIKDTIKHEPSRSPTIPSTAIPHHRRTSTSTSTLTPTSTPFKTEPAKPA
FT                   FELTSAWGASNLQGGGNDQGGGGGGGRLERKPKKLDLSDQAIAGSVGDVGGVGGGAGEG
FT                   DLDLDLDLGYGSGEMDLDELDYTGEVDAAAAADGAGGHGDGVDQEAEIENREEGEGLGE
FT                   EGKGENQQKKKWEELMERPIEWSGWITNPAVPSSLRPPIALRLLTPHPSSSSNFTQSHT
FT                   QIHPPWTALLPNSTIEITGRVPTKASVQYLSDMRLNPGKELICVLFTFGKPYAHGEGDG
FT                   QAEGEKREWERLVGYHVERDRHAIYLPYGPKGPPPPPPASLSPSTTEGVQNTFKELYLI
FT                   PLRPGDALPEFCELVDGLDVLNGRSAGNEDGTGGDLARGKENGKVGSVWLGVFVGSKRR
FT                   NGSVSTSASANGSASAQRQIQTQTQVQKEGRPQARSESQSQTPPHDPRGPRIPRPAFIP
FT                   PAHGASPSISSSRPSVHPLSPASAQSQSSGPGQGVIQNEKLQQLMASLNPSSLGLPGLP
FT                   GLSGLPGLPNLPGVHGGAQVGTPPFPPGGTTPLGTGTGVSNSPPTLPRPPQHLQTNHLN
FT                   QRLPPPPPTLPPPPGGYRPPPYGYIPTPPQGPAMTHGYGSPPYRRGSGGAYAYPLGSSG
FT                   PPGPRGPPGPGPLPRPPLPPGAQAAQGGRPPQEERHHPNQNRQQEQGHRQGQRQGQRWR
FT                   NERGNGNNNGGWKRRGH"
FT   CDS_pept        join(complement(468256..468315),complement(468102..468196),
FT                   complement(467730..468040),complement(467611..467681),
FT                   complement(467264..467545),complement(465549..467213))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806662"
FT                   /locus_tag="CNG01630"
FT                   /product="Calcineurin temperature suppressor Cts1 "
FT                   /protein_id="AAW44573.1"
FT                   /db_xref="HOGENOM:HBG068377"
FT                   /db_xref="HOGENOM:HBG177251"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00004B48F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE60"
FT                   /transl_table=1
FT                   /translation="MSTPIEPKELGTLIVVVGKARNLPNKSRFGKQDPFCTVIVGEEKQ
FT                   KTKPIKRGGQHPEWDEEFRFAILEDVEDVVQRSESQSESLNSSLNGKPLPVPDDPGVIT
FT                   TAALASKSRKIKKKGGKSMKVACFADDAKEPELIGDCVVSLEDVLKKGEVDDWYDFQYK
FT                   EKYSGEIYLELTFFSNEAPPVKRNVPRPSIPRYGPPSLNGSNSSMSFGSTAGKGALPQL
FT                   SSGSISGANLYIPPYAPQAARVPSPASQPGQSTSFADLGLPSGHRKSSPLPPIQQAQHG
FT                   YQPSFSSSLSVNSRASVDVLTRPMSSMSLNPSVNSFSMSSAPAPSAPSSSYGHSHRHSF
FT                   GGSSEAPWGSVLPHSGYAPAPTPHLRPISTQSIGAGSEAPWGSMLPQSHPAPAPTPHPR
FT                   PMSTNDALTGEQTMRMEADRLRTAATPMLRPSSGMSHGAAPASLAPPVAPISAPSPQDS
FT                   RITSTIPESLRPAGPPQPHQHYSQPPPPFTSNQYHGQPPTPAPPLHSHSAGSISPVATT
FT                   LGHYQVPSSSFSGLAQPPGDSRRASSPGPGYYAQQSAGQFQPQCQVNGAYGSPVGGNGY
FT                   GQREGYSTPTRSNIYPVPPAQDHQQSPPSSQGYYPPQPPQTPQSYPPQSSPTPQPYYQT
FT                   LPPAHQQQPPLPPAPPQSYAYSQSSVLPHRQPSPVPPPPQPQTNESGYVPWYQQTQSAQ
FT                   PQPQSHTPYPQSHTPQPQSHTPLPQSHTPLPQSHTPLPQSHTPLPQSHTPQPQSYPYVQ
FT                   QPYGQQPQHQDQQAYHLLPPAPQYSQPLPPPPPVPERRPQPQAPAPPPSRPPFGYYPSD
FT                   ELYLQRQEGRDPYGR"
FT   CDS_pept        join(complement(473051..473570),complement(472974..472998),
FT                   complement(472810..472913),complement(472627..472753),
FT                   complement(472467..472563),complement(472290..472391),
FT                   complement(472149..472236),complement(471742..472091),
FT                   complement(471302..471685),complement(471131..471238),
FT                   complement(470996..471073))
FT                   /codon_start=1
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806663"
FT                   /locus_tag="CNG01640"
FT                   /product="Putative uncharacterized protein "
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAW44575.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG059932"
FT                   /db_xref="HOGENOM:HBG324099"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI00004B48F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE59"
FT                   /transl_table=1
FT                   /translation="MVPIIIIMYAIDMPERLRYKMPTSRPLFLLSPPFHFPPVSNMGSP
FT                   NEKEVLPSIIPPKEAEQPRKKGRLGVYRFLIGSATFLFIQSFLYISPYPKFSIFNNLIE
FT                   DSSSSTNSTCQQADPIYPKSFNPSELVKGEKEQIIEWLSGAVRVPTEVFDVMGEIGEDE
FT                   RWDVFYKFSDYLEESFPLVHKHLKRNRVVTHALVFEWEGSDSSLKPLLLTGHQDVVPVL
FT                   PATRDQWTHDPFGGEYDGKYIWGRGSSDDKSGTIGALSAVELLLKSGKFTPRRTVILAF
FT                   GIDEETGGKVGALNIGQWLEEKYGKDSMALLVDEGNGIESAWGQLFAAPAVGEKGYMDL
FT                   ELKVETLGGHSSVPPAHTGIGYISLLIAALERHPHKPYLNPSSPLVNFISCAANSPAHI
FT                   PSHLAKAIHKVENSLKHGDGKKVNRKALKQVEDWWVTGSYEDGTLGKGMGKAMVSTTQA
FT                   VDIINGGLKVNALPESVVAIVNHRINLASSVAELQQQITDVIAPVASKLNLAVEAFGQE
FT                   IQPHGHGCHFSKNDGPKAGKVILNVAFNSSLDPAPVSPFTVESPAWRLLSGTVKGVYAT
FT                   RPGAEETEAGSDEIIMAPSISTGNTDTKRYWNLTKNIYRFAYQIVGPGFNNVHTIDEHI
FT                   EADVFIEQVRWFMNFIVNVDESDEV"
FT   CDS_pept        join(complement(475862..476153),complement(475673..475811),
FT                   complement(475507..475624),complement(475357..475448),
FT                   complement(474932..475306),complement(474799..474880),
FT                   complement(474448..474748),complement(473943..474391))
FT                   /codon_start=1
FT                   /gene_family="HOG000268792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093390"
FT                   /locus_tag="CNG01650"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44577.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000042FBCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE58"
FT                   /transl_table=1
FT                   /translation="MVAARKRSPTPEAQDAFELPEDYKPYVPVAKRRAQMLSQLGAKHS
FT                   AKKVKTQEELEKEMEEELKEQAEDEARAREKARRERTLLQAAQEVKEQRALEDAKKSAA
FT                   EREAEKEAALLAEMERAQKKLAGAQELAQGVSWTESLKTSWRAPHYIRNKTEDEQQAVR
FT                   DKYHIIVEGENIPPPIPHFADMKIPKPILGYLQAKGIKHPTPIQMQGLPTAFSGRDMIG
FT                   IAFTGSGKTLAFILPAIMAALEMEAKVPFVRGEGPVGLIICPSRELARQTYEQCVAMCT
FT                   VLKESGSYPELRSLLCIGGISMADQADVLNKGVHVVVATPGRLIDMLDKRKLNADNCKY
FT                   LCMDEADRMIDMGFEEDVRSIMSHFKYQRQTLLFSATMPRKIQDFAQQSLINPILVNVG
FT                   RAGAANMDVIQEVEYVKQEAKMVYLLECLQKTPPPVIIFSDNKNEVDDIQEYLLLKGIE
FT                   AVAIHGSKTQEEREYAIRSFKTGAKDVMVASGVASKGLDFNEIQHVIVYSMPKEIEDYV
FT                   HEIGRTGRSGKTGLATTFVNMNTSEQTLLDLKYLLMEAKQKIPDFLLSIDDPRAIQGGA
FT                   LKGCPICGGLGHGLSDCPKLEEETRRKQAAQTRYQGGGY"
FT   CDS_pept        join(476228..476383,476458..476492,476544..476592,
FT                   476698..476799,476858..476930,476979..477085,
FT                   477132..477482,477535..477685,477734..478320,
FT                   478370..478445,478501..478710,478778..479034,
FT                   479091..479534,479602..479749,479805..479906,4
FT                   79960..480504)
FT                   /codon_start=1
FT                   /gene_family="HOG000209012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093391"
FT                   /locus_tag="CNG01660"
FT                   /product="Crm1-F1, putative"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="AAW44579.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG028487"
FT                   /db_xref="HOGENOM:HBG315058"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00004B48F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE57"
FT                   /transl_table=1
FT                   /translation="MRKGAWWNKEMVPLLLLRVSSSALSTEHLPPSHTISSPLLPSFLP
FT                   LPTATMEAILDFSNDLDVGLIDQVVQAFYTGSGETQQTAQRVLTQFQENPDSWQRVPAI
FT                   LETSQNLNTKYIALQVLEKLVQVRWKALPADQQTGIRNFIVQATVEISSDESRMRREKG
FT                   YLNKLNLVLVQILKQAWPKDWPQFIPEICESSRTNLSLCENNMIILRLLSEEVFDFSAE
FT                   QMTQAKTKALKQTMCAEFGEIFNLCNEVLEKANKPSLIRATLETLLRFLNWIPLGYIFE
FT                   TQIIDILVSRFLEVPDFRNVTLKCLSEIGALNVGPEYNSKFVTLFQVVMTSINRMVPPH
FT                   TDMAGAYASSDDEDQQLIKNLALFLTNFLHPHLRLIETPENTELLINAHLYLVKISTVD
FT                   DREVFKICLEYWLKLVTELYEEIQSLPLNDINPLMNLNLGGIGGGLNGAQGMGLNGMPL
FT                   RKNVYSDILSNLRLVMIEKMVKPEEVLIVENEEGEIVREFMKESDTIVLYKSMREVLVY
FT                   LTHLDVVDTETIMTDKLAKQIDGSEWSWNNLNTLCWAIGSISGAMNEETEKRFLVTVIK
FT                   DLLGLTEMKRGKDNKAVCASDIMYIVGQYPRFLKAHWKFLKTVVNKLFEFMHETHEGVQ
FT                   DMACDTFIKIAQKCRRHFVMQQAGEQEPFIDEILRTLHRITVDLSPQQVHTFYEAVGYM
FT                   IASQPNKPTQERLIEKLMELPNNAWDNLMQQAASSVDVLGNPENVKILANILKTNVSAC
FT                   SSIGPFFLPQLGRIWLDMLGLYRTVSGIISDDIAAMGEVATKTPKVRALRTIKKEILKL
FT                   VETYVKKAEDIEGVYNNLIPGLFDAILGDYNRNVPAARDAEVLNVTATIVSKLGPILTP
FT                   QIAPILDAVFEPTLGMINQDFAEYPEHRVGFFKLLRAINLTCFQALLEIPPGQFKLIVD
FT                   SIVWAFKHTMRDIADTGLNIAYEIVNNFAASTPEIANQFYQQYLLSLVGDVFFVLTDAD
FT                   HKSGLKMQGMLLAQLIALVETGAVQAPLFDPAQVTDPGMNNVIFLKGYISDLLSNAFGH
FT                   VQPAQIASFVNLMFETAADHNKFKLTIRDFLISLKEFSGDNAELYIDEREAEAERRERE
FT                   EREAASRVPGMLKPAQIEDDTEL"
FT   CDS_pept        join(complement(482371..483032),complement(482005..482071),
FT                   complement(481844..481943),complement(481510..481781),
FT                   complement(481352..481421),complement(481244..481275))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789294"
FT                   /locus_tag="CNG01670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44581.1"
FT                   /db_xref="HOGENOM:HBG068375"
FT                   /db_xref="HOGENOM:HBG177252"
FT                   /db_xref="UniParc:UPI00004B48F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE56"
FT                   /transl_table=1
FT                   /translation="MDGQAPSPVIHTPSQRPYPYHPNAGYPYTQQQPYPSPLPTHPARQ
FT                   LHTPLPYNPSQRPVHPLPNGHSPTFPMTPPYAPYLNGPIQTSPPSSSGSEALPSNQIHI
FT                   VQTTPLPVMLRSSSTLSTTSTNRPPPLSNGPSPAVEEVIVDMSDQYEMYPPQQAQMRQV
FT                   GPRTGLDQVQARSVVNATRPNEMDGVPRQMVMPQQIPISNPLSSATVVGTSDSNLWQRP
FT                   LEDGTGLRVVANFLEGLGAMQSKNLEGWLSFVMSHFENNSRFQFVLIGEKFQMFDVPIT
FT                   YLPRFFLSLPSPPSIILTDPIESLPSTEETMVLCPDMEWRCDSKAWKGALNMVVGKRGK
FT                   IEKMDIVLGNRDEGGEIFSEGALRVLKMAQEMESFALVMRLAQQENLPPREALQQFIQE
FT                   E"
FT   CDS_pept        join(483181..483297,483509..483625,483714..483830,
FT                   483887..483968,484015..484031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806664"
FT                   /locus_tag="CNG01680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44583.1"
FT                   /db_xref="HOGENOM:HBG068374"
FT                   /db_xref="HOGENOM:HBG177253"
FT                   /db_xref="UniParc:UPI00004B48F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE55"
FT                   /transl_table=1
FT                   /translation="MLRLTNTARTTIRQLSTSAVRREEAAAVGTVGAVPVKRPFFGFAC
FT                   ASSLSIYYLQQETKLATGLLTASIEELQQGTGKITSHLDRLQTVEKELATLKANNALKE
FT                   DVTKVRGEMKKVYDGLHLELLDLRAHVWGVEQDLQTVVKTESIKI"
FT   CDS_pept        join(complement(484837..484905),complement(484627..484772),
FT                   complement(484251..484557))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789295"
FT                   /locus_tag="CNG01690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44855.1"
FT                   /db_xref="HOGENOM:HBG068619"
FT                   /db_xref="HOGENOM:HBG177254"
FT                   /db_xref="UniParc:UPI00004B48F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE54"
FT                   /transl_table=1
FT                   /translation="MGLFDYFLCCGPRKGKAPSSTSPTRENNPLLLPINREESIVSAEG
FT                   PQGYGSTERLTDEQRVRIETIGRETGTYMLPIQSLPPRSRLSMSRTSTIPRSLSSGPSS
FT                   RPSSPPLAQSGDKDQSSPLEETKTLGGDEKDGDVVRKTLFANGTPMNLGARKTSGGGKG
FT                   RGKAKNKSKK"
FT   CDS_pept        join(complement(486173..486207),complement(486031..486119),
FT                   complement(485928..485960),complement(485777..485865),
FT                   complement(485546..485713),complement(485337..485437),
FT                   complement(485250..485274))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942404"
FT                   /locus_tag="CNG01700"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW44585.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG177255"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000042F06A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE53"
FT                   /transl_table=1
FT                   /translation="MVQLRNCMGLAKIGIVDAYGNVLMESFVRHHPANVVNYVTRKSGI
FT                   RPQDLVGAPTYEQIQPQIIELIKDKIVIGHTLFNDLAVIGHRHQYEMMRDTALYYPLRT
FT                   LVGVRSEGVWPSLRKLAAAVLNMEMHAAGTAHDPVEDARMTMAIFMTVREEYEDALWRG
FT                   KDVVACLPERYVSCYW"
FT   CDS_pept        join(complement(488123..488349),complement(487709..488062),
FT                   complement(487509..487642),complement(487273..487450),
FT                   complement(486905..487217))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806665"
FT                   /locus_tag="CNG01710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44587.1"
FT                   /db_xref="HOGENOM:HBG068373"
FT                   /db_xref="HOGENOM:HBG177256"
FT                   /db_xref="UniParc:UPI00004B48F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE52"
FT                   /transl_table=1
FT                   /translation="MSPFLTTAILSALLSFVPSPASAVTLDSIIDAYGLTSAQYNFTWP
FT                   DQALDSTDANDWIDSKWSLNGNKVDWGSSYIVFSADPSTTSSTLVRRQGSSTSSSTTST
FT                   STKSAKTSSAKTSSAVATASATSSGVSYPAVTDLNGEPPALRVEYPSGSYSKKTGGTQF
FT                   YAQPLNGSDSSGGALERMLLSYDIWFPTGFSWNKGGKLPGLRGGPETHGCSGGDATNGT
FT                   TCFSTRLMWRASGAGEVYAYIPTTQKGFCSETDVTCNSDYGTSLARGSFSFTTGQWQTI
FT                   YLMVILNEVGTANGVVQLWYNGVPAMTFTDLIIRTSSDITSVGGLYFSTFFGGDDSEWA
FT                   TPTQQFTYYRNIQLYGGVGASNLTGAAASSAGHRTAALGGMKSVGMGVALGLIGVAAGL
FT                   LL"
FT   CDS_pept        join(489604..489984,490040..490047,490104..490236,
FT                   490289..490377,490425..490470,490527..490612,
FT                   490664..490670,490723..490911,490966..490998,
FT                   491052..491184,491234..491405,491457..491665,4
FT                   91719..491750)
FT                   /codon_start=1
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806666"
FT                   /locus_tag="CNG01720"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="AAW44589.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG058461"
FT                   /db_xref="HOGENOM:HBG741095"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00004B48F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE51"
FT                   /transl_table=1
FT                   /translation="MHIEDEKTIRCVGVLAGNGLGPQIGKRRLLRFSCTVAQQSFTSLY
FT                   ICHLDPFLMAHSPKPAQYPSANKKPTFKPSLAFLAVLLLAAIAFLFTQIDFAFPSHPWK
FT                   TVGKLLKGGELEMNNPKRTVGYFVNWGIYDRKFFPQNIPSQHLTHINYAFGNVKKDSGE
FT                   VVLSDSWADVEIHYDGDSWDEPGTNLYGCFKAIYLMKKQNRNLKVLLSIGGWSFSPNFA
FT                   GIVHPKWRSTFVQSAVKLVEDVGLDGLDIDYEYPKTPRDAEAYVALLRELRQGLEQLAQ
FT                   SKGKPQGQYQLTIAAPCGWEQMQVLRVKEMDQVLDFWNLMAYDFAGSWDSVAGHQANLY
FT                   SDKPDGQSVDRSVRFYLEAGVHPTKLVVGLPVYGRSFANTKGIGSPFSGTGEGSWEAGM
FT                   WDYKALPQPGAQEINDHRLGASYSYDPAKRFLISYDTQAIAHQKASYIAYHGLGGAMWW
FT                   ELDSDKPEETGQALVRTVRDALGQLEWRENELDYPGSKYDNLRRRME"
FT   CDS_pept        join(492119..493076,493135..493451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806667"
FT                   /locus_tag="CNG01730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44591.1"
FT                   /db_xref="HOGENOM:HBG068372"
FT                   /db_xref="HOGENOM:HBG177257"
FT                   /db_xref="UniParc:UPI00004B48F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE50"
FT                   /transl_table=1
FT                   /translation="MTHFQVFLPPPSLPSLSSFKDASVISTEQLLTFHRLNPPPREESH
FT                   SLPPPNDDPSNNPPEAMDVHYTDQTEATGHGKVSVLGKRAVSSRAIGSQSDQNEDIEIS
FT                   TFEERSRNRMPPPPSLPTTNHPAVRTSPRRASKKLVTRPSFILPSSTKRSTTLPDQGQE
FT                   QSLGLESTLNTTASSWPSQIPPSAGAETSIFNFPSWSVPTSRLTSLQDVLKKGSAPQQG
FT                   GLVFDNGYGGKERYNIIACIASVDTPLERQRKTQLGMRGRTKGRQDASDTLWIGKWMIT
FT                   APPDGNEGQVSCVVRLWDECAKDWGDEKVRKGDVVLLENVELKSASAKELAHLVLTPSS
FT                   RPKITILYRILPRYTTTTASDYIYRAPGAVLQHHLDGERKRDIVKEDRYLRPDLRLGSS
FT                   DVGVRMVAGVVEWFADWIGGEGPSA"
FT   CDS_pept        join(complement(494254..494551),complement(493930..494204),
FT                   complement(493873..493878),complement(493715..493818),
FT                   complement(493557..493659))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942405"
FT                   /locus_tag="CNG01740"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44593.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00004B48FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE49"
FT                   /transl_table=1
FT                   /translation="MRVPTTMSPVIILTGASRGLGLAVLRILLAKHNARVATLSRSLTP
FT                   ELQGAVDEYGADRVLPVQGDVSKPEDNARVVKEAVDKWGQLDGLVLNAGSIDPVDKIGN
FT                   VQLDALIPYVQTNLLSTIYLLQPALPHLRKSKGRVVLVSSGASSTGYQAWGLYSMAKAG
FT                   MNSLARTVASEEKENGVAIWSVRPGMVNTDMQSFLRTHGPAEMSPTDMAKFQSAYEKGE
FT                   LLAPEQPGSVLAGMAVNGPIELSGEYINWADERLKAFQA"
FT   CDS_pept        join(494809..495581,495635..495704,495872..495934,
FT                   495980..496217,496337..497360,497412..497488,
FT                   497537..497898,497957..498436)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093392"
FT                   /locus_tag="CNG01750"
FT                   /product="Transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44595.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG068371"
FT                   /db_xref="HOGENOM:HBG177258"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00004B48FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE48"
FT                   /transl_table=1
FT                   /translation="MSRVPSGSQQPQYTQQPLYHPSSVHSQSTPIQQTHQQYHPHTGQP
FT                   MTFQGDAHAYSYDRQSQINTWQANPGAAGSMEYHSAVAGSSRGADPYQPYSQSHRSSPS
FT                   QSVTASRTQPASAQQYTPWAPVQTSATTPSSRGGGVKLEDLMSSDSRAGGKNQPLSGIP
FT                   LSVSASFDTRSQFSAGPQGASAEKEKDKERDKATQQQGPSEFIKKLYKMLEEEQAQYGN
FT                   SRTKKGEKGKRGSVGWGANGTSFVVWDMNDFTTKILPQTFRHSNFSSFVRQLNKYGFSK
FT                   IWEFQHPNFQAGGKSDLESIKRKPVAPKKANNQEGDENSPRHIGLSNEDQTRMHLMEDR
FT                   INMLEDALAKSRSEADEARMREMAMMGLVRDMIGHIAASESDNLARAYPPEMYHSNIAR
FT                   QPTTMPYTPAQPQSHQSFLNAAYNPAFSGNSVGGAVQAQASPHTDGTGSRGSFSGPSTG
FT                   EIKPPASSSRLRAASNAGAAPSGSVNASVPLASQPSGNPPAGPVARAEDPAEDVIEIPN
FT                   QMQDMYGGESVGIAPLFVETPAWLTEGTTVPLTMYRKQSDGQVLKAVYQAFAAGGKLPA
FT                   GEGQDEDGNAIASGSSTSAAEIMAGSSQMGLQQSYGAGSSTSTGIPLPMDGSPSSESSS
FT                   RKGKGKKSRGTSLKEQRESKLKPHWAQTPRILVVEDDIVYRTLSKKFLQKFGCETETVE
FT                   NAQGAVDKMNGTKYDLVLMDIFFGPNMDGRKATSLIRQFNNYTPIISMTSNAQPQDVDS
FT                   YYQSGMNDILAKPFTKNHLFTILDKHLVHLRHAQLYERLIPLGVGVPPLSDQHVQEALA
FT                   VSAANLQNTNGQLQLENGPTAETQNEQQDSNGELELGIRNPLAGSGWSDEAYQLVLAQF
FT                   LQTGVMPDITTISAVSSSPNPNGIDGTIGTSIVFGESSGFSRKRSIEAISDDNWDGQAQ
FT                   TSASVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQTQAQAQNTIMQGDQQQGMSLQMPMN
FT                   VGMGMEVNMGNMPESGMMNQDISNGSDGREAKRARGMAG"
FT   CDS_pept        join(complement(500087..500326),complement(499850..500027),
FT                   complement(499711..499791),complement(498747..499657))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806668"
FT                   /locus_tag="CNG01760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44597.1"
FT                   /db_xref="HOGENOM:HBG068370"
FT                   /db_xref="HOGENOM:HBG177259"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniParc:UPI00004B48FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE47"
FT                   /transl_table=1
FT                   /translation="MNRSLRILKPQTYTLPYRPRPSGLPSNLLRPIAPTASPAGAKVSQ
FT                   YLTFMRTYATGPSNNVDNDNKYVEKQKATPGAKEELKGLTTDFAKIVAGNSREAAQLGA
FT                   REQSTTRAHPGSITEDFGSITSAMWTAVPKPAMFFGLAGTLPYLGTSLGTVFLARQASI
FT                   ASSNGSGAELADILQNLHFVEHVQITYGAVLLSFLGAIHWGMEFAKLGGEKGALRLALG
FT                   AAPVLFAWPTTFLTHGVALAAQWCGFTAMWAADQRASSAGWTTGWYSTYRFYLSIVVGL
FT                   SIIGTLAGTSIYGAGAGANFDPDTKHFEHNTRRVSPLARYDRVKDMKESSKSRIEGKVK
FT                   GDISVVEDDESFLRLKNVQKEEDQKKEEEEEQKKKAEEQDKKEGEQKDKSPEGMKDDQK
FT                   KRTGGGEKKDEGKKDEGQKDKGKQDGSQPQKKDQGGEKDPKQAEKDDQDAKKKKAQEEK
FT                   GAAGDPNAGMR"
FT   CDS_pept        join(complement(502102..502755),complement(501706..502042),
FT                   complement(501575..501647),complement(500949..501522),
FT                   complement(500802..500884),complement(500697..500739))
FT                   /codon_start=1
FT                   /gene_family="HOG000138264" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581881"
FT                   /locus_tag="CNG01770"
FT                   /product="Transcriptional activator, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44599.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068369"
FT                   /db_xref="HOGENOM:HBG177260"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00004B48FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE46"
FT                   /transl_table=1
FT                   /translation="MSEAGENREEDSGAKLQTSELEQNDLGHEERESKRRKLDNGEESA
FT                   EQIVSRQASPVPNPSQEGESPSATEQPPAKALTPSVPSPKQSSAKPDIIAAPEPAEVLN
FT                   VLPAATIGPINGTENEPSGQPLNVSVCSPPTMVKDEDIEIVDGTVPEFAPAPVRDENEM
FT                   IKKEDVSTPAAADSPATEKDEVSSAKGKTKSALVSKSQASKGKKAPAKKGKAKTKVEEL
FT                   KGSKERSASVSVSASHLYFRSSTESSTQESRDSTPPVSTDQSQFTSPSGAPIDSNAVYC
FT                   ICRRPDTDDDDGLMVGCESCDGWFHASCVGLDEEMVELLDVYICKSCERTQRTIYKQVC
FT                   KRDGCRKSVAGSSSKFCSSQCAFRYSQAMLGAITNKTAIKQLSKALTSFPRPKLGVTVE
FT                   HHVPAKSETSIFSVYDDTQTQLLTLQKRQEGAQKAMERIQKRQALLRNAVDRCEQLPPI
FT                   AATETEESQQKGKKRKAGRPADDRPCGWEASLIAEDEEVEELVKGEGDEMEVVEGEREV
FT                   CMLPRRRCDRHQGWQKTVAVSLDLELATLTRTYESLQENQRLIEEANQALKISEEAREM
FT                   FLAKKQAVKRK"
FT   CDS_pept        join(complement(502102..502755),complement(501706..502042),
FT                   complement(501575..501647),complement(500871..501522))
FT                   /codon_start=1
FT                   /gene_family="HOG000138264" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581881"
FT                   /locus_tag="CNG01770"
FT                   /product="Transcriptional activator, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44600.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068369"
FT                   /db_xref="HOGENOM:HBG177260"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00004B48FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE46"
FT                   /transl_table=1
FT                   /translation="MSEAGENREEDSGAKLQTSELEQNDLGHEERESKRRKLDNGEESA
FT                   EQIVSRQASPVPNPSQEGESPSATEQPPAKALTPSVPSPKQSSAKPDIIAAPEPAEVLN
FT                   VLPAATIGPINGTENEPSGQPLNVSVCSPPTMVKDEDIEIVDGTVPEFAPAPVRDENEM
FT                   IKKEDVSTPAAADSPATEKDEVSSAKGKTKSALVSKSQASKGKKAPAKKGKAKTKVEEL
FT                   KGSKERSASVSVSASHLYFRSSTESSTQESRDSTPPVSTDQSQFTSPSGAPIDSNAVYC
FT                   ICRRPDTDDDDGLMVGCESCDGWFHASCVGLDEEMVELLDVYICKSCERTQRTIYKQVC
FT                   KRDGCRKSVAGSSSKFCSSQCAFRYSQAMLGAITNKTAIKQLSKALTSFPRPKLGVTVE
FT                   HHVPAKSETSIFSVYDDTQTQLLTLQKRQEGAQKAMERIQKRQALLRNAVDRCEQLPPI
FT                   AATETEESQQKGKKRKAGRPADDRPCGWEASLIAEDEEVEELVKGEGDEMEVVEGEREV
FT                   CMLPRRRCDRHQGWQKTVAVSLDLELATLVSVASSPARGLFQSSHKATHADAHV"
FT   CDS_pept        join(503974..504150,504271..505380)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806669"
FT                   /locus_tag="CNG01780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44602.1"
FT                   /db_xref="HOGENOM:HBG068368"
FT                   /db_xref="HOGENOM:HBG177261"
FT                   /db_xref="UniParc:UPI00004B48FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE44"
FT                   /transl_table=1
FT                   /translation="MPSTLALFTSLLAASGALAHLQLAWPYALHSTLDPETPEEIKDYS
FT                   MTSPLLTDGTYPCKGFINSPESNMYSRVTWDAGSTVNYTIAGTATHGGGSCQMSMSYDN
FT                   GTTWNVIQSWMGGCPIDAMTAEVTIPTDAPSGYALFAWGWFNLEGNREMYHNCAPVTIA
FT                   NGGSGLNDDDYPTPFVANAGVNDCVTIENVAVVFPNPGKNVKYGASYATSQPTEPAGYT
FT                   GTNCVGPGASSSTSSSGSNSSQPATSISAAAIATSSANPAASASAVDSPADVSVGTGAQ
FT                   TSIAAATVSTADVIGNIAASSASLSPAVAVASSSPKSCKRKRSKAGNKKPFLSRHERHV
FT                   PRQPGSSGRYAASKASHPQSASKRDGIKRVAASMATHPQAAAKRDGAIHHRAVVKREEA
FT                   PKRFAASKATHPRDVKRGFMGRLFFGESS"
FT   CDS_pept        complement(507883..508989)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806670"
FT                   /locus_tag="CNG01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44606.1"
FT                   /db_xref="HOGENOM:HBG177262"
FT                   /db_xref="UniParc:UPI00004B4900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE43"
FT                   /transl_table=1
FT                   /translation="MASGIVSGSLSSNSHSHHSLPSPPTRPPRLAPDAQQELIIDRPTR
FT                   KPTSPSRPVAGESFWRWSHNTPSTVDTYAPTELHFPASHSPGDSEGRRMEARSTYYSDF
FT                   SAGSTVPDVNDLAILPTIFKRGQALQPVMQNQEAARGLTSIPEAPSSTHSQEQQETVHS
FT                   QPRDIPEKDRKRSSAGTFGPKNGKYPSIYSINSSNASPERHIASNIYDIPRAANQTKRR
FT                   PLSYSATSTSPQTFTTPKAADDTAAVASRRAMGMTSPSDRADHREPESESQIEDYLRRQ
FT                   SKCNQRRIAPASSPAPTSGFGFESAVDLNDDLEDKMKKSKKEFRKSKVDQMLGEGAEYA
FT                   RMTMELNRATLRKAFDGPVKQTQVSILS"
FT   CDS_pept        join(509974..510177,510232..510360,510416..510495,
FT                   510557..510788,510844..511080)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806671"
FT                   /locus_tag="CNG01800"
FT                   /product="Mitochondrion protein, putative "
FT                   /protein_id="AAW44608.1"
FT                   /db_xref="HOGENOM:HBG301472"
FT                   /db_xref="HOGENOM:HBG715231"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="UniParc:UPI00004B4901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE42"
FT                   /transl_table=1
FT                   /translation="MSFFRPVVSSASFTSSPSRHVAPRAVRQCRCLSTTSITLSGHNRW
FT                   SKIRHRKGAADQQRGALFAKLSREIMVSMRPPASADPALNSRLATALQRAKEQGLTKQG
FT                   IENAMSRARAVAEGSGQNVMYEAVASGGKVAFMIECVTQNSARLVKRVKELLSKNGARI
FT                   SPVSFLFEKKGSITLTPNDEDAGYEHLFDLAVEAGAEDVKEIEGEDGSVEFEVITTPSD
FT                   LSSITSTLQSNPAYSLQSSDLVFLPNDPLKVLEQGEDGEGITEETMESVMRLVDILEEE
FT                   NEVVKVWTNLDE"
FT   CDS_pept        join(511374..511747,511813..512890,512955..513155,
FT                   513220..513355,513440..513681)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806672"
FT                   /locus_tag="CNG01810"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44610.1"
FT                   /db_xref="HOGENOM:HBG068366"
FT                   /db_xref="HOGENOM:HBG177263"
FT                   /db_xref="UniParc:UPI00004B4902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE41"
FT                   /transl_table=1
FT                   /translation="MAQPSPSAILGQQPFPIDPAPAPAQPNPIPTSTPTLLTYLHALLD
FT                   VRQSQNLTLPYLQPFAPLSSRPLPRMNNNGQRGDGGKGKEKVKSDLDVIRELRESVASW
FT                   RGVLTKENQEGGRLTTALKEVITHQSALLSSAAALLPQASSSTKPLFLSSHLLSQPTKL
FT                   LQSIASAVSLQTFLEDSQFGLQQSSLAIAGERLVVDVDLGVDLGGEEDESRMGTPMGTP
FT                   RPYTPVPGAMPTSALTQNSDERGKVKLLKLVASHVTPSGGTGQCEWVRKVLNELVNDYL
FT                   ALWNAPVLEEGYSLEKGLWEREETARRLEQEFADLKWFDDVAGDESVDWFEELEKITGT
FT                   VERLVAETRYVSLNIFPKGSKMYNDNEKKNSEQRLYPTDKHSVFPTFRLLPSSSIGTNP
FT                   IWRIRPAKSSNESVPTISSIHSTKSDVGGAGDLDMEEQWLETDWVIECIEENGIAGVVV
FT                   SRNWLIDSGHEEKQQVSGTIRLENLLYHPFQQPTFLAIPQQQPFPYTAPFIHSSKDGNG
FT                   LDQHWSIAQPGPLGWVVGRIGMGRNLKGLYGTIKALRKQLVLNQMFASVFKSEALTTYE
FT                   NGNGEEGHDEDDDMDDDWFSGPPKAVPCSATLHQNSISITIPLLDHEGKCEHLEIIAKA
FT                   SDEGPGYTNVEYKGGKIDESEADRDLVSLVRKVLEQRTKQS"
FT   CDS_pept        join(complement(516107..516166),complement(515790..515988),
FT                   complement(515534..515727),complement(515354..515482),
FT                   complement(514124..515301),complement(513925..514063))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789297"
FT                   /locus_tag="CNG01820"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAW44612.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG068365"
FT                   /db_xref="HOGENOM:HBG177264"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00004B4903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE40"
FT                   /transl_table=1
FT                   /translation="MREMSASSSSSQSSGIPGIPRVGAVRCYWALLKPRYDPNPDPGIT
FT                   VPQLELEFVHFDPILDAHLSKQKGSMMARSVLEFIHPHEREQARKDLLGAISADDLQGS
FT                   VTRVRFARLSQIRTLLGCPPEENEIPADADAIVEDNEYIILDLVLNWVATGLLLAFFHP
FT                   IKDKDPVANNDPKRANEEWSNWCGTKFMGDDQIGALCRNVTYNIPIAPSTHRPPARVFQ
FT                   LHLLPPDHMTYAPTQLIFSWPPARPAGVPAGPDGLYDASEYCDMMKHVDMDPSQLKAGP
FT                   GELRTNCTTRYGAHHLVTTEGLHRTVASVFIPYGRLIFACFQTIKAYELPRNQNNYAMQ
FT                   ANDWRKGHTHQSVGDKMDPAASEHSSNAPNRHTEAQNQLQHALAQRHSQSEAAQPQHSA
FT                   IDWSTDSSLLRTRQGSGNDDWDSSVAYELGNLGMAVHEPGSQAVSNMSQHQEHQADGSH
FT                   AASSGATYSTNAPSSSFYSSSEYGNPLYSAVSSQTQSSTSVSSAAQMASIQSSSSTSSA
FT                   TGQRPIHSQSLKGSIARAVQSGAPPQSSGKSSTRPLVRPPGDVEACVMCGTKESPEWRK
FT                   NTNGVKDLCNACGLRMARQVAKRDGKQKPRKKREQGNTPSRGESVTKDSYGISGKM"
FT   CDS_pept        join(517187..517222,517296..517641,517694..517814,
FT                   517866..518017,518081..518193,518249..518324,
FT                   518392..518547,518602..518675)
FT                   /codon_start=1
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636626"
FT                   /locus_tag="CNG01830"
FT                   /product="Oxidoreductase, putative "
FT                   /function="3-beta-hydroxy-delta5-steroid dehydrogenase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="AAW44614.1"
FT                   /db_xref="GO:0003854"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG068364"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE39"
FT                   /transl_table=1
FT                   /translation="MPTVLLTGITGFLSAHVAHTFLKHDWIVHGTLRSSSKVALIEVIP
FT                   EYSPYISSGKLKLFVVGPLENADYTEAMKGVDAVVHTASPVEFGGDNFRESHLKPALEG
FT                   TRGVLRAVAKEKNVKSVVYTSTFGAVGDHRYHPTEIKGKVITEDNWNPYTLEELDKMVE
FT                   SGESGNPTFPPGYLFYKGAKKYAELAAWECQKEAREQGAEWSLATMNCVMIWGPPIQPL
FT                   TSLSHGGMSTEFLWMLAGGKDAHIMDSLYPYYVDVRDAAEAHYQATVRRAQGRFIISAG
FT                   PYDFQEFADMLRELYPEQKERFALGAPGKYMYRDPGVYVLTNEKSQRELGITYRPKQET
FT                   LKDAFDRFFALEKQGLK"
FT   tRNA            complement(518952..519045)
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        join(519509..519639,519705..520061,520111..520432,
FT                   520487..521305,521343..522692,522744..522878,5
FT                   22932..523960)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806673"
FT                   /locus_tag="CNG01850"
FT                   /product="Phosphatase associated protein, putative "
FT                   /protein_id="AAW44616.1"
FT                   /db_xref="HOGENOM:HBG068363"
FT                   /db_xref="HOGENOM:HBG177265"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniParc:UPI00004B4905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE38"
FT                   /transl_table=1
FT                   /translation="MLWRFNLTSTSTLDSLLSREIPPTLEELMDEPDILGECKAQNNKL
FT                   VTFLSREDSAKSLLQWVIAGLDELDQAAAIADSEVLSHAITSPDLYPSYKSPTALVVPG
FT                   SGPGSPPLDPAKSRENGVDVFVNEKPKDEEEYDEDLSIPGGGQGLRRRSEADDDLHRSK
FT                   YPATATEILTCNEIWSISDTIMRNADTLLTPFWDAVLPPIEAITPTTEGTSSLASSVAM
FT                   SRQEAGERERARNEFWSEQDEERDRRREVIRGLWMRVNGVLLAKRGSDMIHFIQSLPNI
FT                   VERIIARISSPAIQALLVTIISSEEAGVLGVIDWLASEDLIPRLLNLLSPQYSSSIHTI
FT                   VAELIKQIITLCAPSPFNPHGGNAEQQASQGPAGGRDNRLIRDLVSERSVGIMTSYMLD
FT                   KIELSDRDWNGINGEGGDPSPADPLIVHPLPSIASATSSLASICVILIEVIRRNNSDFS
FT                   EPHLFHTLRNRLISVRMQEEMDNREIQHRADETEQEKDEKERRHMEDALVDMTSKMGIV
FT                   HLGHLLDAISDRFAQLHRLVLQPRSQMKQRRVASIANPKPFTLERFRIIELYAELLHSS
FT                   NMSILNRTPGTGPVYTEDGILSGGLEGLEALGEAIEDNDNEQAGEPSHQEEDGVTPAKE
FT                   LPVSESASGSLTGSDDMESEDEDVLEAVNDDATPSPSPGASGLMENPIGADSTITPPLS
FT                   QEVADRLKGVMETESKPTASSVTSDLTSVSPIAAAASITSPSVSSDTPEAEPKPALGLK
FT                   PSDDSIETLHFTTAHPPSYTRLPPGERLKRQYLSCKVMPAMVDLFFEYPENDFMHSVVY
FT                   DIFQQVLNGKLSPGSNRDLVVQLMKEAKLVERVLDAQRLNDRLVAQSKSPRLPYMGHLI
FT                   LIAEEIVKFFARCPSDLYDIIKNTFISSEWEAFVNTSLREAKDRDDKPLAGGKPAHPSS
FT                   IKSPDDSASDEDDDDEPGEGSIRFGEPLTRTSAKDGFASRGEFDAYADHDENGDGDDEE
FT                   AMDRYWKSSGLGLSRQRAADSSDDDDDADWLQPPANSWGASGGDEDDFGAWETGETRPA
FT                   SDEFEDDAWGNFTSAPSNDNAENPFGDDNFAPSVVRVEPLQQKGDEPLTPLDWAEQFDR
FT                   AFREGGGDDVPAPVSDDGEGEQGEAEEGEGVVPIVMPSLEDDEEEEVSAVMSGSMDLSM
FT                   SPGTNSWTFEGDDAGVDLPLAESSYTSHASGPAPPLNVSASPGDESSSSASIDTSFTSS
FT                   SDSTMRTTSAAAATPIVIPNRHNSMSHSRHNSLSGSWGHRPHPGHPITATSPSASSASS
FT                   RASSSSPTSPSKVQRWGEAFSPPDPALIAAATEESPLGPGVSPDTRITKDGMLEREVNG
FT                   QSITVPQDEIVEAIERNADDIEELENQEALSRSIGSV"
FT   CDS_pept        join(complement(525330..525706),complement(525237..525278),
FT                   complement(525078..525177),complement(524739..525024),
FT                   complement(524540..524685),complement(524391..524487),
FT                   complement(524193..524329))
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636627"
FT                   /locus_tag="CNG01860"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44566.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI000042DF12"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE37"
FT                   /transl_table=1
FT                   /translation="MTCRSVLVYCVALAVVGLVRGQTATEEEHDHDHDHESEEAVETDD
FT                   AATGLHAGHTHAHSSSDCGVTELQDYNLSLHIAAVFVMLVASAIGVFLPVILGKLGSRN
FT                   KLFGSVFFVLKYFGSGIIISLAFVHLLIHAFFNLTSPCVGNLEYESAAPAIAMATVIVV
FT                   WLVDFFGSRYIARQNSKLRECDRNISAAPGFSPDPTEERKKDDISTPMTELACCGPNNL
FT                   EITNFDGAAKIAHWNVQLLEYGVIFHSVMIGVSLGAMGTGFSTTFAALVFHQLFEGLGL
FT                   GARIAMLVWPSGISSTIKKWSMCLAYALTTSVGIAIGIGVHASVNMNGRAILLSTGILD
FT                   SISAGILLYSGLCQLLYREWVVGEMRDASTSKIIVALVSLFLGLFAMSFIGKWI"
FT   CDS_pept        join(complement(528289..528599),complement(528177..528218),
FT                   complement(528027..528126),complement(527767..527978),
FT                   complement(527662..527711),complement(527450..527595),
FT                   complement(527300..527396),complement(527109..527245))
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806674"
FT                   /locus_tag="CNG01870"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44878.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI00004B4906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE36"
FT                   /transl_table=1
FT                   /translation="MTFSLLEKGALQHILIALAWLAIARADSIDAIADSADSSCASGDV
FT                   AGHYDLGLHIASVFVLLVASGLGVFLPVILGEKGSRSVWFGNTFFVLKYFGTGIIISLA
FT                   FCHLLQESFKTFSNECIGELAYEPTAPAIAMGSMFVIWLIDFFGSRRLANRKALSSLDA
FT                   HQSCEPCEPSSPDTKSPVADLCCDSGLKSVAETSDRANRRAHWDVQLLEGGIVFHSIMI
FT                   GVSLGAQTDGFSATFAALIFHQLFEGLGLGARISLLIWPSGITSSVKKHLLCLAYTLTT
FT                   PVGIAIGIGVHQSFNENGEAELLAIGVLNSVSAGILLYSGLCQLLYSEWVVGDMRNASN
FT                   MRVAVALIALVSGLFGMSLIGKWT"
FT   CDS_pept        complement(529671..531590)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806675"
FT                   /locus_tag="CNG01880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44568.1"
FT                   /db_xref="HOGENOM:HBG068362"
FT                   /db_xref="HOGENOM:HBG177266"
FT                   /db_xref="UniParc:UPI00004B4907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE35"
FT                   /transl_table=1
FT                   /translation="MFWRKKTATPLPNYLPPASAEPPKPILKRTVESQEASNLRFAGDT
FT                   KQYLGDVSSPNTQRPPHLPHSHNENDETRRVRPAPLVIVSSHDGPQLPASPGSQGSYSP
FT                   GADSISRVRALSSRRSSRPTSPSTSSFGARVRASNNGQHRRPSAPCHIVMSSPPSSAPA
FT                   TDVAVCTPPARFSPASHVITTPPSPYRPTSEHGAQLEFRPFNERLPMLDEGGSPDHDVE
FT                   DGPDADVPMLNIIPATPQDQGDGFPAKTEVKALEAAAPIEQSIREIEREMVDISLNDEL
FT                   AEQTIWERESVPTIDLDFNFTPLESLMDFSISKDLITAIQNSSILTEEPGQHGSADEPP
FT                   SPFLHDHPPTQPLPPSPPDQTFCSLPSLDSHNTSASPPLPQSSSSSSLASFPDVEEALG
FT                   SMLASLSERSMASTAIHTLQDRNFEFGGEACAGFDDMMVGVGHRTAPLSISTCNNTPHS
FT                   RIARRTPPKLDLSSSKYGHVAPQELQSAPLASRRNAYFPNARVHPNSSPSGIFTVSPSS
FT                   SQSSVSSESRHASHPTPTAGFSNFPASASESELSYMNGGRPIQSYRDSFSGSEISDEEL
FT                   CTASIISVTPVIVQEKMGIKIGEGGDVKKELIFGGHFLKEDASLGFGLGLGLGVEGDEV
FT                   GLAI"
FT   CDS_pept        join(complement(534359..534374),complement(534077..534257),
FT                   complement(533887..533994),complement(533742..533840),
FT                   complement(533375..533684),complement(533107..533323),
FT                   complement(532937..533045),complement(532780..532886),
FT                   complement(532449..532726))
FT                   /codon_start=1
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789298"
FT                   /locus_tag="CNG01890"
FT                   /product="NAD+ diphosphatase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44570.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG177267"
FT                   /db_xref="HOGENOM:HBG736436"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI00004B4908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE34"
FT                   /transl_table=1
FT                   /translation="MIKTACDSKSSIVGRIVNNILRQLSVKTPVTLSATRPLSKDPAID
FT                   QYSSFRRPSQYTAYMGDNIVNFYSGQPALNRVSFQRHISEKVNAHLQNPDTRFYLFKNF
FT                   QPLVKKGDIGTPLYLQRKDVDHIVKDGFGIAPSNISPQAAKLYEATRLPPLAPLIFLGI
FT                   DDRCDPTTNASPAVDHLNPQGTAYFAVDVTDIPLDEEKIGGEWGEARASGGAMEGWDAG
FT                   VFAQARALVDWNGRNKFCPACGSSTYSLWAGWKRGCTSALNPTDGKECFSTKGLHNFAY
FT                   PRTDPVIIMGILDSSGEKMLLGRQKSWPKGMYSCLAGFIEPGESFEDAVRREVLEEAGI
FT                   EVGPVRYSSSQPWPFPANLMVGCFGRAKDGQIIRMDLDNELEDAQWFPRSAIAAIISHP
FT                   DGSSYTPAELKKLEDKSASNQTTAAALAPAERKPGDVSSSSGHEMGVTRLPPATAIAGV
FT                   LIREWAKGGLDLVSKL"
FT   CDS_pept        join(complement(535645..535873),complement(535024..535592),
FT                   complement(534867..534973),complement(534790..534814))
FT                   /codon_start=1
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806676"
FT                   /locus_tag="CNG01900"
FT                   /product="Iron ion homeostasis-related protein, putative "
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="AAW44572.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG156732"
FT                   /db_xref="HOGENOM:HBG294208"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR017065"
FT                   /db_xref="UniParc:UPI00004B4909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE33"
FT                   /transl_table=1
FT                   /translation="MSLATPAIIRRLAVSSRTAAPLLRAVSSNVTRTFASSSRQQLVAS
FT                   APHSVGFRSTAVSGLRRKTSLLHMSPIIRQQRRTMFIQTETTPNEASLKFIPGVQVTNG
FT                   AAHEFLDLRSALQSPLATRLLTIDGITGVFFGPDFVTCSKDDSYSWSILKPEVFAVLME
FT                   HFSSGASLFKEGSGESQAEDTRILDTDSEIVGMIKELLETRVRPAIMEDGGDIEYRGFD
FT                   EDTGLVKLKLKGSCRGCSSSSVTLKNGIERMLTHYVPEVQSVEQVLDEEELIALDEFAK
FT                   LEARLEKEQGGDKAGKSGKGDMSSYLSV"
FT   CDS_pept        join(536346..536655,536710..536959,537017..537260,
FT                   537319..537429)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942406"
FT                   /locus_tag="CNG01910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44574.1"
FT                   /db_xref="HOGENOM:HBG068361"
FT                   /db_xref="HOGENOM:HBG177268"
FT                   /db_xref="UniParc:UPI00004B490A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE32"
FT                   /transl_table=1
FT                   /translation="MTDSKISPFSSPKLLLARLSRLTSTVPGLDASLMLAQYSSPLVIA
FT                   LLLKLAAFKARHPKVTFASGAGKRVLTVDGGFGLAKVAEGWGKAAGSIGDARVVMRAFG
FT                   LLPIIQWILSLHPKPLAALKSLLASGDFMQVFMSQKTLPTLQALAILFYYPLEHVSWLG
FT                   SKGVLPISPSALSKAALWSVRFWAVYVVLEIHKLCNSYRELSDRTRALQLSRPEVTHSE
FT                   AIDYEFQDDKKEGFSEKLGPSVEYEGETTPRQALANDWKTWKRRALGVRPPYYSLVYTW
FT                   WALVKPAHHWHLGFFRSNWIPDE"
FT   CDS_pept        join(538221..538832,538905..539048,539104..539478)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806677"
FT                   /locus_tag="CNG01920"
FT                   /product="AP005220 putative acyl-CoA thiolesterase "
FT                   /function="acyl-CoA thioesterase activity"
FT                   /biological_process="acyl-CoA metabolic process "
FT                   /protein_id="AAW44576.1"
FT                   /db_xref="GO:0006637"
FT                   /db_xref="GO:0016291"
FT                   /db_xref="HOGENOM:HBG068359"
FT                   /db_xref="HOGENOM:HBG177269"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="UniParc:UPI00004B490B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE31"
FT                   /transl_table=1
FT                   /translation="MGEQLANHVTVTPHPIKPLTYLSQNLWVPSGARGVFGGQILAQAI
FT                   MAATSSISPPLGLHSAHCYFLLPAQRDPEIEYRVEKLSDARSYSSRLVRAWQGEKEIFV
FT                   LMASYALPPNPLPSDFGENNDKSHSKNGPKHSLAFSVDPPTHTPLGSRKVLPKFELPCP
FT                   DNILPPSECEEDADFLERWIREREGKNKKIWEKKFFEEYIQERKSSPVSIARARRTSTQ
FT                   NDIATPPQVRMSWLRIKSVGPDRLNEETVKAMIAYMSDFQFIGTTARSVGLNQNSNPRL
FT                   GMLASLDHAIHFYPFPDTFDPSAPLLHVMEAQAANLSSGRGIARGRIYTPDGHLIAATG
FT                   QEGVVRAEGKGGKRKGLIEGGMDEADVRKNDAKAKL"
FT   CDS_pept        join(complement(541939..541990),complement(541586..541889),
FT                   complement(541398..541528),complement(540445..541345),
FT                   complement(540286..540399),complement(540152..540227),
FT                   complement(539927..540106))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806678"
FT                   /locus_tag="CNG01930"
FT                   /product="DNA supercoiling, putative "
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAW44578.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG177270"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="UniParc:UPI00004B490C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE30"
FT                   /transl_table=1
FT                   /translation="MRMAMQLSVERRWIVSGTPTRNLQQGGQMELQEMDLIGIHGSYDN
FT                   AIGTASRRAWSKRDIEDATRLGVMMGGYLAAEPFKSEGRFQQYVTTHLRGKNGPSFGAV
FT                   QRMKYLLSGILVKHGPKVIDTEARLPPLTILQEVIQFDPLQRVTYNVLAALIASNVYTS
FT                   GGEDVDYFLHPRNIESFNQVVTNLHLACFWYSARDMEAENCLARTHDWLRNHPHCSEQV
FT                   RENLQEACQHLQTALETPGWMEWMENGISIPCDGPYLPPLIKQAWSDSFDTQPDMIDVH
FT                   SLNSLRALNVMGANIQELHMAGWQHRSHKCDWFWEVLTKGVPKHVLETDFGRKAVKAVA
FT                   KLKNKKHREGKGRTTSAAHAPKAVPRSPSKLTKKRTGREGEIDDRLDEAGMNAISIGRQ
FT                   VPKSIDEGPRPLPLTIVTKTRSAKVNFILHAILDAPKNDKFVIFGNNYELGHLTEALDL
FT                   LDIASTFVGHTLHVQNRRLALDYFETPGVRVCLMDLKLAARGLNLVSANRVIFLGPVWS
FT                   LDVQAQAIKRVHRIGQTRPTLVQILVTEGTFEEDIARRSTTSRSADEEQLYSRAMIEVG
FT                   SLGLADHRY"
FT   CDS_pept        join(544085..544691,544750..545576)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942407"
FT                   /gene_name="SHE9"
FT                   /locus_tag="CNG01940"
FT                   /product="Sensitive to high expression protein 9 homolog,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAW44580.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG177271"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniParc:UPI00004B490D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KE29"
FT                   /transl_table=1
FT                   /translation="MACRYPFSPAKVAITRFFYPSPLSRSTTPLFCPPSCRIRVGNTSR
FT                   MLTSSSSVASEDPKSEMAKFLASPNPKSSASEPGPSPHDVLSAPTSAGHISEAEETLSD
FT                   QLRNPGSSSSSSPSQSSTNNLSSKNAPFKLSSTYSLPSNISVPPEVREHLIEWSKNVLE
FT                   HSRYVIQEAQKKFVGLGLKVNEMTGYQEVERLKYMVFEKEDELQRLREHARTAKAAYDE
FT                   AVAARSEAQRETNILLERKHSWTDADVSKFTSLVRSDHTSSHAVASTSIALKDAEIAVD
FT                   KSFSQLMQVILQRYHEEQVWSDKIRSVSTWANVAGLAINFIIFVGAVLLVEPWKRKRLV
FT                   EKLEERVASMMERVDHRLEGVEGHLERVAAGSASASAIKEQHSDAAIQGVEDMPSNSTA
FT                   NPLEFVSPQTIPLMAAVDPTINGSESQSDPFFTQTIRGFPNYLDPLVKPSQKRDLAVAG
FT                   MAGAVAAWILIGAVRLVRA"
FT   CDS_pept        join(complement(548244..548454),complement(547957..548187),
FT                   complement(547616..547905),complement(546981..547569),
FT                   complement(546418..546926),complement(546280..546369),
FT                   complement(545938..546228),complement(545795..545881),
FT                   complement(545630..545743))
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636628"
FT                   /locus_tag="CNG01950"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAW44582.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI00004B490E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE28"
FT                   /transl_table=1
FT                   /translation="MSAIVTLRAIPTEADTDALKSIVSRDVRRAYISPETLRTHKVAAG
FT                   DWMRFKSGSTFIMAQAWPKASIDDDVVALSSAQINNLCGSEVEMHHFKAGQSQGRLVSI
FT                   VLKEVPLTEAPSSSKLNVVTRPPINLDSPREWVWCKAAIKEALTSLHYVRTGYSLIVGD
FT                   TEKAPRKFEIISVEVSPKDIEKRLASIEDGMEELAIDEENQRLYEMHWKTSVSLEVEKL
FT                   QENKEVHAAIPDEKKVLNTKDFSKMSTSSVPHYINFFTPAESPVSAYTFLGGLQSQIDQ
FT                   IKTLLDLPMLHPDLYIKFGLNPPRGILLHGPPGTGKTALARAVASSAGCSCIVVNGPEL
FT                   SSAYHGETEERLRGVFTEARKRSPCIVVLDEVDALCPRRDGGEGGEVERRVVATLLTLM
FT                   DGMSHESLEGERVFVVAATNRPNSIDPALRRPGRFDREIEVGVPDVKGRREILDIMLSK
FT                   IPHSLSEKDLSSLAARTHGYVGADLFSLVRESASAAISRFHLSPSSTLSEPVLTNADIL
FT                   STLPSIRPSAMREVFIETPTVRWSDIGGQQDVKQKLRECIEWPLMHRDTFKRLGVEAPR
FT                   GVLLYGPPGCSKTMTAKALATESGINFIAVKGPELLNKYVGESERAVREIFRKARAASP
FT                   SIIFFDEIDALGSARSDDHAHSGVLTSLLNEMDGVEELSGVTVVAATNRPDVLDSALMR
FT                   PGRLDRILYVGAPDFETRKDIFRIRLATMAVEPGINVEQLAEITEGCSGAEVVSICQDA
FT                   ALAAMNESLDAPYVKASHLVNSAHTVRRRITPEMIAFFEEWRDLSGVRSA"
FT   CDS_pept        join(complement(551936..552097),complement(551781..551835),
FT                   complement(551490..551700),complement(551393..551424),
FT                   complement(551202..551324),complement(550988..551147),
FT                   complement(550634..550936),complement(550502..550571),
FT                   complement(550272..550454))
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806679"
FT                   /locus_tag="CNG01960"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44584.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177272"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000042D029"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE27"
FT                   /transl_table=1
FT                   /translation="MMSSTATLVDEDFSVGTLKLNGAHEVTDVQVSSSPEVERTKKNES
FT                   VAVDPFNYVGEVLGAGPGADYPYAEFLPHNPPRTQSDPPLPFFDIEDRGHRADPNVARL
FT                   RAFVEARGGRLKDMLVAIGTVVEGDVKLEDLGEAEKDDLALLVAQRGVVFFRNQQSMTI
FT                   EQQRELGKHFGPLHKHATYATPRRGDLDDVVVVYSDRDSRPDLYAFSRAELFHSDVTYE
FT                   VQPPGTTMLRLLTTPEVGNDTLWSSGYSVYSSLSKPFQQYLESLSAIHSGFDQASSRTN
FT                   FSKIPRREPIETIHPVVRVHPVTGMKSVFVNPGFVTRLVGVPKAESDMVLSFLKDCFAQ
FT                   QTDATVRWSWAPGDVAIWDNRNVNHSATFDAYPSLRHGLRVTAHGEKPLSVEEYEEIYQ
FT                   KPAKDWLEERFKTLGITGPARDDGKTKKKAFRD"
FT   CDS_pept        join(554218..554227,554296..554443,554552..554981,
FT                   555050..555211,555351..555469,555521..555779,
FT                   555829..556107,556165..556293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942408"
FT                   /locus_tag="CNG01970"
FT                   /product="Nucleus protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44586.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068356"
FT                   /db_xref="HOGENOM:HBG177273"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00004B490F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE26"
FT                   /transl_table=1
FT                   /translation="MQSNTEMMNAGHHPEAGPANNEASRASTPLTIMSATEDPQPNTSS
FT                   KKRKQSEEPLLASTRSARSRRQTPSKTASRAAVASSSRKKGKSPAGRLSIFIPPSNGQI
FT                   VEASQNAMSSKATSPALDSDLALAVDADSIRREAAAGYESRLRARQPGNAKRDGGQRMG
FT                   ISASGRDVRIGGSTRQAAQQSKKDKGKGKSDVQPNQDFCSACRGIGRFLCCDGCPRSFH
FT                   FMCLEPPLKLDELPSEEMWLCKQCRSEKRRKTQSSSGFPPNVRKYFAGVTTGADGEYVD
FT                   SKEARTKIDRKGFLEDRDPFRLRDGRQRKVECYHCGGSALPKHSVMTDPEATWRQIVSC
FT                   DYCPLSWHLDCLSPPPTIMPSAGKKWMCPNHPDHVMPRRRTLQDNLQTVKIVGKGQFNN
FT                   GNVEIANDSGGSETSEMEFEDTIINRKKFRVPEKIIRLDFWEKLRKERNVIQTPAAVQE
FT                   EINADEQDAQEVVPPMEDLNAAAMMMALAFSRHTQIHSRTESLCHVPSSVECE"
FT   CDS_pept        join(complement(557890..558003),complement(557709..557822),
FT                   complement(557390..557504),complement(557259..557336),
FT                   complement(557057..557201),complement(556850..556982),
FT                   complement(556768..556797))
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806680"
FT                   /locus_tag="CNG01980"
FT                   /product="Carrier protein ymc2, mitochondrial, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44588.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00004B4910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE25"
FT                   /transl_table=1
FT                   /translation="MSELLSPPPDPAGVPLTQTQKDLVGGSIGGIAQVLVGQPFDIVKV
FT                   RVQTAPPGTYSSPIDCASKLLKADGPLGFYKGTLTPLLGIGACVSIQFGALEWAKRFFA
FT                   QRARGRDLNLAEFWLSGAFAGVANTVVANPVEHIRIRLQTQPDTLPRMYNGPLDCAIKL
FT                   YKNGGGLKGVFKGQVPTMLRDGIGYGCYFLAYESLVQRHLRATNLSRDQISPLWAVTYG
FT                   AAAGYALWFSSDLPCGCDKV"
FT   CDS_pept        join(complement(559725..560082),complement(559430..559663),
FT                   complement(559177..559377),complement(558614..559116))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093393"
FT                   /locus_tag="CNG01990"
FT                   /product="G1/s-specific cyclin pcl1 (Cyclin hcs26),
FT                   putative"
FT                   /protein_id="AAW44590.1"
FT                   /db_xref="HOGENOM:HBG068355"
FT                   /db_xref="HOGENOM:HBG177276"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI00004B4911"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE24"
FT                   /transl_table=1
FT                   /translation="MAWKPRIKLEFARLPTLFFDQSTPLRLHTFLAPPPRFSAPSFPSS
FT                   LRPSLSSEHSHNSFLTHKNFEHPAMFTYTPSTPEFEPVSPRFEDRTHPASMAPCGIHDP
FT                   ALLEFIRTDVSRELVYYLAERTTSVIGQATKAAVPFTPPGTPTKESAEEALGLPSLETF
FT                   VAVVCEQSNVQVSTLLATLVYLERLRHRLPKVSKSMPCTRHRVFLATLIVSAKYLNDSS
FT                   PKNKHWCKYAQMFPVSEINLMEKQLLFLLGYDLSVDEREILDNFQPFLSEYSFYSPSVA
FT                   SSPELPPTPITPARPTTGRSSHKRHQRTSSRGSRTYIAPPLDRSGSSSSLESEDMPLTP
FT                   QQPPSPVMVNAVRRGQGKVLVGQRPAAIYEVPVPNTHYLQQSMSIESITSANQSKVAPS
FT                   VKEGFLQRLLRSDRRRKQVAIQEVEALAAVSS"
FT   CDS_pept        join(561490..561587,561639..562368,562445..562618)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636629"
FT                   /locus_tag="CNG02000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44868.1"
FT                   /db_xref="HOGENOM:HBG068354"
FT                   /db_xref="HOGENOM:HBG177277"
FT                   /db_xref="UniParc:UPI00004B4912"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE23"
FT                   /transl_table=1
FT                   /translation="MFAASPRPINNSKSINPFPDELCKTAQGDELIWLGDSTFHRPPMA
FT                   FNPSPPQLSVTLFDRLVYDIPRRSTGRSSSPRNQWDSPTDILFYHHRPSEHSQSGDTSE
FT                   CDSMATWTQPYTATLHQARIETLGRKERAGLLRMQTVPVQGSQDMVELLPYTPTTHAMK
FT                   HSAERSSVKDGGAHGAKESNLLISVLDSRPTSDNFQESHNDMGLLANRVIITQPLHLKE
FT                   CRSIEVDENAVNASYNRLPSNEFNKLQVDGKVTETGEKDSTKALVERTGREAKRLRCLV
FT                   AVFSEPDYPSLFYDLLKVVPENSILVFDKFPGFYIFLCLLCFTFLDNLYSFI"
FT   CDS_pept        join(complement(562968..563072),complement(562869..562916),
FT                   complement(562719..562754))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806681"
FT                   /locus_tag="CNG02010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44592.1"
FT                   /db_xref="HOGENOM:HBG177278"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniParc:UPI00004B4913"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE22"
FT                   /transl_table=1
FT                   /translation="MEMIRAVAEQVAMLGGGHTVDLKNADKTILVEVYKNNLGVTVLND
FT                   YEKYKKRTISLASHSVA"
FT   CDS_pept        join(564376..565147,565199..565412,565608..565708,
FT                   565763..565858,565911..566473,566522..566874,
FT                   566926..566989,567037..567142,567196..567574,
FT                   567719..567754,567804..567924,567970..568142,
FT                   568205..568387,568446..568622,568681..568759,
FT                   568817..568996,569046..569195)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806682"
FT                   /locus_tag="CNG02020"
FT                   /product="Endocytosis-related protein, putative "
FT                   /protein_id="AAW44594.1"
FT                   /db_xref="HOGENOM:HBG068352"
FT                   /db_xref="HOGENOM:HBG177279"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="UniParc:UPI00004B4914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE21"
FT                   /transl_table=1
FT                   /translation="MQDRRQPPIAIPPAPLLSASVSTPRRPTPQREQEPSDDTVRRVPS
FT                   SYFSLPYSYSSPAGPSHWRNKPLDSGSARRRDGKFRSASVKTVGSFSLKTPNRHEDLDN
FT                   WQSLQDITGSDVDEDQIEDKATTNSRSSSLATPSARSVRSLFISSDLSADALSIPEGRS
FT                   HTSDRISIVDRLSLSPTQLEAGGDHILSVSRDDSQQEEGTPRAAVLPLQSPEPIERLTS
FT                   ATPLLEASFPSDFLSSRQPITETRSIVEKKASTLEGHRYSWIPPTWATNILKCSIAYLI
FT                   ASLFTFVPALASMLSTQSETDAHGRVTAVPAYSAHMVATIVVYVSRRCEMGDWIVCIIW
FT                   IGGTMGVLAWSKLWVGNPSFNSGCSMAAMILYNVVIKEGAVPKLIEILLIVFTGVCITN
FT                   LVCITVFPVSATSNLQKSISKSLNSFSTLLDLLTSTFLLEKSTVKEKGLTLKDAVRDHS
FT                   AAFKTLQKDLSEAKHERVLDGRIRGRNLQLYDAAIVSLGRLAQHLSSLRSSTRLQESLV
FT                   RASREGRISLEVGAERGRSKISISEVDAIDDERGQGLSEDMDIATSVHLFLKFREIAGT
FT                   QMDDLNTRCDQALEAVQALSQARQMPCIDLPLIRSKLATSLKEFTLSSSRAIKRVYAGP
FT                   RRKKGVYFKTDPSSSDSGESESDVESEKIYGDGNECKLEATENLPVEDQPDINHGPNET
FT                   VFWIYFFLFTFEEFAREMIFLVDTMEEIVTTEKVTFWEHLKTVIMPKRGRKEKKSEYLY
FT                   KQLQNIVPIDPSQLQPPLYPKNGRDSTGPVIVPDLKSLSFIGRIKQMFWALGERSKQPD
FT                   ARYAIKTGLGGGRLEDSLLGFANSNRRCLAMLAAPAFTEIGRPIFLRFRGEWALIAYFA
FT                   TMSQTIGQTNFLIGAGAAVLFTKLFPDNNVALPILGFFFSIPCFYIITQMPDYMNAGRF
FT                   ILLTYNLTCLYTYNTRTRGDVTVEMIAYRRSTSVIVGVLWAAIVSRYWWPFTARRELRM
FT                   GLSDFCLDLSYLYSKLLTTYGNGVDYNGLNAVGADTEEGELEPLLPTDAIRHSHLDHGV
FT                   RQFMAMELHLQSQLDSMKSLLAHTKNEPRLKGPFAYGFYKEVLLSCERMLDRLHSMRCV
FT                   TTRDEWDNNIRDTFVIPVNKERREMAGNVILYFYTLSAGFRLRTPVPPYLPPAEEARQR
FT                   LVDAIRSLDVVRRRSVRGGGRHLLFFAYTLAMQEVIAELEYLGAMMQEAFGVISVSSAD
FT                   DFEDLFEEPVEEVAKVGKSPKSL"
FT   CDS_pept        join(569440..569635,569694..569798,569864..569936,
FT                   569997..570174,570227..570580,570634..570682,
FT                   570738..571013,571062..571146,571198..571282)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806683"
FT                   /locus_tag="CNG02030"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44859.1"
FT                   /db_xref="HOGENOM:HBG068351"
FT                   /db_xref="HOGENOM:HBG177280"
FT                   /db_xref="UniParc:UPI00004B4915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE20"
FT                   /transl_table=1
FT                   /translation="MSSSPEPTALTDPASYLCLSKFNRRLPRCPRTNLPVTFSDIGDPT
FT                   GIPLLYLLPSGCSRWIGASLDPLAARFGVRIVVIDRPGCGGTGQVPLGERIDRSCEMAV
FT                   SVLETLMIKPAHILVSSAGIYYALHLLIHHPSAFKTSLNPPPRLYLIAPWVPLLPIDHP
FT                   DSWPFKWDWIPTPFIATQHITTPHLLKAAEQAQKAYDRGLKAIDTSMSFVMKMYNSFTE
FT                   VPSSTSYSSAQGTAPPSMSPSTPYEQTSIKPGMKEDVQEGLNNIMGAGMGEGTEVQVPQ
FT                   SEGEGGKKERYWGPTPCCVTCLVSSYMQAENGQGIGQDHLLCLNRGPRDTGGAWLQTAL
FT                   SDLAATIQFAQEAVVPKTAAEKLARNSLQTGQANEADETGTAGHVNAVEYPLEMHVWWG
FT                   WMDDMVVRKGQLYFNQLVGEYSGVIDLLVHDVPDGDHSDLMSRPVGIHHCFELIRSQND
FT                   TKMPSREL"
FT   CDS_pept        join(572543..572620,572672..572765,572817..572945,
FT                   573030..573141,573197..573218,573284..573313)
FT                   /codon_start=1
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806684"
FT                   /locus_tag="CNG02040"
FT                   /product="N-acetyltransferase 5, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="AAW44596.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00004B4916"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE19"
FT                   /transl_table=1
FT                   /translation="MSVIRPFDPTDILRFNNINADPWTATYHNGYYASYTAQWPDWCVA
FT                   VEGAYDPTLKAYMISKHEPPAPDPQHHGHLTALSIAPSHRSLGLARVLMDVLEGLTRDS
FT                   VDAWFVDLFVRCNNVRAISMYEKMGYSVYRRVVDYYNGMEGDEWQTDYSA"
FT   CDS_pept        join(complement(576587..576658),complement(576107..576248),
FT                   complement(575778..576057),complement(575169..575721),
FT                   complement(574292..575116))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789299"
FT                   /locus_tag="CNG02050"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44598.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG177281"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000042E70C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE18"
FT                   /transl_table=1
FT                   /translation="MPNPPVADFEQWRSPQSQQTPLTEPTNLPGIFSPKTDSPALIQQG
FT                   KNDLIHPSFLPPCEHGDDGDMHAHAFDLLSLSNGTPVHVPRPLPVHSQTAPQTVPASVP
FT                   SHPSYLSATRPQATQEKAGKENAPKARRMSSSTTGVLGRGKLGLTGTGESGSGPGGVGK
FT                   DSSRITSLDGPASMTRRSTLGTSPAPQLFDFAKTDRRSSLSRPAPTAAPLPTRSVSAVP
FT                   GSLPTKGQRKAPTPPEDDIELDMEFGDDDDEENSRARSGSADDIDMDEDEIEPDADDSR
FT                   PEWEKLALGTGSGGVKGRRKGMVFKCETCNKEYRHPSCLVKHRWEHSPHWKEPTALSMS
FT                   KHQQVQMLEAAAILAHLDPTSQGGRALPSDKSLWPAILSPAGSNDSLPKRATSRAAREV
FT                   SLGRSPSTSTAAPLTPSSLRETTALGTLAEKAERKSSPAAASDSTTSSMGAAEPYIPRS
FT                   NGVHPSPRAVHSGLGVRSPPASSPYARPSRPMGISSPRPAPSISSSTQGPATPHSIGSL
FT                   PDMNGLNFSSSLSSSLTVPGLSPMPGSIGSVRRGSLGMPTYMKTGMVGGGMFGVRTQVP
FT                   SSSVRSGAGVAEEDEEEEAKEEEDGWGDIKEDKREGEEWGMAMEMEL"
FT   CDS_pept        join(577025..577272,577324..577594,577645..577857)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636630"
FT                   /locus_tag="CNG02060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44601.1"
FT                   /db_xref="HOGENOM:HBG068349"
FT                   /db_xref="HOGENOM:HBG177282"
FT                   /db_xref="UniParc:UPI00004B4917"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE17"
FT                   /transl_table=1
FT                   /translation="MSPAVKKLPPPAPPKQRSSAHPSALTHPSHKAATVPLKPLQGVSK
FT                   TRGDVGKAGHGRECIFVTRKTALGALMGRCRSLVVDEGYTSLTLYALGPAISHALLLLH
FT                   ALLDLLPYPKGEKGMWYEIRTGSVECVDEIDKMGDGQTDGNNAVQEEDAWLNDVGSVEA
FT                   SVPERATRIKSSIEITIHIAPRPASKSLSTITEKKKKNRPSKKSRMARWNRLKEEERLR
FT                   EEEEEEEVEEEEGDEEATMNA"
FT   CDS_pept        join(579136..579568,579773..580329,580381..580476,
FT                   580533..580651,580701..580856,580906..580987,5
FT                   81046..581741)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806685"
FT                   /locus_tag="CNG02070"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44603.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068348"
FT                   /db_xref="HOGENOM:HBG177283"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00004B4918"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE16"
FT                   /transl_table=1
FT                   /translation="MPTMPPKDRPNHIALPVGSTTPTGNNSTNPGSPRTPPTATTNNPI
FT                   GPQATSPTSRHSFLGFMRTRGRSSTLGQQPSTSANLSSPIQSQFQRAATPERAGNSRAN
FT                   AREQSISGRAGGGNGVATGSGVMNTGATVTRTVSTPLSGSTIPPAPTTSALAPDASLNA
FT                   APTPPGNPSNRLKTYRIRLVPHLESNRSLPFEPVIREMAPISVTPFPGTTPSDSAMQIA
FT                   DSGTLSSAGGGRTTVGGKPVALVLKIGRFTDKSDRLPVPTNSAPLGTGGGGSGHVNGDG
FT                   TLGPDGPRTGSATLSVAGGGGEVTSGKAAFRSKVVSRSHAEIWCEEGGKFYIRDTKSSS
FT                   GTFLNHIRLSSPNTESRPMMLKDGDVLQLGVDYQGGTEDMFKCIKMRVEVGREWQRGAN
FT                   EFNTNALKQLKALGGDVSVSDNKGKDTPSKKAKASVTDCCICLFSVTVCQSLFIAPCSH
FT                   VFHYKCIRPLLLQHYPGFSCPLCRTFANLEEDVETEDAWEIASRRASVISRRPSNHSIL
FT                   PAGSSTPAAAAATAIESNGNGDVGTAMVVGDNEVASAGELLPAPQAPGEPEGLQAGMPL
FT                   ARQATAVAQVDPITAGLDLTSETITTVPEEAEGFVAPSASTIPRPIVHPASYDQSGNST
FT                   FSEAATPMNDTFLSTLALAPGMIQRLELADEVSQAGTGSLSGMTGSNAGSNGGSNVGSR
FT                   NESRRQSREIERNGDMYP"
FT   CDS_pept        join(complement(583277..583322),complement(583111..583182),
FT                   complement(582951..582994),complement(582815..582880),
FT                   complement(582394..582734),complement(581902..582334))
FT                   /codon_start=1
FT                   /gene_family="HOG000239685" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093394"
FT                   /locus_tag="CNG02080"
FT                   /product="Succinyl-coa ligase alpha-chain, mitochondrial,
FT                   putative"
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP citrate synthase activity"
FT                   /function="binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /protein_id="AAW44607.1"
FT                   /db_xref="GO:0003878"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG001349"
FT                   /db_xref="HOGENOM:HBG615372"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="UniParc:UPI000042F067"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE15"
FT                   /transl_table=1
FT                   /translation="MFRSLRATSTIARSAAAPRGFATSSVARSYEDTIKNILINKDTKV
FT                   LVQGFTGKTGTFHAQQAIEYGTKMIGGTNPKKAGQTHLGLPVFGTVRDAVREAQPDASV
FT                   IYVPPPFAADAIIEAIENEIKLIVTITEGIPQRDQIKIMNVLKSQSKSRMIGGNCPGII
FT                   SEGCKMGIMPGHIFTQGKIGVVSRSGTLTYEAVNQTTLAGLGQSLTVGIGGDPFPGTQH
FT                   IDVVKVLLADPRTEGIVLIGEIGGSMEEEAAAYLEQHNKNSANPKPVVAFIAGRTAPPG
FT                   RRMGHAGAIISGGKGAASDKVAALEKAGAIIAKSPAQIGDLMLKAMKEAGKA"
FT   CDS_pept        583677..584333
FT                   /codon_start=1
FT                   /gene_family="HOG000192102" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806686"
FT                   /gene_name="PSF1"
FT                   /locus_tag="CNG02090"
FT                   /product="DNA replication complex GINS protein PSF1 "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44861.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG359786"
FT                   /db_xref="HOGENOM:HBG597497"
FT                   /db_xref="InterPro:IPR005339"
FT                   /db_xref="UniParc:UPI000042F7FB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KE14"
FT                   /transl_table=1
FT                   /translation="MYGDLALQLVNSSHRTTLSSTPQLPLPKYALPLILSICLETRQLG
FT                   TSIASIAESHGQLSLTQDRGLVCNLTVQHLAARRNKRCMLAYLATRVGGIKERWWDAGG
FT                   GLAYLLSPAASASVNPEADAPDLRSALSPQELDFLRGYNNLLLDYKSDFLDVLDLTAGI
FT                   EKPPGEIMVDVRVVRDAGEVFLDSGERVDFRKGQRFRLERAQVERLIIQGYLEEV"
FT   CDS_pept        join(585275..585461,585513..585594,585644..586841,
FT                   586890..587291,587346..588350)
FT                   /codon_start=1
FT                   /gene_family="HOG000164195" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789300"
FT                   /gene_name="BRO1"
FT                   /locus_tag="CNG02100"
FT                   /product="Vacuolar protein-sorting protein BRO1 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome"
FT                   /protein_id="AAW44609.1"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG051971"
FT                   /db_xref="HOGENOM:HBG330777"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI00004B4919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KE13"
FT                   /transl_table=1
FT                   /translation="MSVQSPLIAVPRKTTTDVDWATPIRHVIAASYGEDPNSYAEECAV
FT                   LQRCRQDAVRGAGNDQTARDLLYKYFGQLELLELRFAEIKVSFPWNDAFTDKLTTQTSL
FT                   AFEKASIIHLISSILSSLAQSASRSDPEGLKRAYYNTRATAGMLTYINENFLHAPSTDL
FT                   SREVVHLLIGIMMAQAAEIFTEKLVEEKKSASLVARSANQTASMYTSVVDEMKEFQGKG
FT                   VFDRNWLYVLQIKAKLFGSLAQYYKATSDSAAGKHGTALVRLKIANSLIQDAQKQASSF
FT                   IYTFVAASTPSLPHDAANALNEIVKAHATVCGEAKEQAVKDNDLIYHEVLPSEASLPAI
FT                   EKLPPAAPITIQDVYGNQEVTKLIGPDIFLRLVPLAVHESASVYSEEKAKLVRAEVDKV
FT                   ELAEGEIQAGLDHLNLPEEIDRWRQFLEGDTNDDVPLSQQLKSLVDSVGDVRQVENDLG
FT                   RLDGERAACERELRELNGALDAESRECERMRAKYTPNFTQSPSGPQTANLRSNLSANLS
FT                   ALSSASTSDAHLQSLWQSIQPSISLLSSGPSNLERAARDITEGNPQKIDKTVSLLDLDD
FT                   EEVDRKALGQEEKDALRKAVDDGREKLDRLKKIRAERDEVLRDLKEKIQTDDVSNLLLL
FT                   NRRSQNVEPQLFASELEKFRPYQTRLAAAVSASRSILQELDMLVAQVHKGTGFREILRK
FT                   EKDRQRIIRDWEKRLIEAGESYAEIRAGLGKGLSYYDSLRRVIEDLRMEVQRFTNSREQ
FT                   ERRNMVSDIETRQRLGGTSPSTGGVVANRGLEERLAALKMEAPPQPPRLGTTSTPNLPP
FT                   PPGRGSSNVTSSYLPPPPPPKPQSNPYDFSTLAGFGSFATPSVSSPQHVYPSQPQQAYN
FT                   QQSYIPPQQNPYYPPPPSRPTYASPPFAPQQPPMQSGHSPYAPPPGHAPQPQQPQYPSS
FT                   QNQQQRQGYKYPGYGQQGGYGGGYGQY"
FT   CDS_pept        join(589836..589985,590038..590178,590241..590506,
FT                   590555..591362)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093395"
FT                   /locus_tag="CNG02110"
FT                   /product="Specific transcriptional repressor, putative "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44611.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG068345"
FT                   /db_xref="HOGENOM:HBG177285"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI00004B491A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE12"
FT                   /transl_table=1
FT                   /translation="MEKDGKADEGMLETAKPKELARAEVTAVVLGSSKKEKLENCKKKV
FT                   SHARKQTADHIPRPRNAFILFRKHVVDAKLIPASVEMRHQNVSIITAKMWSEAPAEQKA
FT                   HFNELARIEKEEHMKKYPGYRYQPVYRRTNVVRRRVRKDEAEEEKCKNVAELLMKGKSG
FT                   QQLEEEIKDKIANGDTKGAKKNKASSRSMNGVCELSKGALRALRAQARQKQEPFNSGDW
FT                   SDLSCSTSMDPDAQGSRRRQSSAFESTRSSQSPKPANGFEHRLLQAQNQGPRRQLQYMA
FT                   YSHQDLAPWSGDIPAEPNEKQAFAFTSSQQGFQPGQQSPPTFSIAAHTYPLTSRHFLYP
FT                   QPQPQFQLTIMPDQQVSNQFYVHDAALPFSPSAGQFTLQGQNTSMHADDMPTFNIGSAQ
FT                   QQVVHPPMSARWDKGHLLPPSSDVPLEGLPFDDGLMLGDFEAALAHADDMVGGVW"
FT   CDS_pept        join(592008..592092,592147..592217,592272..592310,
FT                   592367..592558,592620..592721,592781..592810)
FT                   /codon_start=1
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789301"
FT                   /locus_tag="CNG02120"
FT                   /product="Calcium ion binding protein, putative "
FT                   /function="calcium ion binding"
FT                   /protein_id="AAW44613.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR001125"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00004B491B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE11"
FT                   /transl_table=1
FT                   /translation="MRVLRADCAREQYKGFLKDCPSGQLNKEEFKKIYRQFFPFGDPSQ
FT                   FADYVFNVFDEDKSGTIEFKEFICALSVTSRGRLDEKLKWAFQLYDINQDGYITYDEML
FT                   QIVRSIYKMTGQMVQLPEDEDTPEKRVDKIFRNMDLNKDHRLTYDEFKEGSKQDPTIVQ
FT                   ALSLYDGLV"
FT   CDS_pept        join(complement(596590..596784),complement(594642..596523),
FT                   complement(593478..594593),complement(593107..593417))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806687"
FT                   /locus_tag="CNG02130"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44881.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG068344"
FT                   /db_xref="HOGENOM:HBG177286"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00004B491C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE10"
FT                   /transl_table=1
FT                   /translation="MHATFSAAHNPSSSPPRNTTITPLRQSSSQTCRPSTSSLPRSHKR
FT                   VKSTRQSLGSRAKREASIPMLSQQLSTFSLRQDVLSEMLAQETPPTITSPFKYASHTTS
FT                   ASSLTTPYTSTFKHHPSAEHMPQKSKSAGPKFVTQISKGRHIEDISPIRPTTEDHLADW
FT                   DVSHPSSDEPDLEWLQSGEWLPPLQSKENNMQGCLQGSLQHCRDRDCSVSSMEFSGSDS
FT                   SSVSLLSLARNSLEQQTRPNIVQWDENPAELDGEQAGHSSFDAQSGSSALHLPIKLNTS
FT                   PSISPFITSDCHKSPNDIPSGSFDSQADFHMDSPSVFSTRSSQHARSDSRSTILPRLLL
FT                   SKKSTATLREQNERSKALGHMEDEEMMSDVEDIPSPKSPSRPRSFWDRAKFKASRNPFD
FT                   GNGFGATFGLGIELGPRRIPSDENHNEDNGLSVSIASDSSGDADLSPSRSLLANRRSTG
FT                   TFAHDSAKENASETAPRLEVPTRPTLPRRMPTVGSILQRIPRTSSPAIPTLNSLRGKGR
FT                   PPMRRGTTEPTEKPKPTLLMAEAALNTPHALPFADVKPSPSVFASAGLVKKKSRFSGVE
FT                   IPKFGSEPLVNVKRKQSAAQYGMQPGLGSMQPPSPVSPIQSMSAPSIPLKGPAFAAAGS
FT                   SNAHFTQQAQKTRGLRKKRSLMFKAGSSISSMEMIRGNSRGSITGVSLSPVTPTKHDGA
FT                   AKGYRLTTPSPIRAPVVYPFASSNPVDLDLFSTPPSNRLNRPSALDAPVAERYRSMLAG
FT                   SPSATMDAQRKPVIRASNPMLAASFKSAAQITTPARGHTSQELSMFTGRPKLGSEGITR
FT                   LETDFALVENLGSGAFSQVWKVREKKTGKVFAVKAGKPYTGAKNRLRQLEEIAILRELS
FT                   LDPHPNVVQYIDSWESHSRLYILTTLVDCGDLSSFLSLLSDHGGIREARVWKSLVELAE
FT                   GIDHIHKHHFLHLDVKPSNILINSAGGLVVADLGMAVVCGDGPDGHMLGGMSPALPERD
FT                   EKGGFVWDQVETPMDNGKKSLAMVPSPIMDREVEGDREYLCPEALSEAEMIGKGADVFS
FT                   LGILLLEAALNVVLPSNGDAWVQLRNDDFSDLNGIYIPRPHSASSPNRNPPPDDPNMPI
FT                   LSDDILTVIKGMMRCNPDRRWSLGDVWRHPVVKRVRASERGKALVEESDEWLKRVLGEE
FT                   L"
FT   CDS_pept        join(complement(605677..605745),complement(605492..605601),
FT                   complement(605203..605428),complement(605059..605108),
FT                   complement(604264..605011),complement(603885..604208),
FT                   complement(603628..603768),complement(603447..603581),
FT                   complement(602625..603387),complement(602243..602578),
FT                   complement(600798..602182),complement(600462..600739),
FT                   complement(599153..600414),complement(598978..599079),
FT                   complement(598713..598921),complement(598514..598658),
FT                   complement(598210..598457))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636631"
FT                   /locus_tag="CNG02140"
FT                   /product="Mitotic spindle assembly-related protein,
FT                   putative"
FT                   /function="binding"
FT                   /protein_id="AAW44880.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG068343"
FT                   /db_xref="HOGENOM:HBG177287"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00004B491D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE09"
FT                   /transl_table=1
FT                   /translation="MNGDPPAEEDFSQIPLVERSQHKNWKARLSAYNDVISGSAKTASD
FT                   TDPFFQPFVNDGALLKKWCLDANAVAQEKGIEAVLAIVQYSGESSARLRPEVVPAIVEK
FT                   ALGSARAGTKKKGMDLCAMFVEIENGGEGVMLPKAVAGAVTCLKDIVESFGVPTMGNIK
FT                   PLLKSLSKIFGHSDKNVRAEGSSLSIVLYTYLGPALLPALSDLKPVQMTELQKSFELMD
FT                   AEGKGAGSGKPTRFTRKVQREREAVEDAGGDEEVGADEADGQAEEPFDPTSLLDPVDVL
FT                   ALFPSDLELRLSSTKWKDRLESLEECNKILTDPRNAKILDSNADAYGPLVQTLGTKCKS
FT                   DANVNVVMEACKVIEGLARGLGKSFGRHRGVVMPGMMERLKERKASVVEALGKALDAVF
FT                   STTTLQDIAEDVLTSLKSKNPQVKEGTLKFLHRSLQTTLDAPGKDQIKPLAEALVSLLG
FT                   DSAEPVRSTAAECLGTMMKILGERAFNPYVENIQEIQDGQGEGCVRKSTNKPASSKPPA
FT                   PPSSPPIKASGKFGGGKDDLIQEFASPQRAPPARFARPGVVKSAAVPPSSPPIKSVPKT
FT                   DEENVVVNDMAPPKRGPPARFAKPGSTKPAAAAAPAPSQRAAPAAAPPASRTASAAGKS
FT                   GPVKTLTSSPNDPIKFKFSPEDAAAQASDLIPSEFASKFSDSAWKVRLEAADEMIKWVE
FT                   EEGAEKVDAEIILRFLGKNPGWSEKNFQVSAKIFQVIQIVAQKSPTFGKPVAALAVGPL
FT                   TDKLGDMKLKKPSGDTLSTFAERISLAFVLAQGYEPMSKQKAPKAQADGLLWIKQQLID
FT                   FGIAGIPLKDLISFVKTALGSPNAQVRQSATQVLITIRIAVGADISGFLEDLNPQLLST
FT                   INSEFDKVSSQSPPEPVKDQVDLKEVAAVPGKGGKGGGGSDPLDDLIPRVDLDKLVAST
FT                   NVIAGSKSDAWKVRKEGFEALNSILEVKSNSRLKPNMGEIGGVLKKAMADTNLSVKLLA
FT                   LGIISKISVGMGQPFDKYLRLLTPAVASVCADQKATTRTAALNTLTAMADSVGGLDGLY
FT                   GGLGAALETANPALRSSVLGWLAERLQNEPPSSSADMSPLAGPVIHCLEDRNGDVRKGA
FT                   AAVLPYVVSCAGFDYVMDQTSNLKPASKATIVPLINNARANAPSSTALSSAGANGAALA
FT                   APAPKSIVATKTATPSMARVRAGAARTVPGSPGTATGPSVLKSSGMPARSLAMKALSSV
FT                   PSSRPLSSLNHSDDRPNGLPKSRIAVPRPISATSQAASSAASSLPSASKIIPFLNSASE
FT                   GRAARLKRDTARWVLDPSPKASADLYEYLHHQMESQVAPELLSLLFSKDHRAEEDFMAG
FT                   LAMIRELYDQQTCGSFGLDDHEIESLQLANVDMALKYAALKLLVNNTQLANRCLEVIIH
FT                   VVETMTRLNQRFSDAEAKLFVPALVFKLGDPKFVSKLAPIFEALDKVIAASQVVALLVQ
FT                   YGLEDKSAGKTCKNESLSLIEKTYRKRGSILRTRDDRNFFETLAKCISDSATRNAALTV
FT                   MALIQLQGESKSLHAVLEAMPSSSKDMLANRRATMATGKTSGHGQTLAKTSVDLASQGD
FT                   VSSPRLRRPAGLSQPRINQIPSSSNSNSNSGSTESSPKSISRATSSPTTKVTRTITDSP
FT                   SQSRTIQPPSGLSRPLAVPPSRLQRPTDVFGVGNNNATTSARPTALQPLGRPPAARNSA
FT                   NNRSSGPTVIEAINDIRHDDLDKCVDALKTIQSMLSANPDSFVDNVETLADTLMDEMEF
FT                   SFTPPENLNNPRFFRVVKHLIQSFSGLSSNQTLMRRMSYEQLYAVLNCLSLRLVQADKM
FT                   GGTIQELSRFINLVLVQCLSTPDRLLVFQVMFRLLLDLTHDFSVSQPSPESERAAHADL
FT                   VIKCLWKRCKILEDDFRSGRLKPGPILAVLEEFLQGVGPKEYRKRAQQGIALGDMPLRT
FT                   VKTIIQRLLVYTRDTGLEIYDVLVEQFGDEAASTIVYTYVFRLAGAEVSRPASSNSRSP
FT                   LLPFSEGADLPISVASEQTSGSAERSSFASPAVVEEDTEIEKMVKNLRSGNQTERLDNL
FT                   YAFMKANPDKEGEVTAALAAHMTPTFQTYVRRMLELRKNNENPSPAREQPTSPQHSPRP
FT                   ESMPAALKPLPAVARKSLGPRRSSLAINVDKNAPLDDQLAQYKNLFRAQALDSSSRTGS
FT                   ESPATKE"
FT   CDS_pept        join(606108..606290,606342..606474,606530..606567,
FT                   606623..606658,606711..606738,606788..606836,
FT                   606887..606950,607004..607090,607148..607213,
FT                   607267..607458,607514..607684,607732..607960,6
FT                   08018..608490)
FT                   /codon_start=1
FT                   /gene_family="HOG000262757" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636632"
FT                   /locus_tag="CNG02150"
FT                   /product="Uridine kinase, putative "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="AAW44615.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="HOGENOM:HBG465606"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI00004B491E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE08"
FT                   /transl_table=1
FT                   /translation="MEQPAGYRTPRPQKHSVYDPTQPRSKNQVLISHGRAPWYGPDGKN
FT                   IEAYVVGIAGGSASGKTSVARAILSALNYIPTVLILSQDSFYNAHSPEEVELAFKNDLD
FT                   LDHPDAIDMTLFAQCIKDLKQGKATEIPVYSFHHHQRMSEKKYIYGASVIIVEGIMALQ
FT                   SAELRELYDLKVFVNCDSDLMLARRIKRDVKERGRDVEGILDQYLRFVKSSYDTFVQPS
FT                   SRYADIIVPGSSNQLAIELLVSHIKRQLESRSLRFRRVLADIGENRGSSTPSVEKFDKQ
FT                   IVLLEQSNQLRGIMTILRDRTTCREEFIFHIDRLSTIIVEKALTLIPCEPKVVKTPNKN
FT                   VYKGVSQTKNLVGVSILRSGLPFSQGLRRVIRDVPIGGILIQSDPKTGEPLLLKSDLPH
FT                   CLRSRKTNGDVRCLLLDSQMGTGAAAMMAIRVLLDHGISQNRIIFLTYLISRSASYSVL
FT                   RAFPNIQIVTAAIDPGLDEVKISYMPGSLIIGEAAGEGDFAIRLVDQLGHEEDGKRDNV
FT                   KDLLKTDEELAADGFKMNILKGTEELKFSRKHKRTYSSTGEKRAWVISPGEYAIVVVVK
FT                   DHAHQQ"
FT   CDS_pept        join(complement(611566..611604),complement(611274..611413),
FT                   complement(611149..611226),complement(611015..611098),
FT                   complement(609066..610965))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806688"
FT                   /locus_tag="CNG02160"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44617.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068342"
FT                   /db_xref="HOGENOM:HBG177288"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00004B491F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE07"
FT                   /transl_table=1
FT                   /translation="MINTNLHGYPFQPLVNDHNHVGAGHSVQARPYVCTFGTCDKAFAR
FT                   KSDLARHFKIHTNDRAFVCTYRGCGKSFIQRSALTVHYRVHTGERPHHCETCNKAFADS
FT                   SSLARHRRIHTGKRPYTCHAAGCGKPFARRNTLLKHFKRQHPGLPPPSTAAQRTSIRMP
FT                   IQSLGPRSSTASMLSQQSFNSNADRYTASPSNAGTPHGFAAPHPPEGAAYAFHGGFPEQ
FT                   VLGGHPSAQQPIIFQGSGGIRPHLQQSPVPPGSVSLTPVSTSGPHFAGGYGTQTPTSPA
FT                   HHDRDKHGISPVSSIATNSFGSGQYASPLSAYPHASSYPLTRITSDSGIIWHRSLSAPE
FT                   EPRYEASQWSGGNVGAGFHASQLSMPQTPTHLSPSYPYHLPMQQRSATNPLPKTRQLYS
FT                   PSCHGSDDERDEPLVSLPDAHPTFAIHPPQGIVSVPMSSIEGSNISHISNHGGQILFAP
FT                   SQNGPLHSAPPAIQRFNSMPAVPTMSSWGQIPQYQTQSVGSAKSADEEWEELQKEMLSR
FT                   EASVGTDKELSPATEEGKTPKDGESINHWGEAIAYPVHPHLQHAKDPFHSTSSTFIDHM
FT                   HSSDPLPPIHVFSNQPHHMVLTPINPNGMYPTPITPGEEWAQRHIKPTAMLGRGYPRQH
FT                   IDVENKENGNEIAEHITLTTPPKYQGHRKDSRSVTAVGLGIANVHFTEPQAIEAGDASE
FT                   VKMEDLESEESDVTPEDDSDDEFVLGRKPRRSARKGGVRKRGSRTATKRRRS"
FT   CDS_pept        join(complement(617853..618165),complement(617639..617798),
FT                   complement(617465..617589),complement(617349..617414),
FT                   complement(617165..617298),complement(617003..617106),
FT                   complement(616902..616953))
FT                   /codon_start=1
FT                   /gene_family="HOG000135961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636633"
FT                   /locus_tag="CNG02170"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44618.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG177289"
FT                   /db_xref="HOGENOM:HBG739113"
FT                   /db_xref="InterPro:IPR007273"
FT                   /db_xref="UniParc:UPI000042C640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE06"
FT                   /transl_table=1
FT                   /translation="MSHNNQLDPFADEPAHATLDTDPFADSVRDPFSQPNESSVSFGGA
FT                   GGSTTNTYGDYGYGGGHANQDANKKAEELRRREEELNRREAEFTRRQQESGAYANNWPP
FT                   IYPFVHYDPSVIQDPSKRQTITLIGYQWYALVVALIINLLGCIFLLISGSSEGGADMAS
FT                   SASYLVFITIASFILWFRPIYLGYCRNEGKAMAIFFYIYFLFCGFHLLYSIYMFIGIPS
FT                   TGSAGLINTISMFSQGHILAAVFGTITTVLWALQVLGGAFLYKRVWDFKNGNSDISMQN
FT                   ATDQFKSNSIKTIVLHQSRLPLLEYVVDAMNAVFLG"
FT   CDS_pept        join(621302..622719,622771..622846,622897..622947,
FT                   622999..623100)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806689"
FT                   /locus_tag="CNG02180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44879.1"
FT                   /db_xref="HOGENOM:HBG177291"
FT                   /db_xref="UniParc:UPI000042EF97"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE05"
FT                   /transl_table=1
FT                   /translation="MPPSKSAKSAVLKKRPSRRRIVATESDSDDESPVQAAASTSPQPS
FT                   VEEDSSVDAEGPGSGGSDSSLTPAPSPEQVKTVSTKIQAVPKAKDVEKKEGGDTGDLMA
FT                   PVSDMAKGSVTRKGRQTRARTRMSEIGSAENSEAPSPAPTPVPPAGDVDALVADKSTEL
FT                   DSGNTSPKKISLKLKVGDATTTKVTAPVEDEMGNEREKSALKMKSDMEKKIGKRTSGSI
FT                   DDEGLEDVGLKRAKVKKIGKTKNDSKGTEDDGEGRTKARMEEEKKPTKTKKKSKRIVVD
FT                   HEDEDVASTPEPSMSEIPTTTTPKPTSPARPLSPVKASKSSNKLPSSSQAKDKSPVTES
FT                   STLSVPASITATAKPKPKPKAITKLEGTEVSHKKTPSAGSVNGTPQNKLLNAKKTPSGN
FT                   IKRPSGSATSTPVNSTPKVKPTALGGSLLAQTLNVLNSKQGKDEKESAKGKEDKREKER
FT                   KERGRFGWYDDWVLSASEQKEFDESRAKREAERKKRDAYGANMLNLQEGQDACRVDNTQ
FT                   PSPAVFDRLDPKEINTRNDLPSQMLQRLLGF"
FT   CDS_pept        join(complement(624783..624959),complement(623834..624722),
FT                   complement(623198..623781))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806690"
FT                   /locus_tag="CNG02190"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44619.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG068338"
FT                   /db_xref="HOGENOM:HBG177292"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI00004B4920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE04"
FT                   /transl_table=1
FT                   /translation="MPARTLATGNSNHLRFCLLITPTLRRLVSHFAWRSNNKQLQKSDK
FT                   MVMGNTEKLSDVTRLSAHVTRVLGQNPGLMTLQGTNSYLLQPPSNPHAPLILVDTSSPH
FT                   TAAQYVDLLLVHLHHLALESGVRETHFESSAAQVSLRNFKEERRDEVKKIVKEQREAEP
FT                   RADELGLTEYGPESTWVKGYEGKTGVRKLPTIEHVVLTHRHLDHVGALPLLLKTLKEHG
FT                   CPPPKLWKLPSPDEAELNASERDRPTSDSSIWHSLPPGTYTPLSPLQPFHPILPGLMIS
FT                   IIDPKYRHLLKHNENGKAKWNEVPEIARVSVRCLKTPGHTADSVSLVLMEGEKGVFTGD
FT                   TVLGQGTTHFTDLSTYMTSLRTLLALKPRVLYPAHGPHIPSQEASVSHIQTYITHRQKR
FT                   EDEIVATLKRFSPSLSVEDGGENIAEALITLKKEIHEKKEAENKVKGRSMLDKQKASPL
FT                   PDFEEEKKALEKIDVSKGVSMSVIARILYKSEDERLLFAAAKNVNAHLDKLIKDGKVRK
FT                   GRVRMCKLIGGEVGEVEDMDGWEWIGEKEKSD"
FT   CDS_pept        join(complement(626787..626819),complement(626640..626717),
FT                   complement(626125..626534),complement(625251..626070))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789302"
FT                   /locus_tag="CNG02200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44620.1"
FT                   /db_xref="HOGENOM:HBG177293"
FT                   /db_xref="UniParc:UPI000042F43B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE03"
FT                   /transl_table=1
FT                   /translation="MTFQVPPNDANTVSVAMQEWLEFQEFKKFQAAQRAKQSSQSTPSA
FT                   EEVTKNLSSVNLNGSSGSDERQPHPQSPARTSAPVETATSDGGWGEPTPAPVPASTSED
FT                   NAGGWGEPTPAPVPTSTSEDNAGGWGEPSTIDPAEAHPTEQNQVHSHLAPEPEPEQPKK
FT                   SAYVPWEGGVVYSQPTPMLEPVEPLPPLAFRSRRNKRSSKNASKAKSATSGDEERSVSG
FT                   TDPGGWGEPASGGWGEPASASAPSETGSTPAGIHPSRLRMLGGGPVVDPVPSAPSRDYS
FT                   QPSSRRVTGANASVGGDNGWGNRRRTPSATADSDTLSPAAASFTYPQPDARPAPPSGSA
FT                   PAGGAAGIHPDRLRMLGGAPAASSPPMGFGGSREPPPHMRGGMNEFGAVAGGKPKDSGW
FT                   GSRGKRGPPAQAPVSNDGGNSGWGQTANASGGGWGNDASNGGAPGGW"
FT   CDS_pept        join(complement(627621..627647),complement(627530..627564),
FT                   complement(627396..627454),complement(627268..627320))
FT                   /codon_start=1
FT                   /gene_family="HOG000199609" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636634"
FT                   /locus_tag="CNG02210"
FT                   /product="Cytochrome c oxidase subunit 7A "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="mitochondrial respiratory chain "
FT                   /protein_id="AAW44622.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005746"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="HOGENOM:HBG053624"
FT                   /db_xref="HOGENOM:HBG736151"
FT                   /db_xref="InterPro:IPR014368"
FT                   /db_xref="UniParc:UPI000042FF5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE02"
FT                   /transl_table=1
FT                   /translation="MPVAPVVGKLRKRLITDLTASIGIGLAGAYTFWYTVHLPMVKRRD
FT                   DYYLRLEQAKSS"
FT   CDS_pept        join(627989..628182,628240..628273,628327..628372,
FT                   628421..628748,628802..629063,629124..629258,6
FT                   29310..629675)
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806691"
FT                   /locus_tag="CNG02220"
FT                   /product="Phosphoglycerate kinase, putative "
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44640.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG003915"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI00004B4921"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE01"
FT                   /transl_table=1
FT                   /translation="MRSKSLVFRVAIYIIPLIISAYLFLPYPNKHSYSIVAMSLSSKLN
FT                   ITDVDLKGERVLIRVDFNVPMDKEGKITNPARIVAALPTIKYAIDNGAKSVILMSHLGR
FT                   PDGSPNPKYSLKPVASKLSELLSKDVKFLPECVGDEVKSEVLKGENGQVFLLENLRFHI
FT                   EEEGKGKKGDEKVKADPAAVKKFREQLTELGTVYINDAFGTAHRAHSSMVGVQLPKRAA
FT                   GFLMKKELEYFAKVLEKPERPFLAILGGAKVADKIQLIENMLDQVNTLIICGGMSFTFK
FT                   KTLDNVEIGTSLFDEAGSKQVKDLVEKAKKNNVKLVFPVDYVTADKFDKDAKTGSATDE
FT                   SGIPSDWMGLDCGPKSRELFAQTVAEAKTILWNGPAGVFEFPAFASGSNALLEACIKAA
FT                   KNGSTVIVGGGDTATLVAQAGKEDELSHVSTGGGASLELLEGKTLPGVAELSEKK"
FT   CDS_pept        join(628100..628182,628240..628273,628327..628372,
FT                   628421..628748,628802..629063,629124..629258,6
FT                   29310..629675)
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15806692"
FT                   /locus_tag="CNG02220"
FT                   /product="Phosphoglycerate kinase, putative "
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44641.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG003915"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000042FB0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KE00"
FT                   /transl_table=1
FT                   /translation="MSLSSKLNITDVDLKGERVLIRVDFNVPMDKEGKITNPARIVAAL
FT                   PTIKYAIDNGAKSVILMSHLGRPDGSPNPKYSLKPVASKLSELLSKDVKFLPECVGDEV
FT                   KSEVLKGENGQVFLLENLRFHIEEEGKGKKGDEKVKADPAAVKKFREQLTELGTVYIND
FT                   AFGTAHRAHSSMVGVQLPKRAAGFLMKKELEYFAKVLEKPERPFLAILGGAKVADKIQL
FT                   IENMLDQVNTLIICGGMSFTFKKTLDNVEIGTSLFDEAGSKQVKDLVEKAKKNNVKLVF
FT                   PVDYVTADKFDKDAKTGSATDESGIPSDWMGLDCGPKSRELFAQTVAEAKTILWNGPAG
FT                   VFEFPAFASGSNALLEACIKAAKNGSTVIVGGGDTATLVAQAGKEDELSHVSTGGGASL
FT                   ELLEGKTLPGVAELSEKK"
FT   CDS_pept        join(630032..630432,630482..630581,630635..631531,
FT                   631580..631665,631723..632083)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806693"
FT                   /locus_tag="CNG02230"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44643.1"
FT                   /db_xref="HOGENOM:HBG068337"
FT                   /db_xref="HOGENOM:HBG177294"
FT                   /db_xref="InterPro:IPR013966"
FT                   /db_xref="UniParc:UPI00004B4922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ9"
FT                   /transl_table=1
FT                   /translation="MPSLAESLDALAHHSEQIAYLSTLNTAPPGPFTTAYLHLPPPHLS
FT                   HLGKGNVLELIRDASDAERRLFKFVGESNLPGVIGGGGNKRVEKREGGVVTPLKELKRG
FT                   GGGGGGGGGGTEKDEVEVMLRTALKLVDDYRPMPRARAHVINLLDQHHRNLDRLAELEM
FT                   LIAEANRPVDIPASPSHQPEEAEEPRQEPVKLTPEEAIKAEEAALRALEAKIIPLRRGS
FT                   QPSQDEQPLKPQDMVPPVGKNIPQSPPSSQLQSQFESQPTPSQAQSAPAQPRTPGRSMP
FT                   HVTNSLVNATPRHAIERLERAERIDRFSPLKLITPRAPGTLRGEGIFGRRIGSSSASSS
FT                   KLGAGLGTSMLGKRSDEGAAGTSHTPAPVAADAPPAPLEVAPDQNPAGEDPDETVRLTQ
FT                   APSPSSPIKTAAAEFQPSSPPKKVHLPVEELVQPVLDTDVLAQTPQIYADNKLDGVDTD
FT                   AEAVKAGVEKIWSNVGDLMRQGLENGQTVEKDTASSVRHLIHLSNSNLPPPPSPSTSSS
FT                   LSSLSHGGLPPPKPITSETILFAHLFLSILRASSSSEGSPGEVDMNEVKEFLGNVAKER
FT                   GWDGAGGLGTKVIYAAVGKRVVKIERKGGGAGRVRFAD"
FT   CDS_pept        join(complement(641483..641536),complement(640288..641437),
FT                   complement(640149..640234),complement(639974..640097),
FT                   complement(639727..639918),complement(639562..639672),
FT                   complement(638989..639509),complement(638930..638934),
FT                   complement(638783..638879),complement(638702..638736),
FT                   complement(638554..638652),complement(638354..638453),
FT                   complement(638235..638303),complement(638150..638174),
FT                   complement(637990..638103),complement(637846..637940),
FT                   complement(637711..637783),complement(637633..637660),
FT                   complement(637317..637570),complement(637124..637266),
FT                   complement(636996..637066),complement(636888..636943),
FT                   complement(636779..636833),complement(636649..636728),
FT                   complement(636529..636592),complement(636309..636472),
FT                   complement(636151..636182),complement(635886..636015),
FT                   complement(635542..635733),complement(635308..635485),
FT                   complement(635019..635254),complement(634888..634959),
FT                   complement(634784..634837),complement(634715..634729),
FT                   complement(634415..634663),complement(634255..634365),
FT                   complement(634115..634198),complement(633969..634048),
FT                   complement(633770..633922))
FT                   /codon_start=1
FT                   /gene_family="HOG000138255" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806694"
FT                   /locus_tag="CNG02240"
FT                   /product="Protein-histidine kinase, putative "
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44644.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG068335"
FT                   /db_xref="HOGENOM:HBG177295"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI00004B4923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ8"
FT                   /transl_table=1
FT                   /translation="MLENGSIDYSTLPTRYLESYPYPSLVLLVPIQPPSQPSQEELDEF
FT                   PSPSFNTEAPKPFTRADHGTSQPFDIVWANEKWRNLTNDQSLLNCLNVREARKLGNWIG
FT                   GVKEATGNGKEQIAHVAKAVGVGIPEALAKMISNQSSSEFSAAQMLHSADPGQGQMLQP
FT                   PEDFWAPEHPYEDRSTKSDHLSNSSELTGIEVEEGMQSNPATVTIELVNPGTVTLEFTK
FT                   TIVPVTRLGAGGLKAPMNTHSFVIITTVPKSLFVPNSSFQSSPLTSPKLQGVQDEAATK
FT                   SNYPLAIPKTTILSPSQSPPPLPLSTAPQSSLTPNPDPNNISSAKNSPIDELKGLGILS
FT                   PSKKHSAPLMFNGDGTVSRQIQELEANGESRTNVDVLMDQTDWSKTPLGPPEQWSQSLK
FT                   TIVGLVLNYPHQCCLWWGEELTLIYNEPYARAIHKHPDIFGMSGPVAWSEIWNSIGPLS
FT                   ELVLSGTPIWKEDDFLLFKQLPHQGEGVWEEYHTWMWVPVLQEDGTFGGLWNATVRTTK
FT                   KVLAERRTATVREMGQRTSIARTMDEFNAAVCEILESNPRDVPFAALYRVEPTLPSKGK
FT                   GQGTNTAEITKSDPNEVQVDVTLVGRVGIPENHPSTPSSMSFPIRQRRGSSTNRFPQGL
FT                   NNSPAMSLISSTGGISHIPLGGTGAGESEPHPTPELKHWPIREALQCKSLILVEDVAGL
FT                   IKDYPIRVWDELPNAAIVVPISSDSEEGIPSAVLVLGLNIRRPFDEDYESFIHVLRLQL
FT                   ASGIAAVRSYEAERLRLDELAALDRAKSLLFSNVSHELRTPLTLISGPIEDLLMETKNG
FT                   PKKEMLLMARRNLRLEAGRLRGTFRPVNLGIMTRDLALLFKATIEKAKLKYIIEVDTSP
FT                   ENVFVDPEHWEKIVFNLIGIIGNAMKYTMTGFVKIKLYYSSGQAILIVQDSGVGIPRSD
FT                   IHLIGERFHRVQSVSRSHEGTGIGLSLTKELISLHGGALEIESFTEEESIDGSHGSTFR
FT                   VKIPIGSDHLPFEAIDTGRMPNMPQLTYGRGLVDEAMQWVRDRETGSVVSSDESSSALT
FT                   GDSSGMGSSKPIDPNTLYFQKEDVIMLVEDSSDTRRYMKSIFSQYCQVVEARDGQEALE
FT                   LCHKSIPNLIISDVMMPRLNGFEFLAALKESKDLKMVPVIMLTARGADESKVDGIMAGA
FT                   EDYLAKPFSAREIVARAHMQLQLGKKRRHLEEAFEERTAELRALAEFSPVGIFRTDQNG
FT                   NITFANSAWYKVSGYPMNEPVVDWIDVIIAPHEREAARAFWKEALTSREKSLMGDWEYT
FT                   NGRWNAISNGSVGLKTDITERKAHEESQRRQVIEAEQRRLDAEEAKRQQELLIDITSYV
FT                   KTNLLSLQEQLHIAMDNHTPFTPTRQLMNNIEEDLEALESIYQCGLTQERISNDVLSLG
FT                   RIQLDMLQMFDVEFDLSKEAQSIISIFQNEARMKRISLSLKTGDNNKNLGIRYVKADLV
FT                   RLNQITTNLLSNAIRFTATSCESLRVKRSSVVAEFFIKAIRHIEVRTDISFDPPEEGTC
FT                   AVAKNVLSQPPVLKDDMPIFVFLEVADTGPGLSEDECQKLFQRFSQVSPKTHTIFGGSG
FT                   LGLFVCRKLAELMGGSIEVVSEKGKGSTFRFYIKAKTCRTSPATGNGLRANIKAQRNTA
FT                   RYFGLRRKPHVLIVEDNLINQTVLARQLKHCNLTCDVANNGLEALEKIRKVSSMENEPD
FT                   GQAFDCVLMDLEMPVMDGLTAVGHIREEENAGKLKKNLIIALTGNARQAQIDLAKASGM
FT                   DEVVIKPYRLDDLLHKIDEVIKIRAADENEGINQEVEVEARAVEQAREIARAVESGTDK
FT                   D"
FT   CDS_pept        join(complement(644299..645181),complement(644116..644243))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093396"
FT                   /locus_tag="CNG02250"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44882.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG068334"
FT                   /db_xref="HOGENOM:HBG177296"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI00004B4924"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ7"
FT                   /transl_table=1
FT                   /translation="MTFPSTSSIRSLRSLAASFSRSYATISPYSPPSNDYAPPRRKPRP
FT                   ESSQFFTGRPEFHEALVSLSSTVKNTTAVLREAHIYPLPTDLPHVTPPRAAWVSPEELS
FT                   SIFQVKLKTSTLRQVMDLLSELHNLRHVSELAGYPDLAAKIDAAVERYERAGMAEGKKD
FT                   VKEKKEKRKLDEFGRAYAMGRKKTSSARVWMIPNPSAPPFLQSAESSSTDVPTLPTSEI
FT                   LINHQPISTYFPRLIDRETILRPLRLTGLLGAYNIFAFACGGGVSGQAGAVALGVARAL
FT                   TILREDSTDVLRADGALMRDTRMVERKKTNRAKARKGVSALLSSSYSSLLTEVPQ"
FT   CDS_pept        join(645550..645630,645687..645786,645834..645883,
FT                   645942..645986)
FT                   /codon_start=1
FT                   /gene_family="HOG000255170" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636635"
FT                   /locus_tag="CNG02260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44645.1"
FT                   /db_xref="HOGENOM:HBG429686"
FT                   /db_xref="HOGENOM:HBG739421"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniParc:UPI000042FF5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ6"
FT                   /transl_table=1
FT                   /translation="MDVDKTTLSVEQRMDQKLRSSLEIHHLEFVDTSGNCGMSYAVTIV
FT                   SPNFAKKITLQRHKLVNQILAEEIAQLHAFSQKTLTPEQWEKEKTK"
FT   CDS_pept        join(646754..646933,647021..647288,647339..648373,
FT                   648523..648671)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093397"
FT                   /locus_tag="CNG02270"
FT                   /product="Ligand-regulated transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44646.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG177297"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI00004B4925"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ5"
FT                   /transl_table=1
FT                   /translation="MVLINDKKFACEKCIKGHRVSACTHTDRPLFEVKKKGRPSTQCKH
FT                   CKEKRKSAGSSVHTKCQCGATDPKTLKDILASVNAPHAATSGLAGASATANTSAEQEIE
FT                   TRKGQPGSKPTFPRGLKDVHELAAAANALQGLGEDDQVVKAAERTVQALLNPCKCELGG
FT                   PCTCCQIKTKPRKKHSGHEFENPASAGATPPGGGCCGSSVYSRDDVVATRNSPTSINSS
FT                   EAIHHPPQTAPMLHKTRLFSPYSTDLRRRDSSSSAGSKTPGWASPRAMRPPTTRIKPLT
FT                   DMRRLMSAAVNQDGTLASEIPRSVVGLPTLPGIESFNTSANLENGEKSEDVDMPLAFPT
FT                   SEDVVIGACMCGDDCSCPGCATHDHHNISSSNRTHDGSCGESCKGHHDCAHSIPIPSGV
FT                   QSIAQLICIAASQVPPPPPNRTDSLNPHDTRILPPSVSLNEDAARTMGIVPLKPLECCG
FT                   GQCRCPPGECTCTKQCCGCCGDCTCEKDEDTRMAEEAETFESPRVCDSSFNVFTVFQYA
FT                   TTIAFDCIFTCRFTFCGCSSIEWSKC"
FT   CDS_pept        648736..650040
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093398"
FT                   /locus_tag="CNG02280"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44647.1"
FT                   /db_xref="HOGENOM:HBG177298"
FT                   /db_xref="UniParc:UPI00004B4926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ4"
FT                   /transl_table=1
FT                   /translation="MPQGSRPPSALGRSGSMTATKRSGTSTGVRRSNSDARKVVGPSQP
FT                   HHLQSNQSPSDRSFYISSPQPNQIAPNGVPMASAPSEMAAPLNNADSNSDLLAFIQQQW
FT                   SANKTSNSDMNPSEPAMPISVTAEPWAFPPQNETAEDSPPSDSFDLDAFLMSIGVQPDG
FT                   ELRNDRPPSSQPPQSLMSNIPPTQPIAPLPPIPPSMSNVRPGYDMTFANFFLNSTPSGP
FT                   SGPSAVPAASIPSRHTTPQASRPLTPPEASFAEPPRWKFPGGLGGEIPIWKSPEVLQGF
FT                   GVLGSPVLEKEEVGEENENGKDIIDLSKPLDSAALTKIMKALEKQGGGQSSSQGAPSVV
FT                   NTNQQLQSLPALQTALPVHPASVISPTRTDSAHELDDMFSQFVTLDGTPGGGNNDGLGL
FT                   NGGPGMMALATNMSLGDELGFGGEMRWDQARMWSN"
FT   CDS_pept        join(650501..650758,650819..650969,651026..651445,
FT                   651496..651626,651679..652032,652085..652295,
FT                   652349..652620,652676..652726)
FT                   /codon_start=1
FT                   /gene_family="HOG000214672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15806695"
FT                   /locus_tag="CNG02290"
FT                   /product="Pre-mRNA splicing factor, putative "
FT                   /protein_id="AAW44648.1"
FT                   /db_xref="HOGENOM:HBG141421"
FT                   /db_xref="HOGENOM:HBG395553"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00004B4927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ3"
FT                   /transl_table=1
FT                   /translation="MPSLIADYGSSDDESPSLKASTSLPAPGGSFNSNEATVDDDEDDE
FT                   RIEEEAKKDAFGLTSVAKAEREAEAKRQKEVVTAAPDVLKEDPNGAGMAIITRPTDKVM
FT                   NVNLTYEEMSRPVAGPENPFDQRKNKGMNTLSGHVEEQSMDDYSFLMAQRTFDVHGYAV
FT                   NPSIQNVATPIVGSLTNAHQNGYSSIENIRPTRSERKETKRKRGGKGDASVVDGEEAYM
FT                   GPWASWQQDKQEAPVVEEEEDDEEWREEKRRREEASAAAKEKMKTAMEEKSIFHGKELY
FT                   DYAGRTYMHIPTDKDVKLNPSDGAPPPNAYLPERCIHTWTGHNKAVSAVRLFPRSGHLL
FT                   LSASMDTKVKLWDVYNEGNCLRTFLGHSQAVKDIAFNNSGDKFLSASYDKHIKLWDTET
FT                   GKCIQAFTNGKIPNVVKFNPDGDKQNIFMAGMQDKKIIQYDLREREIVQTYDQHLGPVN
FT                   TITFVDENRRFVTTSDDKTIRGWDYDIPVVIKYIAEPYMHSMPAVTLHPSKRYFACQSL
FT                   DNQILVYSADGSFRQNKKKRFAGHTIAGYACNIGFSPDGKYISSGTGSGEMVFWDWKNG
FT                   KIMKRLKAHKEVVIDHAWLPNEHSKLVTASWDGLIKLWT"
FT   CDS_pept        join(654732..654810,654909..657015,657064..657316)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789558"
FT                   /locus_tag="CNG02300"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44649.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG177299"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000042FE90"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ2"
FT                   /transl_table=1
FT                   /translation="MRESSVTGPPQNRAVTIITHMVYDRRALDTNSPLALLNSLTALTS
FT                   LTSTSPRIREMLTIDGGLERLLDILRESCLPKEAPVPQDLWGLNGAPTARVITMDRANS
FT                   LKHSLAFQCVVNIGVRGSEAIRTRVVQSGALDLVAQILESWLKDHGISIYSGPLGSQAA
FT                   VDAFAAGHPVPGTENLRRRERREDKDRTERRHRASHYPHPQQVEQSTVASSSRTGVPSD
FT                   GVRQATPAASVVSTSSTDVSRPQSRNVDTDVDMADVEGGESTDASMDADDNSIDVDMRA
FT                   DSAAGPSTSQAQSSTTPRARTNILPMTIPPVSRPSREHDMPVHAGSVVESSSGDEHAGH
FT                   SGGIPRITSESNLVTGNQGHRPPNINIGPSRTTQLPQDPTSTQSSPMGTPPRADGEVVA
FT                   TSVRHGRRGTIIARQNNLAPRNDRETRQGDGGGREHSDGGEDIDLPTATIAAGIAAVNA
FT                   QAMENNGPIIPDEPGPPPNVEIIETNGGQELEEPDPEAIAAEQARLDMEAGAPPGQPGA
FT                   AQTPRNAPLEAPTPRQTRGQETRPTEVQAQIIIANGAPRGFNDLGSYVGISSLLNPDGN
FT                   RYSDDSILLSLQLLAYLSKYPHVRTTFHHPRRPIHPTFDLGHDYVANPLPERPAYSETP
FT                   DIFSVVERLTFRPSPSDPLMFKIPPEIQYWAGVIMRNACRKDDARGGIRQCANMSCGKW
FT                   EKFSREFAKCRRCRKAKYCSKECQSRAWQEGHRFWCSSRNDQEPSASASASASATAAEV
FT                   AQSQAQAEDEEDVRVGLEMGLSPEVVTRALAAARAAGIENARTPPGRVPVRRTDYNSHS
FT                   "
FT   CDS_pept        join(657888..658316,658366..659303,659356..659628,
FT                   659680..660544)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807695"
FT                   /locus_tag="CNG02310"
FT                   /product="Chaperone, putative"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAW44877.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI00004B4928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ1"
FT                   /transl_table=1
FT                   /translation="MLARKHLIRTARLSIPRPSVATRAVALGFVRTYAQGPPRPPPGGP
FT                   GGPPGGGFGGMRFPGGGMMGQQPEKGETLKQFSIDLTKLARDGKLDPTIGRDEEIRRTI
FT                   QILSRRTKSNPVLLGLPGVGKTAILEGLATRIVNKEVPESLHGKRLLTLDLSSLMAGTG
FT                   VRGEFESRFKSLLKDIEEEEGNVIVFIDELHTLLNLGKAEGSLDAGNMIKPALARGLQL
FT                   VGATTLDEYRKSIEKDAALQRRFQPIMINEPSVESTISILRGLKSRFEVHFGVQIADSA
FT                   LVTAAVYSDRYISDRFLPDKAIDLVDEASSALKLAQESRPTELEKLDRETVTLEIERES
FT                   LKNEEDPFSVSRMEKVEKELEEKKQEQRRLADLWAQERERVAEIKGIKEQIEQANVDLE
FT                   NAQRNGEFEKASKLRFSTIPQLQAKLPKAQAELKSENEEEPGMAVRDRVTSEDIAVVVA
FT                   KSTGIPVANLLKGERERLVHMEESLKQRVVGQDQVIHAVADAVRLSRAGLQAPTRPLAS
FT                   FLFLGPTGVGKTELTKSLAEFLFADEKRALIQLNMSEFHDKHTVSRLIGATAGFVGYEE
FT                   GGQLTEAVRRRPYAVVVFDEIEKAHPDVANILLQILDEGCLTDGQGRLVNFKNTIICLT
FT                   SNLGSEALYEPDATHPDGSITEATRASILSHVGRFFRPELVNRLDELLIFNKLPPSVIL
FT                   DIVSLRLSELQSRLDGRRITLEVSDDARAWLAKKGFSEEYGARAVGRVVRDQVISKVAG
FT                   RLLDGTIKDGDIINIRLEGERLEISSAPNPNIPHPSQEGGDHISPSARGASTEAESRPL
FT                   NILEDGVEEEGDEDIPRRTVYY"
FT   tRNA            complement(661319..661424)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        join(663940..664155,664214..664478,664539..664971,
FT                   665361..665679,665734..665827,665888..666603)
FT                   /codon_start=1
FT                   /gene_family="HOG000138263" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581883"
FT                   /locus_tag="CNG02330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44650.1"
FT                   /db_xref="HOGENOM:HBG177300"
FT                   /db_xref="UniParc:UPI00004B4929"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ0"
FT                   /transl_table=1
FT                   /translation="MLLLQRTTSPLPREIPPHSVLQLRSPIDHNLVTTSNFTSFGDREA
FT                   IDLHSNHTSTPLFEPTTAPSAIMESSWPAQSSFSYYNQGSLQTSSRQTSSSTNEYSDRT
FT                   PRRSAAQPQMPTFLPPPPPHGHQIPENGGNNLPSFSHSLYSPYHGPGGNLPPSNPHGFQ
FT                   YTNHSPMGLNEPLTSHSRSQITHSYHDPPRLPGYSSSPNLHQLSPVSPTAHLLPNMQPP
FT                   SASPSSSSFPSSIPRTPATLPKGVKRHSLGSEQSFDSWDDEQDMPSGKITGDRKYEKDP
FT                   QPWGMPQEEYKKLNPKDKKQVRNRLRSSQQSPIMPPKRQNENENQASEATQKKQRNSNK
FT                   QWATDTNSDGVSAEEHVAVWLSTIPENGRLPNFHNWKTGHEKKDFWSRKCLQYLTDNGC
FT                   DSRRQFQSVALKINQIVESFTKASQIGTGTGAGAMEIDDESLLAQRKKVCPFYEILLPV
FT                   LGDRASVTAHHASSTLHASLNRPDRDLAALDGLIERQRGEMAADDSEDELSGEDGGLFG
FT                   DGAGEASETESEADAPIIAAIRRESRSSSQPARSSSVLGSVSTPIRAQTQSQRASIRSS
FT                   KAKAVSADDKMDELVMRQEGNDDRRHQELLAVQERKISVQEKHHADMMNIAQENVTIAR
FT                   ENAATEKMKMLAESWNRKMEMLMRSGKSWEEAKVMVGPEPGAPSL"
FT   CDS_pept        join(664141..664155,664214..664971,665361..665679,
FT                   665734..665827,665888..666603)
FT                   /codon_start=1
FT                   /gene_family="HOG000138263" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581883"
FT                   /locus_tag="CNG02330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44651.1"
FT                   /db_xref="HOGENOM:HBG177300"
FT                   /db_xref="UniParc:UPI00004B492A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDZ0"
FT                   /transl_table=1
FT                   /translation="MESSWPAQSSFSYYNQGSLQTSSRQTSSSTNEYSDRTPRRSAAQP
FT                   QMPTFLPPPPPHGHQIPENGGNNLPSFSHSLYSPYHGPGGNLPPSNPHGMAHSMPSYSH
FT                   ISALSGTASGFQYTNHSPMGLNEPLTSHSRSQITHSYHDPPRLPGYSSSPNLHQLSPVS
FT                   PTAHLLPNMQPPSASPSSSSFPSSIPRTPATLPKGVKRHSLGSEQSFDSWDDEQDMPSG
FT                   KITGDRKYEKDPQPWGMPQEEYKKLNPKDKKQVRNRLRSSQQSPIMPPKRQNENENQAS
FT                   EATQKKQRNSNKQWATDTNSDGVSAEEHVAVWLSTIPENGRLPNFHNWKTGHEKKDFWS
FT                   RKCLQYLTDNGCDSRRQFQSVALKINQIVESFTKASQIGTGTGAGAMEIDDESLLAQRK
FT                   KVCPFYEILLPVLGDRASVTAHHASSTLHASLNRPDRDLAALDGLIERQRGEMAADDSE
FT                   DELSGEDGGLFGDGAGEASETESEADAPIIAAIRRESRSSSQPARSSSVLGSVSTPIRA
FT                   QTQSQRASIRSSKAKAVSADDKMDELVMRQEGNDDRRHQELLAVQERKISVQEKHHADM
FT                   MNIAQENVTIARENAATEKMKMLAESWNRKMEMLMRSGKSWEEAKVMVGPEPGAPSL"
FT   CDS_pept        join(complement(667697..668117),complement(667103..667626),
FT                   complement(666652..667044))
FT                   /codon_start=1
FT                   /gene_family="HOG000138222" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942696"
FT                   /locus_tag="CNG02340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44652.1"
FT                   /db_xref="HOGENOM:HBG067689"
FT                   /db_xref="HOGENOM:HBG174795"
FT                   /db_xref="InterPro:IPR006912"
FT                   /db_xref="UniParc:UPI000042C73F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY8"
FT                   /transl_table=1
FT                   /translation="MPRRSAKYKATARARELYRMATILNHKQLKASLSIPYHALRTSRY
FT                   LNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVFVSHGP
FT                   RKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLERNNV
FT                   YWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRYGFNI
FT                   LGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVHSEMIS
FT                   QGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYGILKNRW
FT                   QSLRSLRVKIRNVRDEGVATCWIRACVVLHNLLIDTGDWYNRLDGDADEPDDYIDIERM
FT                   QERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
FT   CDS_pept        join(669506..671272,671315..672427,672486..672769,
FT                   672820..672972,673023..673186,673234..673444,
FT                   673499..673622,673676..673825,673874..674118,
FT                   674176..674260,674310..674373,674427..674504,
FT                   674561..674700,674754..674839,674888..675219,6
FT                   75277..675296)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942697"
FT                   /locus_tag="CNG02350"
FT                   /product="SSD1 protein, putative"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="AAW44653.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG068330"
FT                   /db_xref="HOGENOM:HBG177301"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="UniParc:UPI00004B492B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY7"
FT                   /transl_table=1
FT                   /translation="MADPVSPTPDHQPQATLAPPPAHPSRPSSANSQKSNSSRGRGKNA
FT                   NGGSSNMSRTNSNTSGQSDSGRSDKKRQSGPTTTISGGVSLGVSGEVPQQSKKGKGKGK
FT                   NQDKEKESEKKGASSEVEKPQKNNSQKGRRSASGRKPHLTSTNESSRTVSRNSEGENMP
FT                   ADAGSAQSAPGPKSIHAPVSAPRTAIEAAVEAATKKHRSQTGGDALASLQKMISDLKTL
FT                   PATSGPASGSSAGSRSTSVTRDPPSSSSAKTEPIAIPNAPNSGSHKTLKADAPTFTPSF
FT                   QSFSPVASTSGLSVSPNTTMPTLTQLHPRSQSQSNGAHHRRNSASSMSSVNFAPPFNPS
FT                   PIQAFGNPLPPFYQTPLSVHAEADGESLSPLSFAQHASFQYQQQQLLAAQQQQYQYIQL
FT                   LQAQLAASQLAHQQAQQAAQHQNQQMGNFIAPRFQALAAQRAASQQQQQAAQLAQAQQV
FT                   FELQQAQLLLQQEEATRTSVRAAAEAAHPQDQPVFEEESPELQPHTVGPTGRPQLAPSF
FT                   TFGAKSKHGATESVSERGSGRESLSPAQSSRSPIVVNRSEGIGGAAATGLAGLAARAHK
FT                   RTGSEMSSVLQQQFAIQQEIEALQAKQKALMQQDLTQQGDNPLTQLNTAYAQKQTPSQT
FT                   LSRHRRVQSSLPSASVPVDFEREQGQPRPMKSVGEMPPPPIPSGHGRRHSVNILNKAAG
FT                   SGMGFGLADDIPEDVVAPSGHRRSSSRSGLESGSWRLGASSGNAQSSQNQVADLAAAQA
FT                   QLQSLAQFRAAAGGGHSKMASFSFPNMLPNLLAATTLQAPVGQSLWQQQQAFQMQLQQT
FT                   TQGPQRKSLFAPYLPQASLPPLLQAGKLVVGVLRVNKKNRSDAYVATDVLDADIYICGS
FT                   KDRNRALEGDIVAVELLDVDEVWSTKKDKEEKKRKKEENATYDLKPSTVKKLEKKKDDV
FT                   EVEGQGLTLFDDEEVNDDTKPTYAGHVVAVVERMPGQLFSGQLGVLRPSSAATKEKQEL
FT                   ERREREGEKARKEEPETRPKIVWFKPTDKRVPLIAIPTEQAPADFIDNPDAYSNKLFVA
FT                   TIKRWPITSLHPFGTLVEELGAIGNSEVETSALLKDCNFPTEEFSEMTMKCLPPMPWSV
FT                   PEREYDVRTDLREERVFTIDPPHSKDLDDALSFKDNKDGTFTVGVHIADVSFFVKANAQ
FT                   LDREARKRATSVYLVQRAVPMFPPLLSEDLCSLVPDYERLTFSAIFTVDEEGNVLQKKF
FT                   AKTIVKSCAKLTYDDALTVVKGGALPRSKTSRIHLATDIEGDIRSLHSIASKMRARRIE
FT                   NGAMVVSSSKVSFEFDAQGRPVDCQTYQNGEASVIVEEFMLLTNQSVARIIANALPEQA
FT                   LLRRHEPPSERRLESFVARATKLGFDMDPTSAGTLQKSFDKVLDNDSALCIDLLRKKVI
FT                   QRARYFCAGMLDIAKFAHWGLNTPLYTHFTSPIRRYADVLVHRMLDACLTSPNPNEVKF
FT                   LMDRDQVAKAAQQCNMKKQSAKLAEEQSVHLFLCILINDLTEHYGPVVREARVTNVLET
FT                   AFDVIIPEFGVEKRVHVDKMPVETAVYDEHRDILSLYWTTKDVISHLADTTEDKRLLKI
FT                   KSHGEQRALGSSTSQATDDTALFDGNSPDVVSKQYAKSAHPSPLKFEGLRSVDGGHKVQ
FT                   DVKELMSLPVIITSDMTKSPPVLVVYACNPYAT"
FT   CDS_pept        join(677295..677390,677446..677536,677595..677691,
FT                   677740..677855,677918..677997,678056..678151,6
FT                   78219..678341)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093627"
FT                   /locus_tag="CNG02360"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="AAW44654.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG053786"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR016068"
FT                   /db_xref="InterPro:IPR016069"
FT                   /db_xref="UniParc:UPI000042EC42"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY6"
FT                   /transl_table=1
FT                   /translation="MASSEPTSRALSVSSTLSSAIASLENDQNLRKQIKESVEPIEDLA
FT                   RSAWSEINKIHSAPASQHPDICNSSLEVIKKIAPLWVGVAELIPQGEFYRYLYAVGPIM
FT                   RSLTTSIVFARFMLHDELTPAFTVSSLIGLEQEETKDLVLSAEDYLQGVIGAVNELPRL
FT                   SINAVTSQNFELPVKIAAFVNDIFASYSLLNLRNDALRRRFDSLKYDLKRCEDVVYDLT
FT                   LRGLAPAPKA"
FT   CDS_pept        join(complement(680146..680396),complement(680015..680098),
FT                   complement(679864..679967),complement(679680..679818),
FT                   complement(678985..679633),complement(678453..678935))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807696"
FT                   /gene_name="TRM82"
FT                   /locus_tag="CNG02370"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase subunit
FT                   TRM82"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44655.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG177303"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00004B492C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDY5"
FT                   /transl_table=1
FT                   /translation="MALHCPPTALATSSTSLFIAAGPALHVFNPSTSTFASCAADGTGG
FT                   LIRLLAVREDGEVAATLGEDKQLAVWDIQHDRPQFRHTRTVVKKGSCLSFAKDGSIILT
FT                   DKVGDVYSYPLDPVPIDPSAERPPMYTLVADPSQNPDATYLLGHVSMLNAHVMTPDGRR
FT                   IITADRDEHIRVSRYPKAYVIDKYLFGHDGFVSALHIPPSNPSLLLSAGGDPSLLIWNP
FT                   STGKLLTSVPVWPAVLSHRRVRSHLRRHKPGSRKLKMDPVPEDMDEENQTFYTAPEGYM
FT                   LPSGQGVCIKKIESVKIGGETVVLFFSEGASAIHSFILPTDPEGVKPTVHTLPLPHPLI
FT                   DFTPIPSTSSADEKEVLLSLDTAWDVLKKNPGPGIEGRQDTIQRDDLSDEEKRNISKIF
FT                   SVARISADGHLSLGDASVYDSLVSNLPSTDIKTLSNVNLYPLLCVLPRWPGFEEGDEEL
FT                   TVNTGTPDTPGTPGPADAVSLAPTSGAFLQKSYTQEELEKMNTKQLGRLKSAGIDVGSI
FT                   LLARQKKAKEEHKARKAAAKAKAEAQKNQKEGGRPAKKKKKVEMSEEELANA"
FT   CDS_pept        join(680626..680628,680676..680959,681012..681484,
FT                   681537..682981,683030..683338,683395..683679)
FT                   /codon_start=1
FT                   /gene_family="HOG000224124" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093628"
FT                   /locus_tag="CNG02380"
FT                   /product="DNA replication licensing factor cdc19 (Cell
FT                   division control protein 19), putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44656.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000042C211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY4"
FT                   /transl_table=1
FT                   /translation="MPSPPIPPSSQQRPKRPRSRSRSPTAGPSGLRSSPPPSSLPPSSL
FT                   PPSSPPIPFSDFGDEQDVADDEAEVRRIGRENGDDDEEEEGEDLFNDDMMADYEENAGL
FT                   DTYSQADLDDRSSVAGPTRAERLAAERAMDLRDRGVSGRRAGRRDHMPAFLQSDDDEAE
FT                   AFGDDPLAGINIRRRRRQYDERMDEDDVEEDEEEMSLEHLGDVKAASIAEWVSRDAVRR
FT                   AISKHFKSFLMTYVDAQGNSVYGQRIKHLGEVNSESLEVSYIHLANTRPILAYFLANSP
FT                   QPMLELFDQVALDAILLYYPSYDRIHSEIHVRITELPTSLSLRDLRQSNLNCLVRVSGV
FT                   VTRRSGVFPQLKYVKFDCQKCGATLGPFYQDTNKELKISFCQGCESRGPFVVNSEQTVY
FT                   RNYQKMTLQESPGSVPAGRLPRHREVILLWDLIDMAKPGEEVEITGIYRNNFDASLNTK
FT                   NGFPVFSTVLEANHINKKEDLFAAMRLTEEDEKMIRTMARDDRIAKRIVKSIAPSIYGH
FT                   DDIKTAIALSLFGGVGKDINRKHRIRGDINVLLLGDPGTAKSQFLKYVEKTANRAVFTT
FT                   GQGASAVGLTASVRKDPITKEWTLEGGALVLADKGHCLIDEFDKMNDADRTSIHEAMEQ
FT                   QSISISKAGIITTLQARCAIIAAANPIRGRYNPTIPFQQNVELTEPILSRFDVLCVVKD
FT                   AADPVQDEMLAQFVVGSHLRSHPLFDKEHEEANVSTVIDADIIPQDVLRKYIMYAKEHF
FT                   RPQLHQLDQDKLARLYADLRRESLATGSFPITVRHLESMIRMAEASAKMHLREYVRTDD
FT                   IDLAIQVAVGSFVSAQKMSIKKTLERGFRKYVHQATDHEELLSFLLGGIVKEKVQLYRH
FT                   SHGENPTRVFVKVSQLEGRAKELEIYDVQPFLRSRLFSTNGYKVVDHDGARSIEKAFTV
FT                   GA"
FT   CDS_pept        join(complement(685147..685222),complement(684790..685086),
FT                   complement(684268..684719),complement(684043..684214),
FT                   complement(683885..683991))
FT                   /codon_start=1
FT                   /gene_family="HOG000217675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093629"
FT                   /locus_tag="CNG02390"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44657.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177304"
FT                   /db_xref="HOGENOM:HBG447631"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000042E2EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY3"
FT                   /transl_table=1
FT                   /translation="MPVPVPQIFQYDYVPETKEDLEWADLATIDLSKFNNPEGRKELAQ
FT                   TLLEAIRTKGFFYVINFGIPQEKVDRQYALGSKFYDLPLEEKSKYVPDLENGEYNGYRP
FT                   AGRSVLGGGIRDRIEVYNIPKFDGYHERNHPDVIEQNIHEIEEFARSLHTNVLDPLHVL
FT                   VALALELPEDYFTNLHKYSDPSEDHLRYMMYRHFSPEETKIIESNDGLYTLGHTDLGTL
FT                   TLLFRQPVAALQIRDHETGNWKWAKPLDGSLTVNTCDALSFLTGGYIKSTVHRVSIPPK
FT                   DQQQYDRLGLLYFARPQNDLPLATVDSPLLKREGFDKNEFERGGYKVPTMGEFVQVKQK
FT                   WQQTKRVAHREGDGSQILPGFEGKYHD"
FT   CDS_pept        join(686620..686689,686873..686916,686970..687033,
FT                   687150..687198,687252..687482,687538..687597,
FT                   687663..687896,687949..688306,688359..688454,6
FT                   88502..688792)
FT                   /codon_start=1
FT                   /gene_family="HOG000234934" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807697"
FT                   /locus_tag="CNG02400"
FT                   /product="Biotin transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44658.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG177305"
FT                   /db_xref="HOGENOM:HBG327101"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00004B492D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY2"
FT                   /transl_table=1
FT                   /translation="MGFIKNARKNKIVNVIVDVFDWYLFCKYLDQTNITNAYVSGMEED
FT                   IKAGGNDLNYFNVAYVVGQIPLISLQSKPALAPWLLPSMEIIWAILTFCQARVSKPWHL
FT                   YLLRALLGFFSAPSFGGTHLVLGSWYRKEELFKRAGVWFTGNFIGSAVGGYIQAAAYKN
FT                   LNGVYGLAGWRWLFILTGAITLPVSFIGFALFPGLVNSKRRWWFTEEEHELATTRLTHD
FT                   HGADNGVNLQTIKNVLRKPMIWICVPSYVCLVLASYWTGYMSLWLKADTNYSVELINVL
FT                   PTFVYIVSALSSWIGTTLAGAINIPSLWTLQAVSRKKKKKKTSLVTAEPPFKFGMIFPA
FT                   ILMCIWNIPNGLKFFAFYFSGLSQMGSPIFYSWINTTLRSSPAERSLIISSCMTMGYCF
FT                   YIWVPLFTFPTVEAPEWKHGYPPTVVFAFVQYILVLFGMWYMNRNSAVQENPESPDIGL
FT                   SYSRSEESSVSEKDEKIDPLVEWEAEAVNQAGKQTSRVGA"
FT   CDS_pept        join(complement(689591..689882),complement(689086..689540),
FT                   complement(688970..689032))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807698"
FT                   /locus_tag="CNG02410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44659.1"
FT                   /db_xref="HOGENOM:HBG177306"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000042FB0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY1"
FT                   /transl_table=1
FT                   /translation="MSPASRKVTVESASSSPTPPPAEIPSRSTETEDADKAESASGSES
FT                   EGEWDPSAERLPGEADKSGGNGKGKEHDGGKGEGSEKEEEQPWQAVWSPEQNAYYFWNT
FT                   KTGEVTWTNPLQPQTSTQPPLPNEPPPLPAGPVPVPQESHPEFGQLPDIDPALAHLLPP
FT                   SQRGLGMPADVTLTQRAAFNSRTGKFTPQDYYSPEHLSEYNRAKRMNSHYFDVEAWERQ
FT                   KAEEAAKRRREEEEGGSSKKKISKKDMDRFRKKAAERKARSQAWLRE"
FT   CDS_pept        join(690426..690685,690742..690787)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789559"
FT                   /locus_tag="CNG02420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44661.1"
FT                   /db_xref="HOGENOM:HBG068326"
FT                   /db_xref="HOGENOM:HBG177307"
FT                   /db_xref="UniParc:UPI00004B492E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY0"
FT                   /transl_table=1
FT                   /translation="MFLFSDFGSKFAHLLDGQKTSTTSTLQSRGVSYDPTASRVKIQTN
FT                   RAAPSREEYISNMQGAFKRGAHNIKAHSNAFAFKKGSPEGSPSLEKKGFVRTKKLD"
FT   CDS_pept        join(complement(694502..694621),complement(694333..694445),
FT                   complement(693824..694282),complement(693386..693773),
FT                   complement(693065..693333),complement(692770..693015),
FT                   complement(692420..692708),complement(691544..692368))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807699"
FT                   /locus_tag="CNG02430"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44663.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068325"
FT                   /db_xref="HOGENOM:HBG177308"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00004B492F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX9"
FT                   /transl_table=1
FT                   /translation="MPPDNRASSSSSAQTGSKKRSIAPKRNAIACLRCKERKARCVPAP
FT                   PGSSPVPTCTNCLGAKKECIYLERTPNEIFLLEYVSQLESRCAALELELRKLNPRSQFA
FT                   ADDIHMPEKAREAAVDKLNAVYPPGPLRIGDNGLMSGGQAATPIVGAGPGTSQIVATPL
FT                   MKTDDISTRHAGDINLGSGALTSESENDEEGDEEDFALGIGMLSLGGGEEPVYVGPSSG
FT                   VNWARVCATALRRPRDRSQPSHLSRFSYLAPPELASVQSALEYTLHHPTPPLPPAALAA
FT                   HYLDLVYDHVQSRYGCFDWQAVRHWHENREAICQGRPLWGVGTGEDERRNLASFFLWLC
FT                   YGYGARLSEGEKLQGAVSHEVYYNAAVACLSTLTSHHSLATVQALALLTIYSFRHPTAE
FT                   VSVWQVGGLSMRTAVELGLHRRTRSKAEREKDPKRYEMKKRVFWAVYSLDRMMSAQLGR
FT                   PSGIQDRDIDVELPLNVDVDFNQPKVLAAMQSRQLDMMSGKRPGDEYADGYGPVTSMTS
FT                   AIHNIRLNQLKQLIQDAIYRLDKPLIPTKNILTAERQSIPEVDNLLVRLDQWRACHPDP
FT                   PPGVQIPLLPREHWELEYHNCVQMLLRPIVASRRARREYVSLCLESAAALCETQYAYLQ
FT                   PAIDPSKLSTWRFYRIFLAGMTLLHVVTTLPTDFSEHDRRRAENAIRQCEISLGVWGER
FT                   FRGAKRHEKLFKELVAAWEARKNDESQISTPKALPPIISERSQPKPFQSPAPHHPTPQS
FT                   EPPVDIMSQFLHMVNFPHDTSSRPEQLGRQEPPASMQALYAADVTCSGGASVKNEECSA
FT                   QANKAMEFNQPGAADGTNISLLKSGLGTMVGRSVTDMSSQHPKSEDWKQSGATVGDMHA
FT                   GQWTSDAYLDNDGGFNHVVGGGLGIKDDFFS"
FT   CDS_pept        join(complement(696854..696893),complement(696763..696802),
FT                   complement(696589..696697),complement(696461..696520),
FT                   complement(696266..696406),complement(696157..696213),
FT                   complement(695934..696028),complement(695488..695884),
FT                   complement(695390..695437))
FT                   /codon_start=1
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789560"
FT                   /locus_tag="CNG02440"
FT                   /product="Ribose-phosphate diphosphokinase, putative "
FT                   /function="kinase activity"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="AAW44665.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG247648"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI00004B4930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX8"
FT                   /transl_table=1
FT                   /translation="MASAAYSTIKLFSGSSHPELAALIAKRLRIPLARANISQPPSGET
FT                   KVTIVESVRDCDVYILNTGAGAVNTNLMELCIMIHACKIASARRITAIIPHFPYARQDK
FT                   KDKSRAPITAKLVANMLREAGCDHVITMDLHASQIQGFFDVPVDKLYAEPSMIQYMRNN
FT                   IDVHDCVIVSPDAGGAKRATSIADRLNVEFALFHKERKKANEVSRMVLVGSVTGKIAIL
FT                   VDDMADTCGTLGLAAKNLLEAGATKVYAFATHGILSGNALKVISESGMEKLIITNTIPQ
FT                   SENCEKCEKIEVIDVSRVLAEVIRRSHFGESVSYLFHEVPYSNGVGA"
FT   CDS_pept        join(698355..698431,698560..698644)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636895"
FT                   /locus_tag="CNG02450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44667.1"
FT                   /db_xref="HOGENOM:HBG177309"
FT                   /db_xref="UniParc:UPI00004B4931"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX7"
FT                   /transl_table=1
FT                   /translation="MPTMQNNHHLVDVSYFRRSVKTYRIAQQEDQEDDLTDAADGPEER
FT                   ENSDANFY"
FT   CDS_pept        join(699753..700338,700444..700561,700627..701389,
FT                   701439..701879,701932..702336)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789561"
FT                   /locus_tag="CNG02460"
FT                   /product="Cytoplasm protein, putative "
FT                   /protein_id="AAW44669.1"
FT                   /db_xref="HOGENOM:HBG068324"
FT                   /db_xref="HOGENOM:HBG177310"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI00004B4932"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX6"
FT                   /transl_table=1
FT                   /translation="MRVARSTNLLPVTTFLISSVFLSIVLPTRTAASPSPAVDKRLEFL
FT                   LARHDGEDDSMDMDVDEVNASTEDTPAVDDAMASASISSAITSSSEASTPNSSAPSHEH
FT                   SHESHGAEKAPDPHSHSHSAALEILNDTDIHRWHQFPPTYLDADFRLDADSAIFGEEFD
FT                   DSWNLEEVESHKGLALVHAFLMGLAYFGVLPVALALRAADHPAHYLASIASLTIAVLGW
FT                   LAGAAYNAATPNYYEGAIYPKFVNILLLTSICFTVFDSLELIKRGIAFYRRHDRTWKGF
FT                   YNDVLRSPGSISDEKWPATRYEMVGLTDIDSDEEIGRDRDRDDHIMFAIGDNEDNEHHV
FT                   AEPEHMDSTGEIHHTHESQGFDEHEIARSLLKGSKPRRPSIVIRQFSSPSRTSTGSEGT
FT                   LQDTPHSSSSSSRGFPHKASQLGAYDAHSSHREDRHDAMRAHSDEQNNRIWRSAQAKGP
FT                   LRALEVVLTWVRRTQIIFAYVTMLAGIVTYTGMCRAGLINSCAAHYIKGSIFFWYGVLT
FT                   FARYLGAYADLGWAWNRRPSQNSVSAEMVECAVIFTYGITNTWMERFGAAPGSPYTVKQ
FT                   VQHISIAVMFWFAGLSGMFLESRWVRRVLASVMSTGRSSTEEPATYAFSFNPLPALTIG
FT                   VTGLAMAAHHQTYVFQVQIHSLWGILLAGGSLFRCLTYIFLHVSPPVHSALPSRPPTEI
FT                   LTSFGWAAGGIVFMLSNEEICWSAMRAGWDDMMAFLNFTIALTCFVFCWAVVIMAIKGW
FT                   ATMRIRKEEERQEGVSV"
FT   CDS_pept        join(702938..703020,703076..703294,703342..703443,
FT                   703498..703693,703743..704069,704127..704243)
FT                   /codon_start=1
FT                   /gene_family="HOG000224155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807700"
FT                   /locus_tag="CNG02470"
FT                   /product="Activator 1 40 kDa subunit, putative "
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="AAW44676.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000042E7E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX5"
FT                   /transl_table=1
FT                   /translation="MASGSSSNNKLISATAKHTDAEGYEMPWVEKYRPVLLDDIVGNSD
FT                   TVDRLKVIAEDGNVPHIIISGMPGIGKTTSIHCLAHALLGEAYKEGVLELNASDERGID
FT                   VVRNKIKSFAQRKVTLPPGRHKIIILDEADSMTAGAQQALRRTMEIYSNTTRFALACNM
FT                   SNKIIEPIQSRCAILRYSKLNDAEVLKRLKEICDMESIKHNDEGLAALIFTAEGDMRQA
FT                   INNLQSTWSGFGFVNQDNVFKICDQPHPIVIRQMIKDCQHGKIDEALARVNALWDQGYS
FT                   AVDIVVTVFRVVKGMEELPEYLKLEFIREIGWTHMRVLEGVGTLVQLGAMIARLSKFTL
FT                   PPNALKI"
FT   CDS_pept        join(complement(705842..706088),complement(705614..705798),
FT                   complement(705329..705559),complement(704348..705265))
FT                   /codon_start=1
FT                   /gene_family="HOG000282409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789562"
FT                   /locus_tag="CNG02480"
FT                   /product="Phosphatidylserine decarboxylase 1, putative "
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="AAW44678.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG070304"
FT                   /db_xref="HOGENOM:HBG395511"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="UniParc:UPI000042C63F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX3"
FT                   /transl_table=1
FT                   /translation="MFLPQYGRVLKRSVNVPYRHPARAPICAGFRRETVAAARLFVRSN
FT                   STKPPKFEPSDFKAEPRNPGSTKNAENHQSSKGKTLNEKVAQAWSTPTKWYPIPIALGA
FT                   LVLLAVQYRKQTRGEIEVETQGPEGAVIRRSGNRVDGPWQVRVMGALPLRSLSQLWGYL
FT                   NGLVLPVWFRPFGFKLYAKIFGCNLDEVPKDLTEYESLGDFFYRELKDGVRPIAEAPMV
FT                   SPADGRVLHFGEIAGERVEQVKGITYSLEALLGSQSDLHGQPIDIPRSNSEAEVVDDEH
FT                   FAKINDIPYSLTALLGQGPSRKRAQADYSEAQPVGKIEDASHPPEGQAVGHDASVAASL
FT                   GTSALDSKTDGSTKLPSLSEHSKLFFLVIYLAPGDYHRFHSPTTWIVERRRHFTGDLFS
FT                   VSPYIANRMKDLFVLNERVALLGRWKYGFYSMIPVGATNVGSIKVNFDEALRTNTRVLT
FT                   HPPKTYAEATYNSASILKGQPLLAGEEMGGFRLGSTIVLVFEAPEKWKFHLKAGESVKV
FT                   GQPLGAFEE"
FT   CDS_pept        join(706390..706458,706516..706581,706633..707004,
FT                   707062..708066)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789563"
FT                   /locus_tag="CNG02490"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44681.1"
FT                   /db_xref="HOGENOM:HBG068323"
FT                   /db_xref="HOGENOM:HBG177312"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniParc:UPI00004B4934"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX2"
FT                   /transl_table=1
FT                   /translation="MSTNLQPIVAFLKRTYPLPSVDPKWVRQCVDALVEAGREPSIENV
FT                   HIEFLYSDLSLCTRESPTFPEGELHDMIIFPKPTLLQIHAISEIGHSAYQIQTVMEQRS
FT                   EVLSGRTRIRGLDDDEENEVEEGKVPPYPRGMLRLEVGDGRRIVRAMEYKRINDFVLGQ
FT                   TSLGSKIVVQNVRVLRGILLLTPENCRFLPDSCVQELEDLQRDQFVRDLQRRLGKLNPD
FT                   GEGDGLVNPPPVIPPPVRGPGVRAPKPARNAPRQPTRASAAQPVRATLQTPVPLDRHVS
FT                   KHPVPSNAVAGPSNGRMERQAAVVEDDDLGGFNDFDESFLRQVDEAESRAYAMQANSVS
FT                   RSAPVEVDPYESDDDDFMILDESMIRQLDYAEAQAKQRQTSSAITETKSVSTQKRRSTA
FT                   DEIDDLEDDEFEFNESFIRQVDEAEALALASSSFTKKTTGKGAASSSTTRSATTSAVTD
FT                   VIRKGAVQSTKDVVWKRTFSTDISSDVEVDSQKENRVPEIIEISD"
FT   CDS_pept        join(complement(709663..709987),complement(708999..709612),
FT                   complement(708594..708943),complement(708484..708544),
FT                   complement(708263..708433))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093630"
FT                   /locus_tag="CNG02500"
FT                   /product="PHD-finger protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44684.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068322"
FT                   /db_xref="HOGENOM:HBG177313"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00004B4935"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX1"
FT                   /transl_table=1
FT                   /translation="MPRQPPAKRARLSTRAISSTSEQPEVGPSRSVNDESPTKLDKGKG
FT                   KAEATTTQTQEKQGKQSEGEMDATEELEAWQDFAADHYETVEQLPLELHRNFRLLRELD
FT                   DGTLAQMDTLKKLIRTYVSGRIALEQPRSLSTPLEEAALKKSNREEDSIDAERAEETLS
FT                   HHDSPQEGEEGVNPASEITAEPANSGEPSLNPSLTDEKQKEPGVPLADGAGGLIIPCSP
FT                   ESQTRVPARAKFPSLPSSPTARHNGAIENDDPNIDSLARAAAQQNRSSSIPLRASRPAG
FT                   PHSLLPEISRLAREIVRTSDEKVAVAIGAYNAVDRHIRALDSALTAQEASILLGLRPST
FT                   LPSNAIDEALDLEGSTGKAGTGQLVDGRSRGQGTGDGVGEGDEREVTLGIGGGGSRKKG
FT                   KKRKGKPKQREYQDGNEEGKVEENWNIPPDPNEPRYCYCNRVSFGEMIGCDNDECPLEW
FT                   FHLQCLGFENPPTGKWLCDLCKPKTNGHGAGTSAGAARRSRVSGGRKR"
FT   CDS_pept        join(710832..711014,711069..711330,711389..711503,
FT                   711550..711819,711881..712394)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807701"
FT                   /locus_tag="CNG02510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44686.1"
FT                   /db_xref="HOGENOM:HBG068321"
FT                   /db_xref="HOGENOM:HBG177314"
FT                   /db_xref="UniParc:UPI00004B4936"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDX0"
FT                   /transl_table=1
FT                   /translation="MRLSTTLPLILFPTLTLAHADRIHPAHRRHLARSGSGGYGKRAPA
FT                   LLDDLSGLLDGDSGSTSSAASSTSTTSSAPSSSSSSQSSVTPTSTAVTTTSRDEVTSTS
FT                   VASSSLPSTSSASPTSTSTTSTEVSSFTAGPSENVTSSTASSFDPTSTASSSSTEQSLA
FT                   PSATSTTSTSSVAAESTVSPSTSASVQYTTDAAGQTQLVTVILTQSVDDATRSADAATA
FT                   SATSTAATQSGGNKFPTGAIIGICVGVGAAILALIALAVWRMKRRGGEEDEAIRWPELN
FT                   RHGDSDAHHALPARATGQHGFETNPLERSLSSSSELQYADYPVASHPDYDLPQHSPMPM
FT                   ALNGSSFGASSSLEDDYALSEKYPPASPHPPSHDDHDNYTSMPPPVQSQASVGLGMGGA
FT                   IFGHATTPEEEDPYGGVQMTQLDHGVTYQGMTSPEYGHQPMPNPHDYR"
FT   CDS_pept        join(714093..714923,714961..715176,715214..715350,
FT                   715393..715722,715761..715903,715961..716185,
FT                   716225..716381,716431..716496,716538..716688,
FT                   716731..717082,717138..717283,717335..717424)
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807702"
FT                   /locus_tag="CNG02520"
FT                   /product="Chitin synthase 2, CHS2 "
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="AAW44688.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI000042DE5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW9"
FT                   /transl_table=1
FT                   /translation="MAYHYSHDSSRRQPQGGYNYPSNYSNPSQYSIPDSVYSGHSTNTQ
FT                   PVPSPGGYHPQPSSTTRVVQPAYYQPQPTASSMTSHDVMYGRPSPGPNQYGAAPRDVFR
FT                   GPGATTVPPPQQTPYQPYPDQPYPSHTDYSDENKSFSSTTHLVSPQKEWGVGTVVPVTT
FT                   IPPVNQPPYQPYQAYPPQPSPSPTTPRGGTSHWHAMRKQLLERRVIKQIPLHNGNLVMD
FT                   VPVPKGAIPSTKGLGVMDGEMDSMRYSAATCDPDDFMRSKFSLRQYLYGRKTELFIVMT
FT                   MYNENSELLLRTLNAVIKNIAHLTTRTRSKTWGPDSWKKVVVCIVADGRKVVDPRVLKV
FT                   LQLMGVYAEGVMKDHVVDKETQAHIFEYTSQVVVSETGEVGFGSTPVQILFCLKEQNKK
FT                   KLNSHRWFFNAFGPLIKPNVCVLLDVGTKPSGHSIYELYKCFEKHPTVGGACGEIFADT
FT                   GKWGKYLWNPLVAGQNFEYKMSNILDKPFESVFGLISVLPGAFSAYRYDAVANHADGTG
FT                   PLAAYFRGELMNQPGATATIFDRNKFLAEDRILAFEIVVKKNARWRLQYVKAAKAGTDV
FT                   PATVPEFISQRRRWLNGSIFAATYAMVCFWRIWTSGHGIFRKFNLTILTVYNLVNLLFN
FT                   WLSVSSFYLAFFFLISSSISGSSDPFNGAGDEIFQVFNKVYIALIFVVLVCSLGNRPQG
FT                   SNYMYTFCIFMFAVCQGILLYCAGWTVYQAVPHTSEGWEDVSGLFDNKTFVQLALALMA
FT                   TYGLYLISSLLYFEPWHMLTSFIQYLLLLPSYVNILLIYAMCNLHDVSWGTKGDNGSSK
FT                   DLGTAKKVEKDGKEMAEVALPTKQEDVEALWQQARQELRVPVKEKTEKRSPETKRADED
FT                   RNFRTNVVLLFLGSNMLVILLFTSSTFTNWVNSHFVDATSSTFNPYLTVIFYAVLGLSA
FT                   LRFAGCLLYLIFRMFGY"
FT   CDS_pept        join(complement(720591..720629),complement(720510..720552),
FT                   complement(720381..720457),complement(720319..720338),
FT                   complement(720142..720270),complement(719990..720082),
FT                   complement(719776..719951),complement(719539..719724),
FT                   complement(719123..719490),complement(718587..719064),
FT                   complement(718523..718535),complement(718370..718466),
FT                   complement(718132..718319),complement(717977..718079),
FT                   complement(717849..717911),complement(717775..717795))
FT                   /codon_start=1
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942698"
FT                   /locus_tag="CNG02530"
FT                   /product="Bud site selection-related protein, putative "
FT                   /function="binding"
FT                   /protein_id="AAW44690.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059617"
FT                   /db_xref="HOGENOM:HBG735608"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI000042F388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW8"
FT                   /transl_table=1
FT                   /translation="MSELFKDIPEFVETDIGESLAARTETLGSFRELGPPDLCHVMKVY
FT                   GKPPTQREIGSYHYCSGIEASSSASLAAYLNSLQFSVEDSSAWFGKGSAWKVRSGTYCC
FT                   FNAFSRVDMRVEANIPGGVDAFVVDLHGQRHPATPELWQETYLSAILRAIRYADDASYR
FT                   LAGYRKLDPITTPEAEERFLKAAEALFFKGWQLGSDPEIQVATVVTNHLTSAILKYFSD
FT                   SFRLHRAANLFERMMDKEPEVAALVAKSYIGMNEEIKAVKIMNAALAANPQSYPILHAQ
FT                   VDFLLSKHKYEWAQQVAQQAVNSAPSEFTTWAKLTETYIELGQLDQALLTLNSCPMFTY
FT                   NERDLHRMPTPAKSNMPVKKFIADSNLVDEDSSRENEADIALLRLPAPNLRGTFAKAYS
FT                   LLTLLVSKIGWDELLKIRSSVFVMEEEYRLHKTNVSVDMNGEAGDGASIAGLKRTSSEE
FT                   VNTPSDIPTIRISSESMRTPNTAPGPGFSEKASTHKPALEKPETAQANEDPNSPLGMKS
FT                   EGEQPVSAFSHKRLCERWLDNLFLVLYEDLRVYTIWRAEISHFKTQHMSYRKTGTEWEI
FT                   LGELATRLHHKEEAKDAYQRCLDSKFSAKALMKLLETYANEGDLQKTLTAAVRLTTYHH
FT                   RWYMDASYPSMVAHYLYKVGLIHGHAKLQYTMLSMNLPVGIFEIMQGYMKYGATFNVEG
FT                   SEF"
FT   CDS_pept        join(720793..721003,721042..721088,721151..721285,
FT                   721338..721976,722057..722721,722782..723007)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942699"
FT                   /locus_tag="CNG02540"
FT                   /product="Suppressor of action mutation 2-like protein,
FT                   putative"
FT                   /protein_id="AAW44692.1"
FT                   /db_xref="HOGENOM:HBG068320"
FT                   /db_xref="HOGENOM:HBG177315"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniParc:UPI00004B4937"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW7"
FT                   /transl_table=1
FT                   /translation="MPTLPTPEEAGAHDGQTRPATPAHQVPLETPGAGPSRLATPDPGR
FT                   DLELDIAFERELALDSEDEEQDRENFLRKRNDYLELEQSVKSSNELLHSLEEYLSTFQT
FT                   DLSAVSGQISELQQKSSDIESRLNGRKAVIPALNALLGDITLPPSLVLTLRDTLPSQNS
FT                   DIWLSAIIQLDEKITAIKARSKVRAVKEVEPIIDGLTIKALHVLPPFLLSLIKPLKSAS
FT                   KGLSTNMGVLQTGVLLKYQPFYAFLLKHAPRLAKQVERGYVNAARAFYETGFRRYARAL
FT                   GQIRARTVEKNDLIGVVSSEAAAAVLNGNGTQEGMKQAYERLKFAEVDEGAVVLAYMVD
FT                   DKEFRLPIEALFRSLSLVLMDNASAEFTFIVRFFSRPSSPPAEPRSFLSPESTPLDSPS
FT                   PSSFADLTSEAGRNQTARKRVGMNESNEWLKDAERIWHEVFDSALDYCTGFFQSMIDVP
FT                   PPAIPLLTVIRLNDHLLATCDARGTLPLIPYLTGQKLAMWPIFRKEMDQHIESLKKLAD
FT                   DAEGKGLAGFMGRGVKDGAVRQVASRYAGLFTCVTALSEEADEAMLFSSMARLRAELVR
FT                   LTHLQSLKIKSPAERHSFLSSIYEIVMHELVSGPGQTTHPRLQSELSFFRTREEEARRR
FT                   ISDAQ"
FT   CDS_pept        join(complement(723635..723777),complement(723418..723580),
FT                   complement(723251..723356),complement(723126..723199))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093631"
FT                   /locus_tag="CNG02550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44694.1"
FT                   /db_xref="HOGENOM:HBG177316"
FT                   /db_xref="UniParc:UPI00004B4938"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW6"
FT                   /transl_table=1
FT                   /translation="MSADKETTAAVAEATSVETPAPAAAAKEAEVGEKRKAEEAPEGDA
FT                   EKKTKTDEAADKKGKGRSTEEAEPEAEGGAEAELEEDDLDNLIVTGKRNRKKVDYSKAE
FT                   AWKAADLDPDAPEDEDEEDEDIDAPESPEDDEEFNDEDVAAAAPEEEDEDEDDDEEK"
FT   CDS_pept        join(724137..724154,724255..724335,724776..724950,
FT                   725010..725116,725171..725249,725302..725855,
FT                   725907..726078,726129..726175)
FT                   /codon_start=1
FT                   /gene_family="HOG000168004" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI15807703"
FT                   /gene_name="UXS1"
FT                   /locus_tag="CNG02560"
FT                   /product="Putative uncharacterized protein "
FT                   /EC_number="4.1.1.35"
FT                   /function="UDP-glucuronate decarboxylase activity "
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="AAW44696.1"
FT                   /db_xref="EMBL:AAK59981.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0048040"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021761"
FT                   /db_xref="UniParc:UPI000006C8EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q96V00"
FT                   /transl_table=1
FT                   /translation="MSSEKPETITHVGCNRFGFDSTVDIETLRSLYLSPAYIKEGGDVK
FT                   VSLDAPQKDFSTETTYDHNTNTIQYSTVNKFPPVKLLPNHERKRILVTGGAGFVGSHLV
FT                   DRLMLLGHEVTVLDNFFTGSRTTVSHWIGHPNFEMVRHDVVEPFLIEVDQIYHLACPAS
FT                   PPHYQINAVKTLKTSFEGTLNMLGLAKRTGARFLITSTSEVYGDPEEHPQREDYWGHVN
FT                   CIGPRACYDEGKRVAETLTYGYHRKDGVEVRVARIFNTFGPRMNPYDGRVVSNFIIQAL
FT                   KGEDMTVYGDGSQTRSFQYVHDLIDGLILLMNGPDTRPVNIGNGDEFTILEFAEAVRDI
FT                   VEKVQKEEGNPLAKRVNIIHKEIPIDDPQRRRPDTTRAKESLQWQPRWNVRQGVEEMVR
FT                   YYSARIREGAI"
FT   CDS_pept        join(726462..727120,727179..727251,727324..727436,
FT                   727534..727700,727753..727833,727889..728000,
FT                   728070..728750,728814..729030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807704"
FT                   /locus_tag="CNG02570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44698.1"
FT                   /db_xref="HOGENOM:HBG068318"
FT                   /db_xref="HOGENOM:HBG177318"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI00004B4939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW4"
FT                   /transl_table=1
FT                   /translation="MSPPPTSPTITEPLPDTLLPPNPAPHPDETLAPEKPSMINLATPA
FT                   PLPRPSTLTIPNAPAQNPPAKGVPACTPAANATPSAGRRDGDAESGGVKGIDLSEFDPY
FT                   ATTPGPSIAANGKKRDGTVEDEPEPLESLQEKQDANANVRIEQGVDMAPTGSSQDAAAR
FT                   QPSEREQASNRPATPGTSTEGDQEASDKDKEPVFNFQGFLKDLKLKSAEPVARYLKSFL
FT                   SNFVKKPFTVNEQIKLIHDFLAFISEKMVQVEPWKSQSSAEFDNALEAMEKLVMNRLYN
FT                   YTFTPELVPSQPITTDDLERDRVFSQRVRLFGWIREKHLDVPEGEAAQGFLGFAEQAEL
FT                   LKINHYKAPRDKMICILNCCKVIFGLIRNVYGAETGGADAFVPILIFVVLRANPENLIS
FT                   NLEYIQRFRSHSKLQGEAAYYLSSISGAIQFIETMDASSLSNITQPEFESNVENAIQNL
FT                   PPSPSSEKKGGTLQPLHSSFRTPGKDQGRERERDSKLISPFSAATPGEEAARPLSMASA
FT                   QASLEGTRKWFARTGNLAQEAVSKPLNAIGKILEGMSPADTRQGSEDGSDDEGSAQGGR
FT                   VPTTTTTAETSVRGGGPGGVFPRDVFGSRRFRAVTPESPSRRPAFGDEGISRTGTPSSD
FT                   ILPDFSALQIQSTIDASQETFAQTRHANVQTLHQMFPALDEEIVEAVLEGCNDDLGLAI
FT                   DRLLEM"
FT   CDS_pept        join(complement(730609..730762),complement(730346..730567),
FT                   complement(729969..730296),complement(729781..729909),
FT                   complement(729315..729726),complement(729223..729264))
FT                   /codon_start=1
FT                   /gene_family="HOG000283479" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807705"
FT                   /locus_tag="CNG02580"
FT                   /product="Mannose-1-phosphate guanylyltransferase, putative"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="AAW44700.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG495575"
FT                   /db_xref="HOGENOM:HBG688195"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI00004B493A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW3"
FT                   /transl_table=1
FT                   /translation="MSSCLPVTLTRTRTRTRTLTLTLHPAMPSTKGVILVGGPSKGTRM
FT                   RPLTLDCPKPLLPVAGKPMIWHPLQALSKVPDLTEVIIIGFYDDSQMAAFVKEAKREFP
FT                   NIAISYLREYKALGTAGGLYHFRDSILRPPVPQHIFICNIDICCSFPFAEMLELHTSHG
FT                   GTGTIMGVNVKKETATQYGCIVTDPETNQMVHYVEKPEGWISNIVNGGVYLFDKSLFDV
FT                   IKVAMDEKTARAAEDPLVKPDEILRLEQDVIVPLAAARKMYVYQTHDFWRQIKTAASAV
FT                   TATALYLSNYKLTNPSLLAPAAPNIIAPTFIDPSATIDPSAKIGPNVAIGPNVTVGPGV
FT                   RIKDAIVLEGSTLEKHSCALNSIVGTNSHIGAWSRVDGEQEFEREVKGKISVTILASEV
FT                   SLAPETMVRSCIVLPNKTLTKNATNQVLL"
FT   CDS_pept        join(731053..731178,731236..732265,732430..733865,
FT                   733933..734502)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789564"
FT                   /locus_tag="CNG02590"
FT                   /product="Phospholipid binding protein, putative "
FT                   /protein_id="AAW44703.1"
FT                   /db_xref="HOGENOM:HBG068317"
FT                   /db_xref="HOGENOM:HBG177319"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI00004B493B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW2"
FT                   /transl_table=1
FT                   /translation="MALTVRAIHTFVAEHGDELDFQAGDHIVVLEKDEAFGDGWWRGRN
FT                   PKGEEGLFPATYISESPPTPPEPASPATPETPAAAAPAGTPAVLAENPVNGKQPSVHTQ
FT                   TPPAAIPTPTPTPPRPQADDPTPGAWPADNNNLAVPEIAIPNESPKGTTDAQGGILESA
FT                   TATAGAAAANVGNVMNRTIGDIQDAIESYARPESDDEHEHEELGIGQDARAKLVEQARL
FT                   ANEKRERDETGFVYSDESEDEEEDFGKSLPLVTKSRTSIGTESQDVNGFHENVVKEEPV
FT                   TFESIDTEPVALIPAPVVASSTAAATAAAPSAAAAAPATAPAPAEPELTPLVPTSSDQR
FT                   EPSVGTLQPAFVPATPPLVQTPTSQGATTPTPFAQNAAPPSSTSNQHEISGDVLLELDA
FT                   NLLKELDIPAFGKRMRIAAAITELRRPSSMVSSSSQQFSPSGLPTHMSPGVSVRGMSAP
FT                   PSSYSVGAAGQPFPSTPPLSTPPMPSHSEESGAYSVWAHQPRKHSGGAHAAPLVMESIN
FT                   ENHSQARSSSQPQPQTQSQPQLAADKTASNRSSQPPPSSNTAPSSVRASTNTAASTPVS
FT                   PITPGASSTVTKRDSLGSLGHKRGKPSGDSKDRLSFFGRNRKPPAPLAGGGTGAVSPTT
FT                   GEHQQATKSSSSRLGFGSSKVHQMQPASPQNKRVSGPTPATGGGGAAASMNGGGALKQI
FT                   GTPDHAGYLKKKGERYGGWKSRYVVLKGSTLYILKSENADSLKDRIDLLHTHRIMADEN
FT                   ANPGSYGFRLAPSSHGTAAPAPAASASAKSHTFSSSEQTVVRGWMKALLKATIARDYTK
FT                   PITSSCNIPTIPLAEAQALAPRPPSPTTRAAMQRATRRENPNQLTPHDANILMSLDTSS
FT                   GEKRRASQNLGVAGASPARPSRDMRRPSSNFSQNTQKPASGATAAPLGAVAVPSSDRAP
FT                   SDISTSEAPQLLEWVNTHLPATYPRATALPQSFISGEVIFLLVKSLSGIEPSPPVAPGA
FT                   FNPETDGQPGLDGLIAMMDMLVDAGVKIDGISINEVRVGDTNGVVRLLKSVQDWHGSGQ
FT                   AGAQS"
FT   CDS_pept        734868..735713
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807706"
FT                   /locus_tag="CNG02600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44705.1"
FT                   /db_xref="HOGENOM:HBG068316"
FT                   /db_xref="HOGENOM:HBG177320"
FT                   /db_xref="UniParc:UPI00004B493C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW1"
FT                   /transl_table=1
FT                   /translation="MAQTFLSGFHSFPPDIQQKVYDLVCQTPTPLGLIQTCRSLYNTHV
FT                   HHLYRDVVLDRKNAAKFFYPILHAVGSDEDEDEMPTVDWDDDDDPPERWPRKERQQVFQ
FT                   LDRSDPPPVHIALFRPTARKLLLLNEISSITFLDEEAVYQTERAALFYYKMMSSYASLK
FT                   AIASCGGYVQEVLFLLADRIVFGADVVAKYMEYGQGPRRGGGWEEKVRNLSYAFRGPTS
FT                   VRVEIPEDMEEEEETGEAEMCMNRALIYLGCIELERRVTSSVKGPEPGRKTRLQQGGVV
FT                   "
FT   CDS_pept        join(complement(737670..737682),complement(737597..737622),
FT                   complement(737378..737537),complement(737253..737320),
FT                   complement(737067..737197),complement(736843..736987),
FT                   complement(736338..736772),complement(736047..736280),
FT                   complement(735872..735967))
FT                   /codon_start=1
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942700"
FT                   /locus_tag="CNG02610"
FT                   /product="Clathrin assembly protein AP47, putative "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="AAW44707.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG058183"
FT                   /db_xref="HOGENOM:HBG525531"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00004B493D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDW0"
FT                   /transl_table=1
FT                   /translation="MASLVAILDVKGKSLIQRSYRDDVPTSYIERFLPLILEMEEDNVP
FT                   VTPCFSDEGVNYMHIRHNNLYLLALSKKNSNAVEVIFFLHRLCSVLTEYFKELEEESIR
FT                   DNFVIIYELLDEMMDFGYPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSWRSEGI
FT                   RYRKNEVFLDVVESVNLLVNASGNVIRSEILGAVKMKCYLSGMPELRLGLNDKVMFETT
FT                   GRAARGKSIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLSTPVKPLVFVEA
FT                   SVESHRGSRVEYMVKIKGQFKRRSTANNVEIYVPVPDDADSPKFRASVGSVVYAPEKSA
FT                   FVWKIKQLAGGRDYLMRAHFGLPSVRNEELDKRAPISVKFEIPYFTVSGIQVRYLKIVE
FT                   KSGYKALPWVRYITQNGDDYVLRTITDAKTAPLMGV"
FT   CDS_pept        join(complement(738820..738912),complement(738738..738782),
FT                   complement(738614..738688),complement(738457..738562),
FT                   complement(738373..738418),complement(738088..738323),
FT                   complement(738014..738039))
FT                   /codon_start=1
FT                   /gene_family="HOG000175765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807707"
FT                   /locus_tag="CNG02620"
FT                   /product="Rho GDP-dissociation inhibitor 1, putative "
FT                   /function="Rho GDP-dissociation inhibitor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44709.1"
FT                   /db_xref="GO:0005094"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG016290"
FT                   /db_xref="HOGENOM:HBG329264"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00004B493E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV9"
FT                   /transl_table=1
FT                   /translation="MSNQQVRTHTPRSADMQPEDELAPTRTEGYKLGHSKTVAELAALD
FT                   QDDESLQRWKQSLGIAAGASAGGEKRVVLKSLFLSSPTLPSEITIDLTQSKDALAKLKK
FT                   DPVTIKEGVEYSVGITFMIENEIVSGLKYLQVVKRSGITVDKTEAMLGSYGPQPEPFTK
FT                   VFASEESPSGMLARSGTYVVRSRVIDDDNTIWLDFEWGFKLGKEW"
FT   CDS_pept        join(739211..739247,739295..739322,739371..739404,
FT                   739470..739562,739639..739649,739702..739795,7
FT                   39848..740201)
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19789565"
FT                   /locus_tag="CNG02630"
FT                   /product="Rho1 GTPase"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44712.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00004B493F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV8"
FT                   /transl_table=1
FT                   /translation="MSGEIRRKLVIVGDGACGKTCLLIVFSKGMFPEVYVPTVFENYVA
FT                   DVEVDGKKVELALWDTAGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISEV
FT                   LHFCQGLPIVLVACKKDLRDDGKTIQDLARMNQRPVSRAEGMAVAQKIGAQGYVECSAK
FT                   TGEGVREVFQTATRHALQVGLLPLHRRPPLTVRRAKSPSLAEGRRVVWCFRAL"
FT   CDS_pept        join(739211..739247,739295..739322,739371..739404,
FT                   739470..739562,739639..739649,739702..739795,
FT                   739848..740093,740141..740191)
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI15807708"
FT                   /gene_name="CnRHO1"
FT                   /locus_tag="CNG02630"
FT                   /product="CnRho1"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44711.1"
FT                   /db_xref="EMBL:BAA33396.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1A2B"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI000006C8E8"
FT                   /db_xref="UniProtKB/TrEMBL:O74649"
FT                   /transl_table=1
FT                   /translation="MSGEIRRKLVIVGDGACGKTCLLIVFSKGMFPEVYVPTVFENYVA
FT                   DVEVDGKKVELALWDTAGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISEV
FT                   LHFCQGLPIVLVACKKDLRDDGKTIQDLARMNQRPVSRAEGMAVAQKIGAQGYVECSAK
FT                   TGEGVREVFQTATRHALQSKKSKSGRGKKGCVVL"
FT   CDS_pept        join(740595..741072,741123..741439,741486..742679,
FT                   742737..742906,742979..743074,743131..743299,7
FT                   43355..743537)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807709"
FT                   /locus_tag="CNG02640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44714.1"
FT                   /db_xref="HOGENOM:HBG068315"
FT                   /db_xref="HOGENOM:HBG177321"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="UniParc:UPI00004B4940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV6"
FT                   /transl_table=1
FT                   /translation="MSPAPVAPIRQPRGPSTNSFSQAASPPSSTSAGNSGTAAATGPPA
FT                   PDTDSLRRANTVSNPRHQPSASISASSAASSAFHGVPPSAASTSASSSRGVRGVSRFRS
FT                   GSLSNALPDPGLVRRASGREVAKEVVLENEGEGEGIEAASWGKGLGRQSSLPSRRGLSL
FT                   AQAANQGAPEPVPPPRPPRRIAINTTTVSGPTPPVSAHSASHSLSSLSMLHRPTYSSQL
FT                   SQDEPIPSATSGGVSRTQSLRAQAKHSDVGGLGRSISLKAVGEHTYRQSTSQQASSGQS
FT                   SGVISSPSSVAFSPPAPPPVSSTAALPPFQLPLPDSSYVSTTTGGADVKRHQSLTQGYG
FT                   SSSRVRDRLERSPAITLEPREPRDTSGVRVRIDTRFEDEPPTSPIGPSVWSNTLSRTDD
FT                   GWGSAPLNQSARNASQQLQDAFEAMTLGRNMMAPDGNAMLANDFDPRERLSLETDIMRH
FT                   PQPSSNNTLPSGGQGLQRINSGAEEPSWVNKLVGGDSTPMVGNVMPRSSSALGWSERAR
FT                   QNETQRFPYGAYNMPFGNGFNMGLKPQMGQMGMPQMGPVGMNGMPMGMPMGMGPMNMGF
FT                   PMGMNMGFGQMGANGFGQFAPGHPGQAQNQHPGQGYPPPSSSAAPTGHGMGAQDREVIE
FT                   LARKKGLNPATFNCKPQNARFFVIKSYTEEDVQKSLKHEIWSSTVLGNKRLDAAYRETA
FT                   NKGPIYLFFSVNGSRHFCGVAEMTTPVDETKTSKVWAQDKWKGIFEVKWIFVRDVPSAA
FT                   LRHIRLTNTPECKPITNSRDTQELPYEAGTEVLQIFLDHQTKSKTSLLQDFAYYEQLSV
FT                   NRQNQNSPQNGNSQNQQPSSYQQFQQKPGNAIAPPMSNSHSGPTIPPVPAIPDKFR"
FT   CDS_pept        complement(743995..745662)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807710"
FT                   /locus_tag="CNG02650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44621.1"
FT                   /db_xref="HOGENOM:HBG068314"
FT                   /db_xref="HOGENOM:HBG177323"
FT                   /db_xref="UniParc:UPI00004B4941"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV5"
FT                   /transl_table=1
FT                   /translation="MALPGCNDEEDDRQVNFLPGMDVKKPDTARRPTSFITDTDVSNLI
FT                   AQDAFPSFILDAIEVGSIQAGTKAREARLGELSPSQSAAVHPTNIYIARSQQSRSVSDG
FT                   TWQSYNKRPFTQRRASLDAAPSRPPLNFTHTAPPDLPGYAPMARSASLTTAPAGAPPTF
FT                   SKSHPPVLPIAPQRASAFSTSSSKRYRALQSPATSTCRPATPLHSIPETPRDLDVAPEG
FT                   NWTLRRRPGGSSKLRQSRSAPNMKVSKRPVEPEGLKRSLSGLDRRDGSDSKKKYLSVAL
FT                   QMRRGSAPLDTYLAFHNGPVQPIPKTLSRSSSLVRSSHIQSLSKTAPNKPTNIQNSLKA
FT                   EDIPCWPPLVIRPKRSGCQPVPAATLRSETPTASTMREHGTTPEEDAPGTTIPPRPVKS
FT                   RQRIIRAEKKEKRSRVICFPPECTPCLLTPDSDALTFSSILTEGREKEEEDTEDVWQAV
FT                   GEAEKWVWPDPPSKTLTPPRILVTSFTNPFRPEPTVYDNKNDTTPKASRSTIYRGTNGS
FT                   ADLSKIELRLDLAVPMEKEGEGKKFKSWAKGMRRKWRA"
FT   CDS_pept        join(746280..746664,746711..746790)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807711"
FT                   /locus_tag="CNG02660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44869.1"
FT                   /db_xref="HOGENOM:HBG177324"
FT                   /db_xref="UniParc:UPI000042D9DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV4"
FT                   /transl_table=1
FT                   /translation="MSPSSSLSSAGDFSRSSSPFSRAGTPDVEALEAYEQLMASIIPPS
FT                   TLPRPPTPLLTSNLTLSKYEADEDSVMGENGVKRPMTKAEKQNAKKKRRKERERAARME
FT                   AEAAAKAAEDGVEKEQTRAKDSVVEFRLFSSCPIKPVSLLPASEDYPIPL"
FT   CDS_pept        join(747552..747626,747684..747781,747832..747860,
FT                   747909..748265,748316..748380,748429..748725,
FT                   748785..749198,749255..749398)
FT                   /codon_start=1
FT                   /gene_family="HOG000012351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942701"
FT                   /locus_tag="CNG02670"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydroxymethylglutaryl-CoA synthase activity "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="AAW44623.1"
FT                   /db_xref="GO:0004421"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG236384"
FT                   /db_xref="HOGENOM:HBG578402"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniParc:UPI000042FF59"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV3"
FT                   /transl_table=1
FT                   /translation="MSNFDIPARPSNVGILGMEMYFPKRCISEEQLEEFDGVAKGKYTI
FT                   GLGMGHMAFTDDKEDINSVALTVVSSLLKKYNVDPRSIGRLDVGTETLIDKSKSTKTLL
FT                   MNLFAESGNTDIEGIDSKNACYGSTAALFNAVNWIQSESWDGRNAIVMCGDIAIYKEGS
FT                   ARPVGGMGACAMLIGPDAPLVVEPVHGTYMANTWDFYKPDLSAEYPTVDGPLTIAAYLG
FT                   ALDNAYSTYVQKAEASQARAAKKLSLASVTAAVSEVANGIVGAVNGHANGHAETKEDGI
FT                   AKFDYVCLHSPYGKLVQKGHARMFYNDYLRNPSHPAFANVPEDVKSLDKTKTYTDKVIE
FT                   KTFIGIAGDHYKSAVIPGKDCVSRCGNMYTASLYGALASVVSSAPEGIEIGKRIGMYAF
FT                   GSGCAASFYVLKVNGSTKEIADKLNLKARLAAMDVRPCQEYVDALKLREENHNAVKYAP
FT                   QGSLDNIWPGAYYLEGVDDLYRRTYLQKPESAQV"
FT   CDS_pept        join(complement(750726..750865),complement(749956..750295),
FT                   complement(749549..749890))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636896"
FT                   /gene_name="NNT1"
FT                   /locus_tag="CNG02680"
FT                   /product="Putative nicotinamide N-methyltransferase "
FT                   /EC_number="2.1.1.1"
FT                   /function="nicotinamide N-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44624.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008112"
FT                   /db_xref="HOGENOM:HBG177325"
FT                   /db_xref="HOGENOM:HBG397955"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00004B4942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDV2"
FT                   /transl_table=1
FT                   /translation="MRKVKKTGGWREAEYRRYPPVARAFWYRYRSGGNSLPSQKVVLSS
FT                   SPWNTARTLSTYLLETPQITQSRHVLELGAGAGLPSIVCVLAGSSKVIVTDYSDEGLLD
FT                   NLRFNVDVNLEGEEKERIAVDGHVWGQSVDPLLGHLPKGQKYDLLILSDLVFNHSQHDA
FT                   LIKTVEATLTSSSTQSYDPSNPSAPLTEPSILVFFTHHRPHLAHADMAFFPRLAESGNG
FT                   WAYEKVVEEWAGAMFENDPGDKKVRGTVHGWRAWRVRDGEERGEKPSRISL"
FT   CDS_pept        join(750920..750957,751009..751588)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942702"
FT                   /gene_name="CWC21"
FT                   /locus_tag="CNG02690"
FT                   /product="Pre-mRNA-splicing factor CWC21 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAW44625.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG177326"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniParc:UPI000042F387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDV1"
FT                   /transl_table=1
FT                   /translation="MYGNVGLATARGSGTNGYVTRNTAHLRIREGPPGGQPYGSGYDAL
FT                   LESVSKPPIHRAPDQGILEHERKRRVEVKVMELRDELEEKGMEEDDIEEECSKLRQKLT
FT                   AQPEQLGGRGLDTHSLAAAKEIEMSRLQRALGVSVNHEEGRAFKRETEEEKAARLAKRE
FT                   ERERERIEAAITRERENEKRKQEWEEKERLRRREEYKRRRRD"
FT   CDS_pept        join(753843..754714,754760..757039,757093..757153)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807712"
FT                   /locus_tag="CNG02700"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44626.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG068312"
FT                   /db_xref="HOGENOM:HBG177327"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR007567"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniParc:UPI00004B4943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDV0"
FT                   /transl_table=1
FT                   /translation="MFFAALALSLLSTTWAAPGLVYPLQDQLPPVARVGSEFTFDLLPG
FT                   TFNSTSSISYTTSTLPSWLSWDTPTLSFYGTPASSDQGQGVITVTATDSSGSTRSNFTL
FT                   LVTNYSVPGVHQSFYTQIRQPNLHDISSATILPEGTGVSIPPWWSFSLGFQPDTFRLSN
FT                   DNNNNGRLYNGAHVRGTAGLPSWLQFDNETFTFTGVAPGEGTYTVVATGTDFWGYTGAQ
FT                   TSFIIEVGQGESIELAKDYNFTAVQTIAKGKVDYALDLGGILVGNETATKDELNITMVS
FT                   DEYDWLTFNSDTNVLSGIVPDSYQNGTTSPLSIPLNIASSNSSNTLSVIAWISMDIAPY
FT                   FFSTYNLPNSTISPSKGFSFDISPYRTNSSADINATVTPTDAASWLTFHTENLTLEGTA
FT                   PTSPKYNQVSVVFEAVVGNLAATTTLSVNITGISDTTESTGTAAVPTSTGSSTPSHHGG
FT                   LSTGGKIALGVVFGILGLLIILALLWFFCCRRRRNNKNEEEDEKGPRASAPDLGDPFRR
FT                   SYGLAHTQGAPVSTIGYSDTTAVTNRSPASLSSNATAVEKPHRMDGMKGIIHWDENDEE
FT                   HLAQNPDFSQDFVGYPDVIATEDPIDESRADMSSDTRSMMSKSSRASWQSKSTFQWSSG
FT                   EGTGEGSRVFGSQGEDVERASLGAVGGNVRMPTADSIPRPRADFTPKYPRHQSPAMLAR
FT                   LTGDDASSHDSFSEFNSSYDGIRDSFQSGSNFGASSGFDENSMMGTGSVFHTQSQMHSG
FT                   SGSLGFGRSTLSRIGESTGFKSSDTEAESEEPAVVSTAHRTSFDNRQDSPRILTTDRAT
FT                   RDSQATSGMFDDAEEASRRSMIATNTGLGYPNSVIYFGSPQPHIEGLGAELEDGKGYTS
FT                   QRSSNVPSESTARASTIRAVPFRENPLSPSLPQASSFIRHRRTNTASSGSQGSARLVPG
FT                   SNAGVSTGANDGRVYATSNETFSMHPAIHPPPTVSLSAATWSSNPPSTYRAEVEGGGSL
FT                   PTWLHFDARELELWGVPPLRAVGETTTVRILERLPRDARRADPMSFGYEPPQEKEVGRV
FT                   IIEVNDKTKSPQFAFEGSPHAL"
FT   CDS_pept        join(complement(759093..759109),complement(758949..759040),
FT                   complement(758839..758897),complement(758669..758779),
FT                   complement(758345..758606),complement(758273..758298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942703"
FT                   /locus_tag="CNG02710"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44627.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG384598"
FT                   /db_xref="HOGENOM:HBG492790"
FT                   /db_xref="InterPro:IPR007705"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI00004B4944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU9"
FT                   /transl_table=1
FT                   /translation="MDSSPTALFENYDEDLKQLFGSLKSKLDGEAKSLTGEQRKAALKR
FT                   VSEEIDEAEEIVAQMEVELPSMPTSIRQTYQGRLAASKQSLDKIRKTLKDLRLQSQRSD
FT                   LLSGPGFPHGDDPYTDDPEPYSTRSRLLAGTQTLEDGTTRLDNAHRIALETEGVGSEIL
FT                   RNLRGQRDQLENTRDTATCPSGLFY"
FT   CDS_pept        join(759383..759493,759631..759795,759923..760041,
FT                   760227..760322,760374..760446,760510..760569,
FT                   760620..760829,760923..761028,761095..761108,
FT                   761178..761205,761284..761297)
FT                   /codon_start=1
FT                   /gene_family="HOG000234711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807713"
FT                   /locus_tag="CNG02720"
FT                   /product="Transcriptional repressor, putative "
FT                   /function="binding"
FT                   /protein_id="AAW44628.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG017984"
FT                   /db_xref="HOGENOM:HBG331109"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00004B4945"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU8"
FT                   /transl_table=1
FT                   /translation="MNFFNRQKTRTPADTVKSLKDNITRLDNAPAGEASRKINEDISRQ
FT                   LSIVKILLSGEGDTEPNPDAVAQVANEVYAQDLLSLMVVHLGKFDFEARKDVCNIYGVL
FT                   LRRQLGSRSPTVDTIATRPDIIFNTLKGYANQDIALNTGMILKEMLRYEPLARILLYSD
FT                   QFYTFPSYIENTSFGISCDALANMKETLTRHKPMVAQYIEANYDRFFNMYNTLILSSNY
FT                   VTKRQSLKLLGEILLDRANYNIMTRYIASEANLKMMMNFLRDKSRNIQFEAFHVFKVFV
FT                   ANPNKPPQIASILRRNKEKLLVFLREFHNDKDDEQFNDEKQFLIHQIQQL"
FT   CDS_pept        join(761798..762390,762475..763366)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093632"
FT                   /locus_tag="CNG02730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44629.1"
FT                   /db_xref="HOGENOM:HBG068311"
FT                   /db_xref="HOGENOM:HBG177328"
FT                   /db_xref="UniParc:UPI00004B4946"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU7"
FT                   /transl_table=1
FT                   /translation="MSQENPPSLLIPPNPSLSQQKPSASILLNGPNRPRGPSSSTAPDT
FT                   ASQRSLSASSFTGSHSPVSSLTSVFSHASGSGEGSGSGDGGFPSPPDFSSSPASSHNSL
FT                   HSHPAKQSGHNYTAPSSPAGFHPSRRASHAKIHFAPLPAVPPEFRRRNSISLGVASRRN
FT                   LIGMQGQGHKGGVQRVVMSDEDWDNYCKQFEEKQGNNDVIDVGQLAKSGAKALWRSVKR
FT                   RRSGSQSSQNSTASTATTASTSASPSTVSDSAPLGRHSLTGTSNSGSTHSLNGPLNGSL
FT                   HLAPVREESEFALKSIPGSPPATTIDDAGLPPMRVRAPVPRRPHSPRHVHAAHAMLHNS
FT                   AMETDMGMGDGDAAMDGDGDATPRRRPSPPPRLADKLPTEDELEQIADEDEEEEAQDAA
FT                   AAAEVEEGEEEMAGAPLSPVAEGASRPEVEPEAEAVAGAGAEAAAPPSPEEQASIESHD
FT                   TESRETHEDRKRGRRSAVLGFDVERFGFMSIHDKNH"
FT   CDS_pept        join(complement(765019..765021),complement(764468..764595),
FT                   complement(764252..764346),complement(764173..764198))
FT                   /codon_start=1
FT                   /gene_family="HOG000224977" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636897"
FT                   /locus_tag="CNG02740"
FT                   /product="40s ribosomal protein s27, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44630.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG034279"
FT                   /db_xref="HOGENOM:HBG392194"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000042CC10"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU6"
FT                   /transl_table=1
FT                   /translation="MVLAIDLINRPASVQARTHKLKKIVPEPNSFFMDVKCPGCFAITT
FT                   VFSHASTVVQCQGCATALCQPTGGKAKLTEGCSFRRKN"
FT   CDS_pept        join(complement(767281..767427),complement(766388..767224),
FT                   complement(765880..766333),complement(765599..765831),
FT                   complement(765400..765543))
FT                   /codon_start=1
FT                   /gene_family="HOG000208955" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789566"
FT                   /locus_tag="CNG02750"
FT                   /product="Cytoplasm protein, putative "
FT                   /protein_id="AAW44631.1"
FT                   /db_xref="HOGENOM:HBG068310"
FT                   /db_xref="HOGENOM:HBG177330"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniParc:UPI00004B4947"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU5"
FT                   /transl_table=1
FT                   /translation="MPPKGSIFRGPNAQHFQLVHRSQQDPLINDPEASQRVLKPMGRGN
FT                   DSRKTEISLAELEATIDKSKIRANEGEAALYGITYDDSAYDYMQHLKPVGGPGGAVESF
FT                   LIAAPSGGSGVASGMKGGKGKFKARADDEMFQLPDSVLPSRQEISVQEARARNEAIPLE
FT                   LQGLQPDMDPHLRQVLEALEDDAFVDDEDDDEGWFNQLVKGGERNEHEEVPWEFAEWGV
FT                   DDSGKPVQRQAEQDGEREETWEDRFKAFKREQARVSEEPSEFDPEEMSEMADTVGSLTS
FT                   NLADMMVRGGKKRHGKRGPSDASGMSMSSSSMFRNQGLRDLDDRFDKIERDYEYDDDEE
FT                   EEEYEDWSDDDGTASIAASNFSVSSRFSLASHASRASTAVPPELSREDFNSIMDDFLEN
FT                   YEVVGRRLRPALGGTTMSGPEKLKVLRSAIEGEGDFKDDNRKRIKEIEKEEMGKGRTKL
FT                   REEKVKIVGEEEQKWDVETILTTRTNTENHPALIRDPTRKIRTVPPPPAPPVQREEESE
FT                   DDSGSETEREGGPRVTVARTKGESAEERKARKAAVKAERSARRAEKKSHKETFSTERKR
FT                   QLKSHNKMVGDGRAADVPAGREGVFALR"
FT   CDS_pept        join(767714..767753,767827..767876,767961..768008,
FT                   768066..768119,768180..768287)
FT                   /codon_start=1
FT                   /gene_family="HOG000115759" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18942704"
FT                   /gene_name="TIM13"
FT                   /locus_tag="CNG02760"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM13"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="AAW44632.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00004B4948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDU4"
FT                   /transl_table=1
FT                   /translation="MSSFFGSGAGSPSNDMTARKEQMKQSIQQELAIANAQQLINKINE
FT                   NCFAKCVTKPSTSLSSSQESCLSQCMTLYMAAFDQVSRSYVARISKERGVAPGL"
FT   CDS_pept        join(complement(769659..769761),complement(769458..769595),
FT                   complement(769220..769400),complement(769032..769163),
FT                   complement(768878..768980),complement(768423..768824))
FT                   /codon_start=1
FT                   /gene_family="HOG000209122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807714"
FT                   /locus_tag="CNG02770"
FT                   /product="rRNA processing-related protein, putative "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="preribosome, small subunit precursor "
FT                   /protein_id="AAW44633.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030688"
FT                   /db_xref="HOGENOM:HBG068309"
FT                   /db_xref="HOGENOM:HBG177331"
FT                   /db_xref="InterPro:IPR010301"
FT                   /db_xref="UniParc:UPI00004B4949"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU3"
FT                   /transl_table=1
FT                   /translation="MPATASRKGKSRAQDTSDDNPEAALPLGKQLVHTDKKVRDKAVTS
FT                   LVNFLSQGGDTEGSSSSYVNLEDKEMAKLWKGLFYCFWMSDKPLVQQGLAAELAELLLK
FT                   INPRTNSPGDKFKASLAFLEGFWDSIVREWAGIDRLRMDKYYLLMRRYVNATFRLLARE
FT                   KWEKEAIEAVNSILMKEGGAMTWEDRRVPTSISTHLSDIYLDELNKVLGLPEVDFQPAC
FT                   PIAAVLQPHITLLARTPLSTIHTRIMSSVFTPLLNSLALASSSPDQYDERPAKRSKKSI
FT                   DDEPMYAHIVMHSCAGEGGKQGRNSAEQLRNAVLKAMFNAAANPKSTEPNRRKIYKVWR
FT                   EEGGDDDDEDDE"
FT   CDS_pept        join(complement(773414..773572),complement(773286..773368),
FT                   complement(773179..773235),complement(773111..773132),
FT                   complement(772843..773064),complement(772620..772796),
FT                   complement(772314..772573),complement(772136..772265),
FT                   complement(771736..772089),complement(771071..771688),
FT                   complement(770703..771016),complement(770496..770655),
FT                   complement(770138..770440))
FT                   /codon_start=1
FT                   /gene_family="HOG000207417" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636898"
FT                   /locus_tag="CNG02780"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="AAW44634.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG314776"
FT                   /db_xref="HOGENOM:HBG324649"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011710"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016460"
FT                   /db_xref="UniParc:UPI000042F43A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU2"
FT                   /transl_table=1
FT                   /translation="MATNAPCYTIVHDDLLDSPSTNDLRNALQKGSDEVKLETMRTIIV
FT                   GTLNGQSYASLLMPIIQYVMPSRSKQLKKMLHFYWEVCPKLDENGKLKQEMILVVNAIR
FT                   NDLQHPNEYIRGATLRYLQKVRESELLEPLVPTVRQCLEHRHSFVRKNAVFAVYTIYQD
FT                   HEHLIPDAPELLDTFLAAESDSTCKRNAFVTLCNISQPTAVQYLLNNFDQIESMDELMQ
FT                   MAVIELVRKEARSEGGHRAKWIRCIFELLNSKSHAVKYEAATSLTTLTQNPAAVKAAAA
FT                   ALAELIVKEADNNVKLIVLDRFNNLRAKHENVLDGMVMDILKVLSSPDMEVKRKAIGVA
FT                   LEMVSSRNVEEVVLFLKKQLQGTLDQDFDKNLEYRQLLIQSIHSCAIRFSEVAANVVYV
FT                   LMDFLGDSNNPSAVDVIAFVREVVEKFPKLRTAITEKLISTFGEIKSGKVFRGAMWIVG
FT                   EYCEQPEDIKQAIAAIQKVLGEIPILASEQRLLDEAEAADETPAEQQEQPKAITTTRVL
FT                   ADGTYATETVYTSSASAARLEAVRSASKPPLRSLILGGDFFTGSVLASTLTKLVLRYSE
FT                   VTSSDQQSINILRAQAILIMTSVIRVGQSKFAAVPIDEDAEERIMNCIETLAELQGSKA
FT                   LHQVFLKDTKAAYAKMVATEEKKALEKKERESKVSVVQADDLISFRQLSKKSVVGDVDE
FT                   SDDVVKATGSIHPQDDFVSKLSRITQLTGFSDPVYAETVVTLSQYDIILDVLLVNTTNE
FT                   TLQNLMVDFATLGDLKLVERPAPFTLAPHGFHSLSATVKVSSTETGVIFGAITYSKQGA
FT                   SDADVTIVMSDIHVDIMSFIKPNYVNEAQFRSMWTEFEWENKVAVQTSISDLRAYLDHL
FT                   LKSTHMALLTPEAALSGDCDFLSANLAAKSLFGEDALANASIERTEDGHITGHVRIRSK
FT                   TQGIALSLGDKITLSQKALATA"
FT   CDS_pept        join(773744..773764,773811..773897,774048..774141,
FT                   774455..774525)
FT                   /codon_start=1
FT                   /gene_family="HOG000157483" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581884"
FT                   /locus_tag="CNG02790"
FT                   /product="Expressed protein"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAW44636.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG177332"
FT                   /db_xref="HOGENOM:HBG328835"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniParc:UPI000042EF94"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU1"
FT                   /transl_table=1
FT                   /translation="MATPTVNVVRWSALIAGITYGIFHQSTLQAKYDEDKVKHHAAHRA
FT                   HLVEEAKKAYAAKKAAQSGGSSLITDPEDPKFDLEKVIKSWTKDS"
FT   CDS_pept        join(773997..774141,774455..774525)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581884"
FT                   /locus_tag="CNG02790"
FT                   /product="Expressed protein"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAW44635.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG177332"
FT                   /db_xref="HOGENOM:HBG328835"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniParc:UPI00004B494A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDU1"
FT                   /transl_table=1
FT                   /translation="MHRRSNLNLARKHSTTQVKHHAAHRAHLVEEAKKAYAAKKAAQSG
FT                   GSSLITDPEDPKFDLEKVIKSWTKDS"
FT   CDS_pept        join(774870..774950,775005..775027,775084..775167,
FT                   775223..775383,775440..775668,775718..775792,
FT                   775842..775920,775967..776034,776088..776214,7
FT                   76274..776654)
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807715"
FT                   /gene_name="HAT2"
FT                   /locus_tag="CNG02800"
FT                   /product="Histone acetyltransferase type B subunit 2 "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44637.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI000042E7E2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDT9"
FT                   /transl_table=1
FT                   /translation="MAHNEPITIDDAGDDFDAVEDNQAINEQYKVWKKNTPFLYDTVIT
FT                   HALTWPSLTCQWLPDITDVPDTDYTSQRLIIGTHTSGQANDHLIIAEVLLPKKGAGISD
FT                   KALADLYDEEKQEIGSYTASPARIRAIQTINHAGEVNRARYMPQNPELIATKTVTGEVY
FT                   VFDRTKHESKAPANGECKPDIRLKGQTKEGYGLSWNALKEGHILSASEDTTIGHWDIQG
FT                   YSKQDPSLQPLRLYTGHSAYVADVEWHPKNENMFGSVSDDGQIMIWDTRSDNTAKASSQ
FT                   VQGHNAEINCISFAPSSEYLFLTGSSDNTIALWDLRKLSTKHHSFEAHTNDVLQLSWSP
FT                   TSPVHFASASADRRVHIWDLDAIGAEQTPDDAEDGPPELLFVHGGHTSKVCDISWSPSS
FT                   PWTIASASEDNILQVWEPSRHLRTPYEAEFDEKDLE"
FT   CDS_pept        join(complement(777440..777783),complement(777319..777388),
FT                   complement(777247..777270),complement(776795..777196))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807716"
FT                   /locus_tag="CNG02810"
FT                   /product="Putative uncharacterized protein "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="AAW44638.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG068307"
FT                   /db_xref="HOGENOM:HBG177333"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="UniParc:UPI00004B494B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT8"
FT                   /transl_table=1
FT                   /translation="MMSSSPTSTPHQVPSFLANILLSHISPLDPSSTSSTTFDHHRSPT
FT                   TQNPSHPQALQTAEHPPNPLYLPPPALPKVEEDLVPPENFALVSSGVYRCGFPKKRNFK
FT                   FMETLRLKTVLTLVLEEYPKANLEWCQSQDIQFMQFGIPGNKEPFDNIPEDVICAALVA
FT                   ILDRRNHPILIHCNKGKHRTGCLIGCIRRLQAWSLTSIFDEYRRFSAPKSRAVDQQFID
FT                   LFDIMPVWEAVCRPKGGGLGNLPDWGMLVLPKGVVEVGRDGKEKKRVERDIFHMRGL"
FT   CDS_pept        join(complement(783801..784280),complement(778847..780804),
FT                   complement(778520..778793))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636899"
FT                   /locus_tag="CNG02820"
FT                   /product="Protein phosphatase regulator, putative "
FT                   /protein_id="AAW44639.1"
FT                   /db_xref="HOGENOM:HBG068306"
FT                   /db_xref="HOGENOM:HBG177334"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="UniParc:UPI00004B494C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT7"
FT                   /transl_table=1
FT                   /translation="MNNKEPIEIGHTSALLERFLDIISLSDQNMIEVPYGEAAGMFDLC
FT                   DQFDFDKKIVDKIRQQVIKQGHSNPWELLILGSKLDDKTMGLQALRMMDHDIFIKGKPG
FT                   HKFWATMEELENGWRPKLLDLVFKDPGEIAGAPEPFPHDASRPSIFGSQHASRPLPSLA
FT                   LTADSLHLAAKRGRRTRLFGFTELKDSNQSSPASSAKSSPEGTPQVRPHNLCRASASLS
FT                   SAVTEPKSAQITPASTPSIPLLPPRRHPNTVSNSAPIHVPSRRRDNGLRLNFDGITPIS
FT                   LSSEDVKGVVHTSPYPNVLVRKKSGEILKSALKQNSSDGSVGSVTPFSEAGQPRFETRS
FT                   CPNTPICPKYVHFDTQLERVKLFSHDQKPQVVSRDGLAVREDDGDEFPLGLEAEKVLKM
FT                   SLPNFPTYQDPSSDLYLESLFLSDDRQSIKGVMMCKNIAFQKWVAVRFTFDWWQTTSEV
FT                   TAVHKESVRGGTYDRFLFTIKLGDMLPNIVQKTLFLAIRYNTGGREVWDSNGGQNYRVN
FT                   FIKERPARQPLRGARDTAPIEPGMGKAVGGRSSQWSVTGDQEDRMADLRAKLSMVSEDD
FT                   AGLHVFPNGSRHAYPNRGRKADNPGFTAHDSKATELPGKGVSLAARYDFGAALHTARRN
FT                   SSSSPVGTSSKLSEIKTGLRSSGEESKVGHAASGFYSPKFDQTEVFGDSAFISSEFVSS
FT                   PKAIHVPVLKVESPSPPATEASTPVSRIPSPKPSSLPSQPSLYRTQSAPAKFTIGDPAE
FT                   SNSSEDSPPQLDTSSISTITPPESPMSPSDLGSFGRWSPTTMSSNGSLSSLASYSSLIE
FT                   QFCWAGDPSVSASSQTNYSSGSFDDYFSHSHSGFTTPRAGTPNATPNATSNSSIAYTGG
FT                   SNITPTRNENEPVDNMISDGFVGRTARSPMVF"
FT   CDS_pept        complement(785351..785995)
FT                   /codon_start=1
FT                   /gene_family="HOG000182935" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807717"
FT                   /locus_tag="CNG02830"
FT                   /product="Processing of 20S pre-rRNA-related protein,
FT                   putative"
FT                   /protein_id="AAW44642.1"
FT                   /db_xref="HOGENOM:HBG034966"
FT                   /db_xref="HOGENOM:HBG735086"
FT                   /db_xref="InterPro:IPR019398"
FT                   /db_xref="UniParc:UPI00004B494D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT6"
FT                   /transl_table=1
FT                   /translation="MADATSPTILLFARGTLALLDLWPALTIAVSEQWGGSESAEKKTW
FT                   IASTLIDEFESRATYLPAPVPDSCAPSVAGPAVDPADANDPPLDQDDIIDLLTQIMEDE
FT                   FEARLEDGSIEAVASDIVRLWKGLLTEEKPESIVEALERKANEVRRTGVQVSKGAQNED
FT                   DSSSGEEDDEMEVDGGEAPQLVAREEERREKQEPVVDDDGFTLVQKGGRRR"
FT   CDS_pept        join(791879..792032,792099..792182,792282..792415,
FT                   792474..792613,792666..792737,792791..792947)
FT                   /codon_start=1
FT                   /gene_family="HOG000135995" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942705"
FT                   /locus_tag="CNG02840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44660.1"
FT                   /db_xref="HOGENOM:HBG034373"
FT                   /db_xref="HOGENOM:HBG737258"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007583"
FT                   /db_xref="UniParc:UPI000042C16B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT5"
FT                   /transl_table=1
FT                   /translation="MGQATSSLPSSLPDLALHCLRVADMSPADGLVEPYFDYLIGVQTP
FT                   SINEPTDVLGKILEENEGKQIGLRVYNTKSQRVREASKASGDPNAKPSLLGLSLRVCNP
FT                   AHALESVYHVLDVLEGSPAEMAGLVPWGDYVLAWSGGPLHSENDFYNLIEAHVDKPLRL
FT                   FVYNADLDNLREVVLYPTRQWGGEGLIGCGIGYGLLHRIPRPSTPPSGQASLSGADGYF
FT                   GPDDVRRPSMQGSVSEGGGLAETV"
FT   CDS_pept        join(793365..793367,793449..793524,793585..793615,
FT                   793669..793876,793924..794032,794082..794170,
FT                   794224..794311,794365..794531,794581..794732,
FT                   794782..794819,794870..795312,795369..795518)
FT                   /codon_start=1
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093634"
FT                   /locus_tag="CNG02850"
FT                   /product="Serine/threonine protein kinase MST4, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44662.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000042C718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT4"
FT                   /transl_table=1
FT                   /translation="MSTYSQNNPNNPHADPELFYVRQNRIGKGSFGEVYQGYDKRTSLP
FT                   VAIKIIDLESAEDEIDDIQQEIQILSQLDSEFVTRYHGSFLKGSHLWIIMEYCSGGSCS
FT                   DLMKAGVFKEEYIAILARELLRGLEYLHEEGKLHRDIKAANILLTANGDVKLADFGVSG
FT                   QLTATMTKKNTFVGTPYWMSPEVIKQSGYDHKADIWSLGITCIEMAMGEPPYADLHPMK
FT                   VLFLIPKNPPPQLDDRFSRPFRDFVSLCLQRDPRNRPTAKELLKHKFIKTARKASYLTE
FT                   LIEMYEKWKAEGGAKPADDGVGGMSQEPAYGPAADALWDFGTVRNNLPGTVSRNTGRPL
FT                   PPTNGSVSGPSDSHMSTQSATPTRTKTEEFLPPSLNGRALPTTPSRGTSTSTYVNSPGY
FT                   SQGSSTPTRTRDVRQAMHPTVRGAMVSPRAPAPAPSQVQPPRHHHDEQLEENGDDDVML
FT                   EGVIIPALSNLATRVPNDHARATLDRLRDAFIEAERSIPGVTSAFVLEIVENVEQIEEH
FT                   "
FT   CDS_pept        join(complement(797467..797605),complement(797371..797400),
FT                   complement(797182..797296),complement(796832..797130),
FT                   complement(796637..796782),complement(796488..796584),
FT                   complement(796181..796433),complement(796020..796128),
FT                   complement(795874..795957),complement(795761..795823))
FT                   /codon_start=1
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093635"
FT                   /locus_tag="CNG02860"
FT                   /product="Putative uncharacterized protein "
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAW44664.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG008278"
FT                   /db_xref="HOGENOM:HBG318153"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="UniParc:UPI000042F386"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT3"
FT                   /transl_table=1
FT                   /translation="MSPVAMPEVEGLTISQEKVEKGPEVVEGEEENDDDEGENEEDPST
FT                   GDAKKKKKKKKSKKKKSATVTQSEPPRVGLTKIFKNGVFPVGEEVEYKNDTTSRITSAE
FT                   ARERERLAQEDPSTRYANIRRAGEVHRQVRAYAQKAIKPGMTMTEIANLIEDGTRAVVE
FT                   ENGFESGIGFPTGLSVNEVAAHYTPNPGDKQVLQQHDVMKVDFGVHVNGRIVDSAFTMS
FT                   FEPTWDKLLEAVKDATNTGIREAGIDVRMCDIGEAIQEVMESYEVEVNGKVYPVKSISN
FT                   LNGHSITPYTIHGGIGTRPGKSVPIVKQHGSDKDETKMEEGEYFAIETFGSTGRGRVIE
FT                   EGACSHYALNSAAPEKYQGHHQSAKSLLASVKRNFGTLPFCRRYLDHVGEKNYLLALNT
FT                   LVREDFIADYPPLVDPQPGAMTAQFEHTILLRPTCKEVVSRGDDY"
FT   CDS_pept        join(798957..799044,799091..799164,799219..799350,
FT                   799402..799505,799551..800424,800477..800703,8
FT                   00755..800797)
FT                   /codon_start=1
FT                   /gene_family="HOG000165463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789567"
FT                   /locus_tag="CNG02870"
FT                   /product="Membrane protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44666.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG446824"
FT                   /db_xref="HOGENOM:HBG490015"
FT                   /db_xref="InterPro:IPR005016"
FT                   /db_xref="UniParc:UPI00004B494E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT2"
FT                   /transl_table=1
FT                   /translation="MGALLSIPLLTGGIGTVAGSLFSGCMICMGGTAASAFCKSCNCNS
FT                   SIATRVGFGLIFALSSMLAYLSKTDIAIRQIEKLSWDWIKMDCSKGKCYGLLAVHRFCF
FT                   ALTMFHLVLSAILIGVRSTKAKRAAIQNGWWGPKLLFYFLLCFLAFLIPNEFYMAYGSY
FT                   IAPIGAFFFILIGLVLLVDFAHTWSETCLDNWEHSNSNLWQFILVGSTFGMFVTTITVT
FT                   ILLYVFFAGSGCGTNTFFITFNLILSVIVTIVAISHPVQEANPKSGLTQASMVAAYCTY
FT                   LTASAVVNHTDTQGGKCNPLHARGGTQTTTLVVGALFTFLAIAYSTSRAATQSTALVGK
FT                   GRHEGASYGAVALPHDGEEEGEVRLVTNQPKGRKDEMRYQAILAAVNAGSLPASVLDEP
FT                   EDEDEEIEAAMGEERDDERAGTKYNYSWFHIIFAIAAMYVAGLLTDWAIISTSPVAHPT
FT                   ESQFGAPGIVNEPDVYIGRSETTMWMRIISSWLCYMLYTWSLVGPVLLPDRFGNA"
FT   CDS_pept        join(complement(801750..801962),complement(801568..801702),
FT                   complement(801454..801515),complement(801309..801404),
FT                   complement(801046..801256))
FT                   /codon_start=1
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942706"
FT                   /locus_tag="CNG02880"
FT                   /product="28 kDa golgi snare protein, putative "
FT                   /protein_id="AAW44668.1"
FT                   /db_xref="HOGENOM:HBG338865"
FT                   /db_xref="HOGENOM:HBG382530"
FT                   /db_xref="UniParc:UPI000042D0F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT1"
FT                   /transl_table=1
FT                   /translation="MSTSWDNARRHARALETALDSKLSTYSKLAASIARGSSLGGSSSR
FT                   DELSMEEEGIGGYKLVEEEIEELLSKLEQAIEDLTSLINSPSQPPSTSMQHSAQTHRDN
FT                   LDDYRRDFVRTRNNVEQTIRRSNLLGSVRKDISDYKSGRSGTTDALLQDRSRIDSSHRM
FT                   IDDTLNQAYATREDFAQQRTFLASIDSRMGGVLNQMPGINSLITMIRTRRRRDTVIMGC
FT                   VIGLCVVLLLGYMFGF"
FT   CDS_pept        join(802228..802378,802455..802582,802638..802702,
FT                   802752..802991,803042..803102)
FT                   /codon_start=1
FT                   /gene_family="HOG000160229" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807718"
FT                   /locus_tag="CNG02890"
FT                   /product="ER to Golgi transport-related protein, putative "
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44670.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG334070"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000042DE59"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDT0"
FT                   /transl_table=1
FT                   /translation="MPLSRPPILAAIAIGLLAAAHVSATALTAMLAANDRSCYYADVDG
FT                   LGEKVGFYFAVQSGGNFEIDYVVLDPDDRVILEGQGEKQGDYIFTANKLGEYSFCFENE
FT                   AYTQDKLLDFDIMVESEPRRILPGQQPPLKEHTSALEESTYKISGILNSITRTQKYFHT
FT                   RHHRNYSTVLSTQSRILWFTILECIIIVAMSLLQVWILKTFFSRGGRRYKV"
FT   CDS_pept        join(complement(804866..805002),complement(804653..804812),
FT                   complement(804350..804589),complement(803905..804288),
FT                   complement(803751..803854),complement(803496..803702),
FT                   complement(803198..803438))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636900"
FT                   /locus_tag="CNG02900"
FT                   /product="Chromatin remodeling-related protein, putative "
FT                   /protein_id="AAW44671.1"
FT                   /db_xref="HOGENOM:HBG353348"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI000042EF93"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS9"
FT                   /transl_table=1
FT                   /translation="MSGPQAGPSQPSSAAPQQQSQQPQAPQAQQDLKRRAEVDADAARR
FT                   LKHPRPPLPPPHVLSALVSNSPAFNELMKIEQKLDWTLMRKKAEVNDALGRPTRVKRVL
FT                   RVFISNTAHDQDWQKALDAGAGSVVGGDYSTGPRENPGQDAIMADGGVTKSNEPDLNTG
FT                   KGIAGWILKVEGRLLDSGNVRLDKTKRKFTTFLKSAIIEFDNRDAPTFPEGNIVEWHAT
FT                   SHQGPPLDGFEILRRGDVNIPCRISLHIAHYPERYKVLEPLAGLIGLRESTRSEIMSGL
FT                   WKLVKTTGAQDKEDGTIIKAVGGLQKLLPQGQETVPFHELPEIATRYLAHPDPVVIPYT
FT                   IDVSKDYTFHNKCFDIPIEIEDPLKSKMASMIGSFEGPEGQEIVKLEDKVAELAFFAKE
FT                   LKQKKDFLESFAANPQAFINNWLAAQARDLDQMLGYQIGQAVVNGGSVREEDLRRSDLF
FT                   TMPWVDEAITVHESARMEHDRRAQAASYGNMR"
FT   CDS_pept        join(805719..805999,806053..806474,806510..806697)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807719"
FT                   /gene_name="RRP36"
FT                   /locus_tag="CNG02910"
FT                   /product="rRNA biogenesis protein RRP36 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAW44672.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG068304"
FT                   /db_xref="HOGENOM:HBG177335"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniParc:UPI00004B494F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDS8"
FT                   /transl_table=1
FT                   /translation="MFADLNSLPLSTLAKAQKSLSRKSSSSSSNGRSKEEKLALMKSKL
FT                   AQMQRSKGKAVAVPDTDSHRFGSRAQESDEESDSGPETTSSTKRGSKHAPAALSTKKQV
FT                   SRKRQVIEVPKPERRDPRFSSVSAGHANADLHSKSYSFLPDLLRQEFSGLKEAVAAAKK
FT                   AEKNCPWAEKPMRTAERERLEVQMGQVRTKLVRTEKEAMEREVLAKAKKEEREKRTQGK
FT                   AAWFMKKGESPKCEKKDLLLKARFETLEKQGGKTAVKKLVEKKRKKLASKEKKSRPFAK
FT                   GAEGMGRDTKRRRVA"
FT   CDS_pept        join(complement(807679..807759),complement(807540..807628),
FT                   complement(807413..807479),complement(807017..807232))
FT                   /codon_start=1
FT                   /gene_family="HOG000184343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807720"
FT                   /locus_tag="CNG02920"
FT                   /product="60S ribosomal protein L24 (L30), putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44673.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniParc:UPI000042C63C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS7"
FT                   /transl_table=1
FT                   /translation="MRVDRCDFTGYKVYPSRGKVYVRGDSKTFRFLSAKAESLFLQRKN
FT                   PRKIAWTQVYRRMHKKGITEEVAKKRSRKNVKVQRGIVGADLASILAKRTAKPEVRAAA
FT                   RQAAITKAKTEKRDKEARKAANKPAQANVPKVSKQSMKGGAGKGGR"
FT   CDS_pept        join(810088..810112,810339..810379,810622..810651,
FT                   810714..810767,810825..810902,810959..811022,
FT                   811070..811132,811187..811249,811305..811337,
FT                   811647..811709,811767..811801)
FT                   /codon_start=1
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807722"
FT                   /locus_tag="CNG02940"
FT                   /product="Glycine-rich RNA binding protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW44675.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015465"
FT                   /db_xref="UniParc:UPI00004B4950"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS6"
FT                   /transl_table=1
FT                   /translation="MSASKVYVGNLSWNSTDDTLLQVFSAYGTVTDCIVMKDRETGRSR
FT                   GFGFVTYGSPQEAEAAIAAMNEQELDGRRVRVNMANSRGSGGGGYGGGYNSGYGGGYQQ
FT                   QQGGYQQGGGFNQGYGGGYGGSGYGGGAQGGYGGGYGGQQGGYEQGGYGGNQGFDAQQG
FT                   YGGAAGGYGQQQGGYNGGY"
FT   CDS_pept        join(810088..810112,810339..810379,810622..810651,
FT                   810714..810767,810825..810902,810959..811022,
FT                   811070..811132,811187..811249,811305..811337,8
FT                   11767..811801)
FT                   /codon_start=1
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807721"
FT                   /locus_tag="CNG02940"
FT                   /product="Glycine-rich RNA binding protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW44674.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000042FF57"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS5"
FT                   /transl_table=1
FT                   /translation="MSASKVYVGNLSWNSTDDTLLQVFSAYGTVTDCIVMKDRETGRSR
FT                   GFGFVTYGSPQEAEAAIAAMNEQELDGRRVRVNMANSRGSGGGGYGGGYNSGYGGGYQQ
FT                   QQGGYQQGGGFNQGYGGGYGGSGYGGGAQGGYGGGYGGQQGGYEQGGQQQGGYNGGY"
FT   CDS_pept        join(complement(813458..813572),complement(813212..813392),
FT                   complement(812401..813160))
FT                   /codon_start=1
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807723"
FT                   /locus_tag="CNG02950"
FT                   /product="Putative uncharacterized protein "
FT                   /function="lyase activity"
FT                   /protein_id="AAW44677.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG358848"
FT                   /db_xref="HOGENOM:HBG370502"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00004B4951"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS4"
FT                   /transl_table=1
FT                   /translation="MSSLNGHSNGSKGATHKRVLKPGVWAPIPTFLDDKEELDISTFRK
FT                   HVVDLAKIGMQPVICGSMGEAFQLTDDERVTLFKETRAALDEAGLLDTVVIAGTGANST
FT                   RATINLCHLAASSGADVAIVIPPGYFAGAMTPLALKTFFLEVQASSPIPVMVYNYPGAA
FT                   GGIDLSSDLIEEIAKKGSNICGVKLTCGAVGKLTRISAATATPAFADYPRKSDVAPEFL
FT                   TLGGFADFLAPAVLGGRGHGAIMGLGNIYPRSLARLFELSYKIATDAQPSAQDLKKVLE
FT                   LQDLVSGADASFARAGIAGTKWYLKTHSGYPSARLRHPLLEFTDEQGRALEKEEAVVKL
FT                   MEVEKSLANSQ"
FT   CDS_pept        join(814013..814222,814286..814425,814490..814641,
FT                   814706..815165,815516..815542,815604..815780,
FT                   815836..816232,816286..816374,816425..816464,
FT                   816551..816643,816704..816751)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807724"
FT                   /locus_tag="CNG02960"
FT                   /product="Expressed protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44883.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068302"
FT                   /db_xref="HOGENOM:HBG177336"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00004B4952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS3"
FT                   /transl_table=1
FT                   /translation="MIPSPLPYLLHCNLVSFFPRPEEDIGSQSFTFVRVLYHIGLCFIS
FT                   ALFRMPADAEKRPSNQVCDWCRRQKVKCKELEGVNVDGARHLNLEPTCQRCYRRKERCT
FT                   FTYSPKKPGRPSGVYKRLSRSSRSASPVQPVPTTPLNPIRTMTNIDEILSSGAVVSNDC
FT                   SGADLDSIPTQGSGSVALPIDDQENVNRLALQRAIDGVNNNRTNDLYNALQQCTPKFPF
FT                   PPDHFTNATLPLNMAGWTSHAFRLPDEIRPSGNSTSGTTFFDTPSTAQALAEDDQPQFP
FT                   GNSPSEAAILASLKATNEPESFMPIDVIAPWSDICFFLSFLSMLGSVILDLISTQATQN
FT                   LSSTDMLAAEARRLVYTLRVNQTEPKEGMNLIEREICHRMYWEVVAIEKTLALNGAPIM
FT                   LLEMEGVPPLPLAVDDEYISEESHFPQPFGKRSYMTGFVIVTQIFRLLGQCLQRHRMFL
FT                   CKKDQSTDTESSLRWIEQTLEELDTLTNDVPIIATFDEAQPETWWGIQCANIHITALCV
FT                   QFACIDFRSALSPGYDSPPQRQIIAKTAYDILANIPVECLASNGQSVRGKILRVLLSLL
FT                   SFASDPSDISGHVWDWWNLYHNVHFIQAMPEASE"
FT   CDS_pept        join(821600..821839,821900..821968,822018..822232,
FT                   822292..822456,822517..822602,822659..822968,
FT                   823029..823134,823189..823257,823306..823342,
FT                   823401..823638,823696..823790,823869..824074)
FT                   /codon_start=1
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807725"
FT                   /locus_tag="CNG02980"
FT                   /product="Myo-inositol transporter 2, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44680.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B4953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS2"
FT                   /transl_table=1
FT                   /translation="MENPSGPPKVPTEANREIIVCINTQVSQTEPSSLATYAKQSKMNS
FT                   DEIAPVATLSSSSLPPSEMKAEATSSGLTHEGQLIDEAVIQAENEDKMTPYLVFLIGSA
FT                   ALGGFLYGYDTGVVGIALPYVGTDLGHALSSPEQEIATAATTIGAIFGAAILGYFADKW
FT                   GRKWCLLISDLFFTAGAIIIASSFSLGQLTAGRLVLGVGVGGAAIICPLYITELAPTAV
FT                   RGRCVGTNGFFIPFGQTVSVAIGAGLKDVKYNWRILFGLGVVPSLLQLCLMHKLPESPR
FT                   VLILRGQDDRAREVLKQIYRYASHEVIELKLEIVKAHVQATTVLERSTTWAQRAKKLWC
FT                   HKPYRRSILTVCMIQVFGQFTGYNTLLYYAGTLFGLVGLSNASLGGLIPSITNTFFLLV
FT                   GMLFVDRIGRRGLLMKFGPLMIIGLIWCLIAFYFMCKETGGFLVEGFVYNQRDVGLVIA
FT                   GIVIFVMGFGSTYAHICWYQSEYLALEIRAIGSAISTTASFSANLVVAVSFLSELETLT
FT                   PSGTYGLYLGFVVVGYVLAYYCYPETKGLSIDEAFSLFDDDFGVKKSVKMRREKAEAQK
FT                   RYNAEGGESGQVVDYLGAKPETSHIERVEPVASGL"
FT   CDS_pept        join(complement(828881..828899),complement(828762..828841),
FT                   complement(828488..828712),complement(828228..828429),
FT                   complement(828075..828190),complement(827834..828008),
FT                   complement(827748..827776))
FT                   /codon_start=1
FT                   /gene_family="HOG000138244" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807726"
FT                   /locus_tag="CNG02990"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44682.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068300"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4954"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS1"
FT                   /transl_table=1
FT                   /translation="MKIEGKAFIITGGCGSIGGTAARHILAKGGIVVVFDLLSAEQGTA
FT                   KVKAYHPERAFYIQTSVDDQESVEAACSEALKLIPKGSLFGAVHCAATAPGRKWSNKLK
FT                   DSIQDFAKVLRTNAFGTFVIDACVADAINSQYVDEGPFAPRVSEERGCIINIASAVAHP
FT                   VPARCITYGPTKTAVIGISQGMADFLGPYGIRVNTVSPAVVASSIMGPDRIPYFQSELE
FT                   AGAIFPRRVSEPDEVAIGIVFLLENSMMNDYELRVDGGWRGSSNWAGPQDPRSNALSLE
FT                   "
FT   CDS_pept        join(832430..832502,832562..832934,832974..833077,
FT                   833132..833655,833709..833819)
FT                   /codon_start=1
FT                   /gene_family="HOG000022188" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789568"
FT                   /locus_tag="CNG03000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44685.1"
FT                   /db_xref="HOGENOM:HBG004162"
FT                   /db_xref="HOGENOM:HBG328627"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000042FE8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDS0"
FT                   /transl_table=1
FT                   /translation="MRVQTRTRLLQPFPKQEIERFGTICGQVTNASDYPLSVDVVNNVV
FT                   IYAGDQLRQSLKKGIQVKEDIMAEFHQCLSSGPGILVIRGFVKDLDVIRRTNSVFSDII
FT                   QKEKEHAKGDHFAPAGNNDRIWNSFQKHAVADPSSFVEYYANELLDLVAEAWLGPGYQV
FT                   AAQTNVIRPGGKAQEPHRDYHLGFQSEQVASRFPIASQIASAMLTLQGAVAHSPMPLRS
FT                   GPTQLLPYSQQFDHGYLAYRRPEFVEFFHKYMVQNELEVGDAIFFNPALFHAAGENQTT
FT                   DMYRIGNLLQISACWSKPMETVDRMSIIRAAWSHVQQYIAKAEGGVAASSSQALLKAIC
FT                   DGYSFPTNLDRDPPPADSHCPKTQLDCVTNGLIENWSRERLAEVLDELDWKRRA"
FT   CDS_pept        join(complement(835634..835814),complement(835402..835579),
FT                   complement(835072..835348),complement(834830..835012),
FT                   complement(834512..834772))
FT                   /codon_start=1
FT                   /gene_family="HOG000163182" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807727"
FT                   /locus_tag="CNG03010"
FT                   /product="Inositol oxygenase, putative "
FT                   /EC_number="1.13.99.1"
FT                   /function="inositol oxygenase activity"
FT                   /function="iron ion binding"
FT                   /biological_process="inositol catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44687.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019310"
FT                   /db_xref="GO:0050113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG140922"
FT                   /db_xref="HOGENOM:HBG332059"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniParc:UPI00004B4955"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR9"
FT                   /transl_table=1
FT                   /translation="MRTAPMREDIYKRRPFDWKYLLSTDQKILHSITKTKKHKADNINM
FT                   PVAVTPAAQDFVRVDDPKGTKFDHISDAVDDINVAKLKANDKDNAYDESAFDSEKDKAT
FT                   FRQFVDSNESSRRFYIEQHTKQTVEFNLEARRKAFEKPRAVMGIWEAMELLNTLVDASD
FT                   PDTSATQIQHLLQTSEAMRKDGKPEWMQVTGIIHDLGKLLYFFGSDGQWDVVGDTFVVG
FT                   CEIPTDKIVYSDTFGDNPDLKHPTYSTKYGIYEPNCGLDKVMISWGHDEYLYMVCKEQS
FT                   SLPQAALNMIRYHSFYPWHRERAYTYLESEADKQTLKDVLAFNPYDLYSKSDTLPDPVA
FT                   LRPYYEGLIAKFFPEKINW"
FT   CDS_pept        join(838091..838184,838239..838261,838324..838373,
FT                   838432..838495,838548..838675,838730..838773,
FT                   838826..838891,838940..838965,839019..839449,
FT                   839515..839748,839811..839871,839925..839934,8
FT                   40002..840051)
FT                   /codon_start=1
FT                   /gene_family="HOG000131662" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636901"
FT                   /locus_tag="CNG03020"
FT                   /product="Glutaryl-CoA dehydrogenase, mitochondrial,
FT                   putative"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44689.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG494288"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI00004B4956"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR8"
FT                   /transl_table=1
FT                   /translation="MTAARSISPLLRKVTPSAGTVIAKRGMASTSKFAKYNWEDPLNMN
FT                   SLLSEEELAIHETAKSFSQAQLLPRVTEAYRTENFDPAILREMGELGLLGATIQGYGCA
FT                   GVSSVSYGLIAREIERVDSGYRSAMSVQSSLVMHPINEFGSDAQKDKYLPQLATGEIIG
FT                   CFGLTEPNHGSDPSSMETTATKTSDGWVLNGSKTWISNAPVADLFVIWARVVENGEKGK
FT                   VRGFLVEKGTAGLSAPAIKNKMSLRASITGSIFMEDVKVSDDAVLPKSNGLGSPFSCLN
FT                   NARYGISWGVMGALEDCIARARDYALERNQFKRPLASFQLIQKKLADASTAATLGLLGA
FT                   LQLGRLKDKGEWSSDMVSMMKRNNCGEALHHSRVLLDILGGNACSDEYHIGRHAANLQV
FT                   ANTYEGTNDIHALILGKAITGLQAFAN"
FT   CDS_pept        join(complement(841230..841283),complement(841034..841190),
FT                   complement(840871..840983),complement(840661..840822),
FT                   complement(840418..840606),complement(840118..840366))
FT                   /codon_start=1
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807728"
FT                   /locus_tag="CNG03030"
FT                   /product="S-adenosylmethionine transporter, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAW44691.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00004B4957"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR7"
FT                   /transl_table=1
FT                   /translation="MADSDAPPRPPTFQRALISGAISGLSVDFMFFPLDTVKTRIQSSA
FT                   GFWSSGGFKGVYRGVGSVGLGSAPGASAFFVTYEALKKRLPKYQVFANNSSLTHMVAAS
FT                   GAEYVSCLIRVPTEVVKSRTQAGAYGQGKSSLHSAISTMKYEGIRGFYRGFGITLTREI
FT                   PFTSIQFPLYEFFKSFLSQHYLGGKRPTSYEAALCGSLAGGIAAACTTPLDVVKTRVML
FT                   EARVSASASGANVVNDVLPPKQPSPSVLSFPPRLLNILRTEGPAALFKGWVPRTFAISM
FT                   GGAVFLGIYDLASNFGIKDEKEDKVA"
FT   CDS_pept        join(841513..842037,842088..842285,842333..843799,
FT                   843862..843981,844035..844199,844253..844312,
FT                   844426..844703,844754..845107,845163..845362,
FT                   845420..845598,845651..845715,845774..845967,
FT                   846021..846766,846821..846861,846910..847026,
FT                   847073..847254,847310..847349,847410..847614)
FT                   /codon_start=1
FT                   /gene_family="HOG000135975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807729"
FT                   /locus_tag="CNG03040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44693.1"
FT                   /db_xref="HOGENOM:HBG177337"
FT                   /db_xref="HOGENOM:HBG738516"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00004B4958"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR6"
FT                   /transl_table=1
FT                   /translation="MADEPLATWFTLTHQRNVLHLDFRGVITASAFLTVQPTNPSLQAI
FT                   YLHASPHLHIHSVFLSSPTPSEPLLATPASFALSNPYQPLPVREPPIDIKSHPEIKRKT
FT                   WAAMGESDEGELAISVSGGWVRLVESQNIAGREPQVTFAPIQVRIDYQLVVGGDVIEGI
FT                   VFRRPGDGGNEYQIPHMFLSPTTYNSARVWTPCIDSLFERCTWELEFVVPRYLEGGEPL
FT                   DGEEGYPVMVVSSGELMEQITHPHDPHKVIFYYLQTNPTSVQHISFAAGPFQMHCISAD
FT                   ESHKPILGFCLPGDLDLLANSTSFLPRVMAFTTELGSYPFTDFKVVFVSNPRSECSTSA
FT                   TLAIASSDLLHPPSVIEQAISVRQTLSLALIQQWIGINIIQRNYSDTWIVNGLALYILG
FT                   QFIRHLLGNNEYRFRLKKDIDRCVMQDQGAQWPLCVPGQVDPPDSATTAFINIKAPLVL
FT                   HILDRHLAKAGTSLGLSQVIPRILMAALSDDLPGNTLTTSYFLRQCRKVSGLDLQTFQD
FT                   QWIFGSGCPRLSVRTNFIKKKFTVEFMVSQTQPAVEAINEMSEKQRKVAVWRRPTPFFE
FT                   GSLTVRIHEADGAPFEHLIDIKTPQKTFPLPFNTKYKRTRRSGHIAARFNKMQDALDAA
FT                   NEPSNDDEEEAKLEAADRAGVFAYPPWDDEEERRRWKVAEWGEGEANAMLGEGGGYEWI
FT                   RVDPDCEWLAIFEFAEKPWCWISQLQGDRDVIAQLEAIQNMRMYPSPVIASELARTVLV
FT                   KNYFYRVRMEAARALAMYNSSECDYIGYFLIMKLFQAFYCQPSSGNETEPPEIQCRPLP
FT                   NDFSNFADYFVKKSLIAAMADLRDPATRAVWRHYSDSFYLAAVITAISNAFTVGSAAQG
FT                   MLSETEIESEQLLQKEATDVLDRAMTVDRLVPSYHNVVTKAGLEAQMKSILAGQRTNDS
FT                   RELLSYTREGNFEAIRMVAFDGLLLCKPPGRSPAVDKYLLDVIANDQSLTIRRFVARNL
FT                   SESILVSLALGEITGALPLPGVVDVTNETDQMREQRTEGQNNAIVKALRKDFGAKLEVK
FT                   RLVQDSLIESFTMPDPEVRFALLKVAEIIASSTSEPQPGNLITLSTPTVETPTAPQPPK
FT                   IRISMPSAEIVSDSQGYGFPAPENPVVTPRTAAKIVLNPNAPTPSTHKKKDAPKAQRKG
FT                   LSDNDFKAIAIALNKLVADKRSFFFRQPVDPVRDNAPDYLTVIKKPMDLSTIRAKLDNG
FT                   MYTNRQDFVSDIRLIIANCYTYNAAPTSPVRKAGEAFEKLFNTLWAKTENTLSAQRSSH
FT                   ATTPSKAMPPPPLPQAEPTASTSVKVKVKPPKSVTIDPAPAPVMPPPPLPIAKKASMAR
FT                   PPATEEKKEKQAKKRKEPGETSKSNLDDLLGAEVDAMGSEAATNDPLTDLLEEPKQPTK
FT                   KSKLPVSSKISKSTTSKESSAAPSSSNEKPSVKKAKIKVQSGGSSSPVPRPPVPAEQPS
FT                   VSQTLVPSPIAPSTVISAQPQPPSDLPPTKSNSMSFKAKRAKALLTTLQKEPSAILFLR
FT                   PVDPILDGCPTYLDEIKHPMDLGTIGKKIDQKKYKTMGQFARDIELVFANCRQFNPPGE
FT                   ITALADKVEEVYWRDWPKTVSSKMTGDEKKSMVSMLNQALKNPLSEWFRLAVDPVALGI
FT                   PQYFDIIPPEDARDLGLIKLKLEKGQYQTAKQVDEDVELMLENARVFNGEGPVVDAANA
FT                   LGKWWQSQRSKMDV"
FT   CDS_pept        join(complement(849134..849281),complement(849034..849080),
FT                   complement(848812..848946),complement(848611..848654),
FT                   complement(848418..848555),complement(848246..848358),
FT                   complement(848095..848191),complement(847958..848040),
FT                   complement(847808..847926),complement(847724..847732))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636902"
FT                   /locus_tag="CNG03050"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44695.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR5"
FT                   /transl_table=1
FT                   /translation="MDYSSFIGSQLFSVKGRVGSLILSPPFVHRGPACSSSTPKTCIVT
FT                   GGGTGIGKGIAAALILNGAKETANELTNAAVRAQSEGQCIPVEGDVATKQGVSDIYEKI
FT                   VNLTDRNDPIGLEEQLWSIEDSDFANMTAIHCAGPYFLAVKCIPLFKNSDNPSVCNITS
FT                   LAAHFFNRAVCEYSYGQSKAAEVHLTRLMAAGLLPYKIRCNSVCPGLFRSQLTTGTTDL
FT                   DAPLWPPMQRATEEAIPARRVGKWEEIAGAVLMLASPAGAYFNEAEPGRKKTDGQEVII
FT                   DGGWRLVSLHQDLHVPRRSRADNTPSQFA"
FT   CDS_pept        join(852846..853009,853067..853252,853308..853471,
FT                   853531..853637,853690..853886,853941..853995,
FT                   854046..854170,854229..854461,854509..854606,8
FT                   54665..854757)
FT                   /codon_start=1
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807730"
FT                   /gene_name="PRP46"
FT                   /locus_tag="CNG03060"
FT                   /product="Pre-mRNA-splicing factor PRP46 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAW44697.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG021649"
FT                   /db_xref="HOGENOM:HBG630928"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00004B495A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDR4"
FT                   /transl_table=1
FT                   /translation="MSTSLETPSGASAGPSIVASGLPPLADLVRAGSKRTRVVYGAETS
FT                   AVEDDGLARANKIKLATKLAIEYKDVQTLPPILQAQQTGPAGPKRPTQPSIAASATAGP
FT                   NVKLIGGPEAEKASSSTPQAVAEPRSLVKFRHQEGFAAEGGQATSRLSQALMRKKEARE
FT                   VKPEYHPEWKLTRVISGHMGWVRAVAMDPGNQWFATGAGDRVIKIWDLASGELKLSLTG
FT                   HISTIRGLAVSDRHPYLFSCAEDKMVKCWDLETNKVIRHYHGHFSGVYSLSVHPTLDVL
FT                   VTGGRDASVRVWDMRTRANIFTLTGHTSTVGDVKTQDSDPQIISGSMDSTVRLWDLAAG
FT                   KCMNTLTHHKKSVRALAIHPTEYSFASASSGGNNIKKWKCPEGIFVNNFVGHEAIINTL
FT                   SINSENVLFSGADNGTLTLWDYKTGLPFQHLKDIPQPGSLDAEAGVFCSTFDKTGTRLI
FT                   TGGADKTIKVYSEQA"
FT   CDS_pept        join(complement(856765..856793),complement(856681..856723),
FT                   complement(856575..856628),complement(856416..856524),
FT                   complement(856297..856360),complement(856214..856243),
FT                   complement(855857..856160),complement(855645..855795),
FT                   complement(855510..855589),complement(855335..855450),
FT                   complement(854824..855283))
FT                   /codon_start=1
FT                   /gene_family="HOG000033915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636903"
FT                   /locus_tag="CNG03070"
FT                   /product="Adenylosuccinate lyase, putative "
FT                   /function="N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-
FT                   forming) activity"
FT                   /biological_process="purine ribonucleotide biosynthetic
FT                   process"
FT                   /protein_id="AAW44699.1"
FT                   /db_xref="GO:0004018"
FT                   /db_xref="GO:0009152"
FT                   /db_xref="HOGENOM:HBG171016"
FT                   /db_xref="HOGENOM:HBG302411"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI00004302F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR3"
FT                   /transl_table=1
FT                   /translation="MDSYQTPLSSRYASKEMSKLFSSGARFGTWRKLWLNLAIAEKELG
FT                   LTISDAAIEQMKANLELDEAQMKVAAEEEKKRRHDVMAHVHTFGTVAPEAAGIIHLGAT
FT                   SCYVTDNADLIFLRDGLDILLPKLATVISRLANFAKQYRDLPTLGFTHFQPAQLTTVGK
FT                   RATLWIQELLWDLRNLRRARDDLGFRGVKGTTGTQASFLALFDGDHAKVEALDKRVTEL
FT                   FGFPYAYPVTGQTYSRKIDADVLGPLSSFGATVHKIATDIRLLANLKEIEEPFEKDQIG
FT                   SSAMAYKRNPMRCERACSLARHLMVIYQNTLMTSSVQWLERTLDDSANRRVTIPEAFLT
FT                   ADILLTTLQNISEGLVVYPRVIGRRISQELPFMATENIIMAIVKAGGDRQECHEKIRVL
FT                   SHQAGAVVKEEGGENDLIDRVKKDEYFKPIWGQLDALLDPRTFVGRAPEQVDGFLKEWV
FT                   EPALKPYEEALKNVKTAELSV"
FT   CDS_pept        join(857130..857320,857389..857473,857543..857673,
FT                   857728..857743,857800..857917,857988..858026,
FT                   858083..858231,858300..858367,858433..858511,
FT                   858577..858777,858834..859316)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093636"
FT                   /locus_tag="CNG03080"
FT                   /product="Aldehyde dehydrogenase, putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44701.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00004B495B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR2"
FT                   /transl_table=1
FT                   /translation="MLVKSRPRISPLFAGMRYYSQISRVPLWIGGKQVTSTSRGTIIHK
FT                   HPRTGQKSCEMVIAGELETSEAIRHSHEAYKSWSMVSGWERRSILQNALRLLKERSANI
FT                   ASLLRADADFSDLLVHSDINSSINLLDGSAETAISIEGYMPQTVDGSLAMVMKEPHGPV
FT                   LSIPAFNFPLTLAMRSIVYPIACSNTVVMKASPLVPQLSTFIAALFNDAGLPPGVLQIL
FT                   SFSEDEVGKRVKQLISHDDIRFVNFTGSVSLGKQLASLCGQYLKPSVMELGGKAPAIVL
FT                   PSANLQLAANHILFGAFLNSGQVCMSMERVIVHEKIAEEFEQVLKSEAIKAGWAGGMEL
FT                   VRSGAGERAKHMVDQAVRMGARVIYSAGADGSAASLSSKSAYPPTILADVRRDADLFQV
FT                   ESFAPILTVQSGSDLSSIIAMANSHETGLSASVFCQDLALALKVAQSLQSGAVHINGMS
FT                   VHDEHGLPHGGTKSSGWSRFNGKGAIESFTQTKVIRINGTNLSLPLSALYRGLPENGSS
FT                   EI"
FT   CDS_pept        join(861818..862009,862065..862319,862379..862491,
FT                   862538..862626,862686..862878,862942..863136,
FT                   863184..863292,863344..863398,863450..863811,8
FT                   63871..864098)
FT                   /codon_start=1
FT                   /gene_family="HOG000159304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942707"
FT                   /locus_tag="CNG03090"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44704.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG192418"
FT                   /db_xref="HOGENOM:HBG318532"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniParc:UPI000042EB68"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR1"
FT                   /transl_table=1
FT                   /translation="MPTPSITTNGTGPHTTVATPVKSSAAKSRGALKRLKAKARAGGGG
FT                   GKGSNRMSETPTDTESEAESTTSTVDLSTLEIDPSDPRFSAFSNIFAHFQGGEGDEIAE
FT                   QLAGPAKGEIYYSDEEDDDQEAKENAVKRAQEQEGLTRRQRRQAAKLTVAELKQLVDRP
FT                   EVVDWYDCDARDPRLLVNLKSHRNTVPVPNHWNAKRDYLAGKRGIEKPPYLLPSWIAET
FT                   GIGEQRDAVKAKEAEQSLRQKTRERVQPKMGKIDIDYQKLHDAFFKFQGKPSMSKFGEA
FT                   YYEGKELETDLRTKKPGELSQELIEALSIPPLAPPPWLIAMQRFGPPPSYPNLRIRGLN
FT                   APIPPGAQWGFHPGGWGKPPMDDFNRPLYGDVFGVLQGAEIAHQNEVDRSLWGEIEHVE
FT                   EESEEESEEEEEEEEEEAEKPAANVPADGLETPSGLATPSGYNSVVSTVPGGLETPDFM
FT                   DLRKNTRAQAEDVPSGPKELYQVIPERETTSRGLMGSSTAYDIGAVGKGSGIAVLGAED
FT                   SGRKRKAGDVDISIDTDEELTQEQLRAKYEASRTQQNRVYVPGADADRSGFDDVMSGEM
FT                   KKRARKDDKRGKEKAEKFKF"
FT   CDS_pept        join(864685..864715,864805..864893,864984..865139,
FT                   865195..865197,865257..865405,865457..865616,
FT                   865671..865755,865811..865846,865900..866063,
FT                   866114..866215,866269..866304)
FT                   /codon_start=1
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789569"
FT                   /locus_tag="CNG03100"
FT                   /product="L-malate dehydrogenase, putative "
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44706.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG242477"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI000042DA99"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDR0"
FT                   /transl_table=1
FT                   /translation="MVKAVVCGAAGGIGQPLSLLLKLNPLITELSLYDVVNAPGVAADL
FT                   SHIATPAQVAGFLPPDNGAEKALKGADIVVIPAGVPRKPGMTRDDLFNINAGICATLAQ
FT                   SIANACPEAFILVISNPVNSTVPVFAETLKKAGVFNPKKLFGVSHLDVVRASTFVASVL
FT                   GKPKDAANYSVPVVGGHSGATILPLLSQAKPAIAEVLSDKEKRDALVHRIQFGGDEVVK
FT                   AKDGAGSATLSMAQAGAEFAEFVLQAAYGSQKGKVVQSYVFLGADAGGNEVKKEISADL
FT                   DYFSVNVELGPNGIEKILPIGKIDDNEKTLLAAAVKELGPSIEKGVNFQPPPPKL"
FT   CDS_pept        join(complement(868501..868658),complement(868207..868462),
FT                   complement(867883..868170),complement(867728..867845),
FT                   complement(867485..867666),complement(867286..867441),
FT                   complement(867115..867228))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789570"
FT                   /locus_tag="CNG03110"
FT                   /product="Putative uncharacterized protein "
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   homologous recombination"
FT                   /biological_process="regulation of S phase of mitotic cell
FT                   cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44708.1"
FT                   /db_xref="GO:0000724"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007090"
FT                   /db_xref="HOGENOM:HBG068297"
FT                   /db_xref="HOGENOM:HBG177338"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00004B495C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ9"
FT                   /transl_table=1
FT                   /translation="MMRRCGCALATAEWIKNHWAQILWKLAGEVQARPDLLTEKWSWEE
FT                   VISQLKYRYEREFGVAQRPLVRRILERDSSPSLPMVLLVSKIHSTDGKDGSVGFLELTD
FT                   GWYCINAQIDDCLKRAVDKGKIVVGRKLAITGAKLQSSNEEADVFEAHKTCRLVLSGNS
FT                   TSLARWHARLGMQSQPYVSGLSSLSVDGGVITLMDIVIERLFPIAFTNGDRNIKESPWN
FT                   EEEEKRRQDKWKERYWSERTRLMERKEKEVEKLRELGTLLSQYAVEASLAEWQEESSDT
FT                   MENEFEELLHAKDLPLRVRNFSSIQISHLAHYAQLRLSSEMEELRIEVEAELETICPPR
FT                   DVRDFRMVRFKDGQEGHREAFRKGMLSVWDASALGSTTLKEGKRYLVSNLVPGKSGDWR
FT                   VGRRQSSMAEVYLHTRRDTRWVAL"
FT   CDS_pept        join(870756..871082,871151..871477)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807731"
FT                   /locus_tag="CNG03120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44710.1"
FT                   /db_xref="HOGENOM:HBG068296"
FT                   /db_xref="HOGENOM:HBG177339"
FT                   /db_xref="UniParc:UPI00004B495D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ8"
FT                   /transl_table=1
FT                   /translation="MGKEWKEGILDIGAEVERHLDVLEAEGDYLQSTGKVWEAIDRMSR
FT                   DLSRDEKSAIIRRWKIHQSIVKDAWDEFKEILEDSQNRDDDGGWDELGLGGTSLSEEEK
FT                   SRAEAIKPLLSLHQLLHASIPRYFDQAEDHLQALLEDSSKFVDCYDELVSSLHPEQDEE
FT                   EIDSALSDIEKVSRGMASLVGNVSTDKWAIKYDIEKGKWSDRKFDMRSLAVAIE"
FT   CDS_pept        join(complement(873147..873207),complement(872932..873100),
FT                   complement(872738..872894),complement(872624..872687),
FT                   complement(872230..872586),complement(872026..872190),
FT                   complement(871836..871987),complement(871527..871796))
FT                   /codon_start=1
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636904"
FT                   /locus_tag="CNG03130"
FT                   /product="Translation elongation factor, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44713.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000042D0F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ7"
FT                   /transl_table=1
FT                   /translation="MLRNALQSRLSSTLRTAELRAARPVAGPSVLAARTFVSKPLPSPR
FT                   FRAAVLTPRRLPTRSYAAEAGGKFTRSKPHFNIGTIGHVDHGKTTLTAAITKHLAEQGG
FT                   GKFMDYSQIDKAPEEKARGITISTAHVEYETPNRHYAHIDCPGHADYIKNMITGAAQLD
FT                   GAIIVVSATDGQMPQTREHLLLARQVGIKKLVVFINKVDQVDDPEMLELVEMEMRELLG
FT                   QYGFDGEETPIVMGSALAALEGRDPERGAQKIQELMEKADEWLDVPSRDLDKPFLMYVE
FT                   DVFSISGRGTVVTGKVERGTITKGSEVEIVGLGAPVKTILTGIEMFHKELERGEAGDNM
FT                   GALLRGIKREQVRRGQVLVQPGSIKSVKKFKAQIYILTKEEGGRYTPFMANYRPQLFIR
FT                   TTDVTCALTFPEGTEGAHEKLVMPGDNVEMIGDLVHDIALEPGSRFTLREGGKTIGTGI
FT                   VSEIYE"
FT   CDS_pept        join(873631..873678,873723..873803,873857..873933,
FT                   874002..874080,874117..874127,874163..874177,
FT                   874218..874302,874360..874474,874513..874626,
FT                   874858..874979,875024..875107)
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942708"
FT                   /locus_tag="CNG03140"
FT                   /product="Inositol-1(Or 4)-monophosphatase, putative "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="AAW44715.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI00004B495E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ6"
FT                   /transl_table=1
FT                   /translation="MEYSEIFDFAYGLAEKASKIILDASAKRWISTADLNEKKNSVDLV
FT                   TETDELVERMIKSAVAKKYPQHKFIGEESYAAGDRPPLTDEFTWIVDPIDGTMNFVHSY
FT                   PFVACSIGVAHKSRPVIGVIALPFLNQIFSARLGGGAYMNRDIPLPLTGGIPQPLSDLS
FT                   RCMIGAEWGSDRGLSTFKHKASSFTKLAGDPSKGVDGGVMVHALRTIILNETGGFFAGG
FT                   KDSLDAPVGRIMMGRRYIFVRAVPATESSSQIQHRLARELYDVVEEWTNEDMMD"
FT   CDS_pept        join(complement(876456..876485),complement(876352..876403),
FT                   complement(876241..876302),complement(876145..876200),
FT                   complement(875803..876099),complement(875673..875747),
FT                   complement(875423..875633),complement(875267..875383))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636905"
FT                   /locus_tag="CNG03150"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44716.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG177340"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000042C63A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ5"
FT                   /transl_table=1
FT                   /translation="MGKKKRSQVFVLKPWCWYCEREFEDDKVLLQHQKSKHFKCQLCPR
FT                   KLNTAGGLMVHSQQVHKCDPEPLTNTLPGRDGYDIEIFGMEGVPANAQAEWKARKEAEA
FT                   GTALLAAAAAAKRPRNSYNVIPEADLRAALAQHKVLMAARNKAAPATPFPPFMGAPPPF
FT                   PPGFPPAGAPPFAGMPPPLPPGAIPPFAPPGVRPPFPPPGPSPFTSAGNAPDGLVSTPT
FT                   FSSVNPPNFVPSTSGSGLAETNVLPSKDGVIWPDTAASPYEKRAQQPRYRYASPAHRVE
FT                   EEDGSAAGRKRKAAADFL"
FT   CDS_pept        join(876689..877348,877386..877439)
FT                   /codon_start=1
FT                   /gene_family="HOG000039904" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807732"
FT                   /locus_tag="CNG03160"
FT                   /product="Putative uncharacterized protein "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44717.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG297151"
FT                   /db_xref="HOGENOM:HBG606796"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI000042DF0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ4"
FT                   /transl_table=1
FT                   /translation="MTARPVVSLARQIHSSAVRRSQVGKVPIPIPPSVVLALPASSVPP
FT                   HVHPGSPEAHRVFTVSGPLGSTTLPISPSVILTPPTPSASTLTISVHDPAVKTQRSVWG
FT                   LTRTLISNAVTGVSAGFNLEVKLVGVGYRAAIEPIPQVFIDLAKQTSSLPTDALPRERL
FT                   NIKLGFAHPVLIDIPPQIKVTVPEPTKIMLSGTDKQKLGQFAATIRQWRKPEPYRGKGI
FT                   FVGGETIRLKEVKKK"
FT   CDS_pept        join(complement(879382..879444),complement(877925..879318),
FT                   complement(877748..877861),complement(877461..877704))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807733"
FT                   /locus_tag="CNG03170"
FT                   /product="Expressed protein"
FT                   /function="transcription termination factor activity "
FT                   /protein_id="AAW44884.1"
FT                   /db_xref="GO:0003715"
FT                   /db_xref="HOGENOM:HBG068294"
FT                   /db_xref="HOGENOM:HBG177341"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniParc:UPI00004B495F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ3"
FT                   /transl_table=1
FT                   /translation="METSSSLQRLKVADLRSKCKELKLANYSKLPKPQLIQHILEAQNL
FT                   ASSTSFTSVTSYITEEQDNHFRSRAEAFKPISQESTKHLKVTFDITQHDQAHCLLDPVP
FT                   GDSSHLTASTNQKRLPSGGRLQQQAAKSVSLKVASNSVGLPSFPNAFTKTNSEPHSPGL
FT                   AAMNKSMLLSPSMPNARHISAFTSSQSGSYTALVRKKKLQGTNPAHHVTPIIAASLSSS
FT                   ASMTIPCPLPITPAKRVTQMENHFLNTLFISLNRYRTDPILSPPFPSSIRRKTHRIDPT
FT                   THLAFQGIHPSLYTSANELAFHVSVRFWVFRIHTEMLQGCSEAWSVLGAASGLMTADLC
FT                   RWPTVTECRRVSQDIWLVRTEANGLDSLYDHTSKVSITSSNGDMIQQTYLVLEATGEVV
FT                   AESSSLQQDTHVIEGCAIRPDWFFYIQNTTSLGVGSSVFRYVKTKDDHEYPQGISKCWR
FT                   QQVMKKGDSKSVLDVAERAVLTSCSLNSISGRKMTIVDMDAEQRGYCSTVLTPSGNLEA
FT                   VSLYLPQEQHVMSVHIPLDSYHPNLAFVHRRSGITEYVLKDTGQVVGDENCGISPLWQG
FT                   LLGCNDRGDKDDGRMEEFWKDWETRLWM"
FT   CDS_pept        join(879899..880097,880144..880226,880276..880359,
FT                   880413..880684,880738..881116,881186..881244,
FT                   881283..881377,881430..881859,881914..882055,8
FT                   82134..882181)
FT                   /codon_start=1
FT                   /gene_family="HOG000138262" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581885"
FT                   /locus_tag="CNG03180"
FT                   /product="cAMP-dependent protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44719.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG068293"
FT                   /db_xref="HOGENOM:HBG177342"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00004B4960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ2"
FT                   /transl_table=1
FT                   /translation="MEPAPYSVRYRILCDLLDSHTALAYDNAFIVDGESGICLAEDEKA
FT                   AVLDTVLLRNWNGETSCLDSVTFNILERNRLKHDDFDVIGCLGDGQFGVVEAVRFKMSG
FT                   QVFAMKTIEKTVAKRAGRQLSLSLERHVHRLSNSSSLSPCPNLVAAFQTELSLHLITTY
FT                   AECGSLWNRMCALFSDTKYAGRMLEGEIQWWGAQMVSAIGWLHNHNIVHRDIKPHNFLI
FT                   KSDHHLQITDFGSAAPLYFTFPDETPCVPWQFCVQPVGTPDYLAPEVLILAEQAVIESK
FT                   QVHQTSGSHILQHSEKKGYSASIDWWSLGSTLYEMATGKPPFFAETIHETYEKLITFRS
FT                   DDLSFPTYLSSELVLLLKGLINVPVKRLSTATMIQKSPFFQPIGWIDNFPKFFYSPLVL
FT                   PDMLGNEQLQTNFQQSIQEDEFTLNHFFDYSDISSVHLTPVSPSSSAPPVWSQWVGWSF
FT                   HPDPKSLEVISAADNSSGNDAFMTPIRNKLTTCPFTPDIMNRPPAPLLPSTHSTKKQVF
FT                   QELLHCVQMSAKKHMMRGKVKTKSFTKDTSCISLLSDPGMVLIETGVSHQQLQERHDVL
FT                   CGQLHHLDRQLFKLHKLLKS"
FT   CDS_pept        join(879899..880097,880144..880226,880276..880359,
FT                   880416..880684,880738..881116,881186..881244,
FT                   881283..881377,881430..881859,881914..882055,8
FT                   82134..882181)
FT                   /codon_start=1
FT                   /gene_family="HOG000138262" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581885"
FT                   /locus_tag="CNG03180"
FT                   /product="cAMP-dependent protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44720.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG068293"
FT                   /db_xref="HOGENOM:HBG177342"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00004B4961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ2"
FT                   /transl_table=1
FT                   /translation="MEPAPYSVRYRILCDLLDSHTALAYDNAFIVDGESGICLAEDEKA
FT                   AVLDTVLLRNWNGETSCLDSVTFNILERNRLKHDDFDVIGCLGDGQFGVVEAVRFKMSG
FT                   QVFAMKTIEKTVAKRAGRLSLSLERHVHRLSNSSSLSPCPNLVAAFQTELSLHLITTYA
FT                   ECGSLWNRMCALFSDTKYAGRMLEGEIQWWGAQMVSAIGWLHNHNIVHRDIKPHNFLIK
FT                   SDHHLQITDFGSAAPLYFTFPDETPCVPWQFCVQPVGTPDYLAPEVLILAEQAVIESKQ
FT                   VHQTSGSHILQHSEKKGYSASIDWWSLGSTLYEMATGKPPFFAETIHETYEKLITFRSD
FT                   DLSFPTYLSSELVLLLKGLINVPVKRLSTATMIQKSPFFQPIGWIDNFPKFFYSPLVLP
FT                   DMLGNEQLQTNFQQSIQEDEFTLNHFFDYSDISSVHLTPVSPSSSAPPVWSQWVGWSFH
FT                   PDPKSLEVISAADNSSGNDAFMTPIRNKLTTCPFTPDIMNRPPAPLLPSTHSTKKQVFQ
FT                   ELLHCVQMSAKKHMMRGKVKTKSFTKDTSCISLLSDPGMVLIETGVSHQQLQERHDVLC
FT                   GQLHHLDRQLFKLHKLLKS"
FT   CDS_pept        join(908546..908792,908857..909054,909143..909333)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807734"
FT                   /locus_tag="CNG03210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44723.1"
FT                   /db_xref="HOGENOM:HBG177343"
FT                   /db_xref="UniParc:UPI00004B4962"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDQ0"
FT                   /transl_table=1
FT                   /translation="MPGRQARCQSTLAEATTPTSSAGGKATKKRSSKTTPYSRNPPLSA
FT                   SSTSTTISPVSSTVVTSTPSTIAEIARLQEELRAAQTALNTLSTDPATVSSSPTTLSNA
FT                   TSLSLNSSLSNVASHGLSSPVETHFAASPPDNADPSHETPSPAPAPSFSMTTSYSKPTS
FT                   QSIYPPPNMMKKGFKLRSAMGLIGQEHDNLMKGIHASHTPLLSIINIY"
FT   CDS_pept        join(complement(912955..913009),complement(912781..912873),
FT                   complement(912632..912724),complement(912498..912575),
FT                   complement(912384..912448),complement(912195..912326),
FT                   complement(912116..912148))
FT                   /codon_start=1
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19789571"
FT                   /gene_name="ARF"
FT                   /locus_tag="CNG03220"
FT                   /product="ADP-ribosylation factor "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /protein_id="AAW44725.1"
FT                   /db_xref="EMBL:AAA17546.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI00001688C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P34728"
FT                   /transl_table=1
FT                   /translation="MGLSVSKLLNGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERITEAR
FT                   EELQRMLSEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRSWYIQAACATSG
FT                   DGLYEGLEWLSANLKRKSP"
FT   mat_peptide     join(complement(912955..913006),complement(912781..912873),
FT                   complement(912632..912724),complement(912498..912575),
FT                   complement(912384..912448),complement(912195..912326),
FT                   complement(912119..912148))
FT                   /gene_name="ARF"
FT                   /locus_tag="CNG03220"
FT                   /product="ADP-ribosylation factor "
FT                   /db_xref="UniProtKB/Swiss-Prot:P34728 "
FT   CDS_pept        join(913845..913963,914017..914084,914133..914301,
FT                   914342..914424,914491..914645)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636906"
FT                   /locus_tag="CNG03230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44727.1"
FT                   /db_xref="HOGENOM:HBG177344"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI000042CC0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP8"
FT                   /transl_table=1
FT                   /translation="MSQASDAFWQPFSSGALKLLPKRGVGIRAKSKRADRIPDDPQRPL
FT                   VTDYHSINDPTMRIRVPKKFLTPVKVEAKVWFANERTFISYLSMGLLLSTIASGLLFGS
FT                   RDSSARWFAFAYALISAGVLIYGWAIFQKRLTMISARDSGSFDLLWGPIFICFALFIAI
FT                   LANFIFRLHEAQQHTGLNPLSLKYAWNEAGMKNA"
FT   CDS_pept        join(complement(915951..915989),complement(915670..915879),
FT                   complement(915489..915618),complement(915428..915451),
FT                   complement(915012..915184),complement(914937..914963))
FT                   /codon_start=1
FT                   /gene_family="HOG000177542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942709"
FT                   /locus_tag="CNG03240"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAW44730.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059414"
FT                   /db_xref="HOGENOM:HBG396717"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000042DA98"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP7"
FT                   /transl_table=1
FT                   /translation="MASKMDIDRPLDEIIATKAKPRRSRQGGAGARRGGAASGATSARA
FT                   RYASTVPKTISAPQPFSAEVFKIIISNLPSDVTEAAVRDLMQSTVGPVKSVQMSYTATG
FT                   KSTGIATVVFRNKGDARKAHASYHNRMIDNQRPMKVELAIDPNQAQSSLVNRVAPAPVQ
FT                   PQKRRAPASKPRNTRPAKKTAEQLDAEMAEYKQSSTA"
FT   CDS_pept        join(complement(917991..918219),complement(917838..917937),
FT                   complement(917665..917800),complement(917543..917610),
FT                   complement(917474..917492),complement(917203..917413),
FT                   complement(917014..917150),complement(916467..916961))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807735"
FT                   /locus_tag="CNG03250"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44732.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG177345"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI000042F7F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP6"
FT                   /transl_table=1
FT                   /translation="MVSTRPSPAPARGRVAYPSAASYVPGDANNSPAYPSASSPVKEVS
FT                   SRESDKERAQGLKTWWKGFREREAADDKQWDDGRVVFGVPLEISTKYASVQLSTSGPDD
FT                   SLYVWGVIPVVVAKCGLYLKENATMVEGTFRVSGSAKRMRDLQLLFDTGPKYGKDIDWK
FT                   RLPYTTHDVGTIFRRFLTQMPEPIVPFRYYGAFRLVMEKFTSGETSVDQAIDEYKHLIQ
FT                   SLPNVNRYLLLYVLDLLSVFARRSDINLMTAANLALIFQPGIISHEIHAMQPREHVLSQ
FT                   QVLEFLIEHQKHFVDGVKTTSHKGKEKTKAKRSGSKSSSKQMVPAPLVRADSDLMVPSD
FT                   SDDEAPLGGYYVIEGRIRSPIPVANTTTSPSIEKVTSPPPLRPKPTMDTLEPSDSDEDV
FT                   PPGGYEVRSGDFEATRATLLATSHRNVASRTVSESLARRKTVPARVGVGLSSKIGKSRK
FT                   VTKEAP"
FT   CDS_pept        join(complement(923179..923548),complement(922795..923122),
FT                   complement(922742..922757),complement(922435..922705),
FT                   complement(922286..922398),complement(921482..922244),
FT                   complement(921331..921440),complement(921153..921290),
FT                   complement(920739..921108),complement(920541..920696),
FT                   complement(919972..920468),complement(919849..919918),
FT                   complement(919660..919794),complement(919516..919603),
FT                   complement(919223..919460))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789572"
FT                   /locus_tag="CNG03260"
FT                   /product="Sterol 3-beta-glucosyltransferase, putative "
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="lipid glycosylation"
FT                   /protein_id="AAW44734.1"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG068290"
FT                   /db_xref="HOGENOM:HBG177347"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniParc:UPI00004B4963"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP5"
FT                   /transl_table=1
FT                   /translation="MRWFSPSEAVQRSGTPCAAQLFDLFKYMAGDNSDGDFGQGEAAEG
FT                   EENEVLPNFLPQGDRPSPVTWDDRPYALADDPHLHIASQETRPSTPSRVKHEKGTSTYL
FT                   EEAEKATERERNSLSARLTAMSLSNLSNAMLLRSGKKVKRRPLPLKDQDPSPEIGAKSS
FT                   ILLTPSASLDDYKIGVLGDLSENDMPLDGDDITDEEKIAAIISEFGDITSLYEDQEPER
FT                   ILAESKGSVFKSVMMIGNLHLTTHRLLFHASIPPDYGSGALSSTGSATNDATVRQPDVL
FT                   QAGPVTVHYPGAIRPSRRVWMELSSEMVTTYPGADEASRVRPLRCVLLSSVRQLEPIDP
FT                   EHPRDFYVEYETATGWKRSHISVDTEQSAGQWRRAFHAALFRQMRYKWRQSSGFIPPDD
FT                   NWSMMRVCIPLSRVTLKGISSYHSFATLMGLDVDLDVVLHPAFSFLSSIENRIPDAPHK
FT                   LKLIHPSSISSVKPPALPCSKTTSRKSSLWRGDADAARSPDLWNGSQANPDNPKEQKLL
FT                   EFNIAVLNEQVWFAEALQSAVNASKLRKYAATAKEPKIVLEVDGHDCLAADDELDSKSL
FT                   GTTGSTELDEDEDSGDDVLQQTRKREKAFMAAKVFGLKEEDGIWMKRCYIVTSFLPARG
FT                   HIIITPQYICFWRRVAVGTDIRYRFPVEDVENVFIVPGIRVRFHGLALQIKGHEDLRFE
FT                   FWKHSSRDEVMAHIKSLAGTSSGVTALSSKSPSARTSNSGKQVMAVSSKQTFAVHPADI
FT                   LAPSKSSLFQPLSVTDDSLPYLPFVANSPNFTARLEPRTFVCLTIGSRGDVQPYIALGL
FT                   QLKKDGHKVVIVTHLEFKEWVEGYGIEHREAGGDPTALMKLSQEHKMFSPGFFKESLGS
FT                   FRQWLDNLLLDSWQACKDADVLIESPSAMAGIHIAEALKIPYFRAFTMPWTRTSAYPQA
FT                   FLVPTFEMGPSFNYATYVLFDNIMWKATAPQINRWRKKHLNLKPTDLSTLSITNVPFLY
FT                   NFSPSVVPKPLDWHDDVIVTGYWNLEDSDRDWVPPAALEEFIVRANEKGRPLVYIGFGS
FT                   IVVPQPDEMTRSIIKAVEKANVCAIIAKGWSSRGGDPAKEGQNITFPESCYGIDKIPHA
FT                   WLFPRVRAALHHGGAGTVGASLRAGIPTLIKPWFGDQFFWSIRVSKLGVGLKVPSLRSD
FT                   DVASALIKATSDRLMIEKAARIGERIRSENGVATAVSAISYNISRAANNRRTAR"
FT   CDS_pept        join(924169..924382,924419..924597,924638..924834,
FT                   924874..924999,925038..925289,925329..925458)
FT                   /codon_start=1
FT                   /gene_family="HOG000157670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636907"
FT                   /locus_tag="CNG03270"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /protein_id="AAW44736.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG020852"
FT                   /db_xref="HOGENOM:HBG381263"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR013796"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniParc:UPI000042F793"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP4"
FT                   /transl_table=1
FT                   /translation="MQPGPSKDILRFTGHRHLRQRILLSILSGKSMRIDGIRSDDVHVG
FT                   LRDYEVNLLRLVEKVTNGSTIEISVTGTSFILHPGLLPGGSFNHSCHIGRSIGYYLEVL
FT                   LPLAPFCKKPFNITLYGVTGEEGRDMTVDMIRTVTLPHLHLFGISDGLELQIKKRGSAP
FT                   LGGGQIFFKCPVVRQLNTLHFVDKGKIKKIRGVSYSTRVSPQFANRMVESARSVLNRYV
FT                   PDVYLYTDVYKGDDSGKSPGYGLTLVTQSTTSAVHAAESLSVAGEVTTPEDVALFASRL
FT                   LLEELSRGGCIDSKHQWLVALLMALGKEDVSKCLFGSLTPYTVQFFRDMFTFFGTKYKI
FT                   SEESSGEVLVSCIGIGYSNVNKSMA"
FT   CDS_pept        join(926779..926980,927029..927589,927627..927703,
FT                   927744..927945,927984..928325,928384..928483,9
FT                   28553..928583)
FT                   /codon_start=1
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807736"
FT                   /locus_tag="CNG03280"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase, putative "
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44738.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG211646"
FT                   /db_xref="HOGENOM:HBG322449"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI000042D028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP3"
FT                   /transl_table=1
FT                   /translation="MAAPSNNKSGTIPSMEASGEALTDETVVIVLGASGDLAKKKTFPA
FT                   LFALFTQGLLPKDVHIVGYARTKMDKDEFHRREIQYIKGDQEKIKQFQELSSYVSGPYD
FT                   EDAGYKELLKHVEELERDRKTRNRIFYMALPPSVFTTVAKGLKKNCYSSQGTNRIIIEK
FT                   PFGKDLESCRQMMSELKSQWAENETYRIDHYLGKEMVKNLLVLRFGNVFLDASFNKNFV
FT                   SNVQITFKEPFGTEGRGGYFDEFGIIRDVCQNHLMQALSILAMERPVSFSAEDIRDEKV
FT                   KVLRCIPAIDRKDVLFGQYVAAGDKPGYLEDDTVPKDSICPTFAAMTLWINNPRWEGVP
FT                   FIMKAGKALNEAKVEIRVQYKDATQGIFTDISRDELVMRIQPDEAVYLKMNNKLPGFHT
FT                   RAVPVELDLTYKKRFTDANIPQAYEALILDALKGDHSNFVRDDELDVAWKIFTPILHWI
FT                   DSKDAPKPEPYPYGSRGPKQIDEFAAKYGFKRSPQTYSWPKTSASL"
FT   CDS_pept        join(complement(930105..930143),complement(929670..930048),
FT                   complement(929311..929631),complement(928885..929272),
FT                   complement(928795..928846))
FT                   /codon_start=1
FT                   /gene_family="HOG000138261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581886"
FT                   /locus_tag="CNBG1470"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44740.1"
FT                   /db_xref="EMBL:EAL19854.1"
FT                   /db_xref="HOGENOM:HBG066272"
FT                   /db_xref="HOGENOM:HBG177348"
FT                   /db_xref="UniParc:UPI000042F383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP2"
FT                   /transl_table=1
FT                   /translation="MMTTFQRLLVARSPLAPLFPLKHRFPRTPAYSLCEFRKGLFLRRK
FT                   AAFIALYIDAQTAINASSLKHKSTLPDVTSFEKLLPSLEDVGVNSWTPDRSGWREDRAE
FT                   SWRIRCGRKKAASTMRVERKGWAPEGSFEFEMECQASASIRARAREQAALLKLAYELRG
FT                   VVLATNKPAPVVRALSAAEDKPPSKNKRKLDKKAEPLLVTSQTASSPLSQTPSRDGSVK
FT                   AKKKTKKKKRSVLANQSNPHHVDNYRPSRTVSPHRDPYEPWPNHFDLISPPSMRFLATR
FT                   PQRATVPLPGAPQRRVVVRPSEEDYICCFCEYDLYYGSEKARKRAIRRRRRELKRKDAI
FT                   KAKAKNVAEGRGVLKDDSEDDEEDDECDDDGHGQCTCGRAIPQTKPLESDAG"
FT   CDS_pept        join(complement(929670..930183),complement(929311..929631),
FT                   complement(928885..929272),complement(928795..928846))
FT                   /codon_start=1
FT                   /gene_family="HOG000138261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581886"
FT                   /locus_tag="CNBG1470"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44742.1"
FT                   /db_xref="EMBL:EAL19854.1"
FT                   /db_xref="HOGENOM:HBG066272"
FT                   /db_xref="HOGENOM:HBG177348"
FT                   /db_xref="UniParc:UPI000042FB0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP2"
FT                   /transl_table=1
FT                   /translation="MGSDLRIESEDCFDDDDFPAAPGGKKRKVPAYGQMKSADEVNDTK
FT                   PLAPLFPLKHRFPRTPAYSLCEFRKGLFLRRKAAFIALYIDAQTAINASSLKHKSTLPD
FT                   VTSFEKLLPSLEDVGVNSWTPDRSGWREDRAESWRIRCGRKKAASTMRVERKGWAPEGS
FT                   FEFEMECQASASIRARAREQAALLKLAYELRGVVLATNKPAPVVRALSAAEDKPPSKNK
FT                   RKLDKKAEPLLVTSQTASSPLSQTPSRDGSVKAKKKTKKKKRSVLANQSNPHHVDNYRP
FT                   SRTVSPHRDPYEPWPNHFDLISPPSMRFLATRPQRATVPLPGAPQRRVVVRPSEEDYIC
FT                   CFCEYDLYYGSEKARKRAIRRRRRELKRKDAIKAKAKNVAEGRGVLKDDSEDDEEDDEC
FT                   DDDGHGQCTCGRAIPQTKPLESDAG"
FT   CDS_pept        join(complement(929670..930183),complement(929311..929631),
FT                   complement(928889..929272),complement(928805..928824))
FT                   /codon_start=1
FT                   /gene_family="HOG000138261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581886"
FT                   /locus_tag="CNBG1470"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44741.1"
FT                   /db_xref="EMBL:EAL19854.1"
FT                   /db_xref="HOGENOM:HBG066272"
FT                   /db_xref="HOGENOM:HBG177348"
FT                   /db_xref="UniParc:UPI00004B4964"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDP2"
FT                   /transl_table=1
FT                   /translation="MGSDLRIESEDCFDDDDFPAAPGGKKRKVPAYGQMKSADEVNDTK
FT                   PLAPLFPLKHRFPRTPAYSLCEFRKGLFLRRKAAFIALYIDAQTAINASSLKHKSTLPD
FT                   VTSFEKLLPSLEDVGVNSWTPDRSGWREDRAESWRIRCGRKKAASTMRVERKGWAPEGS
FT                   FEFEMECQASASIRARAREQAALLKLAYELRGVVLATNKPAPVVRALSAAEDKPPSKNK
FT                   RKLDKKAEPLLVTSQTASSPLSQTPSRDGSVKAKKKTKKKKRSVLANQSNPHHVDNYRP
FT                   SRTVSPHRDPYEPWPNHFDLISPPSMRFLATRPQRATVPLPGAPQRRVVVRPSEEDYIC
FT                   CFCEYDLYYGSEKARKRAIRRRRRELKRKDAIKAKAKNVAEGRGVLKDDSEDDEEDDEC
FT                   DDDGHGQYQALRE"
FT   CDS_pept        join(complement(932272..932313),complement(932205..932223),
FT                   complement(931998..932152),complement(931890..931933),
FT                   complement(931787..931851),complement(931596..931751),
FT                   complement(931517..931560),complement(931349..931447),
FT                   complement(931141..931286),complement(930926..931093),
FT                   complement(930752..930887))
FT                   /codon_start=1
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581887"
FT                   /locus_tag="CNG03300"
FT                   /product="2-nitropropane dioxygenase, putative "
FT                   /function="nitronate monooxygenase activity"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44744.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533360"
FT                   /db_xref="HOGENOM:HBG683237"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00004B4965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN8"
FT                   /transl_table=1
FT                   /translation="MPIVTEFTRLLGIKYPIVQGGMQWVGTPPLAAAVARAGGLGMLTA
FT                   LTQPSPEDLREAIKETRRLLGDREGKFGVNITLLPSINPPDYAGYTRAALEEGIDIFET
FT                   AGNNPKPLIDYIRTYKADNSKGPTPKRFIIHKCVNIKHAFSGQKMGVDVLSIDGFECAG
FT                   HPGEEDIGGLVLLAKAAKELTIPYIASGGFADGRGLAAALSLGAAGINMGKYTHWLSEL
FT                   ILGTRFMCTVESPIHQNIKDKIVRSTEKDTIHIFRTLGNTARVYRNSVSTRVVELEKRP
FT                   QGAKFEDLRELVAGARGRKVYETGDYDAGIWSAGIAIGLIDDIPTCASLIERIDQEASD
FT                   VIKGLCGLIDNQNKAKL"
FT   CDS_pept        join(complement(932272..932313),complement(932205..932223),
FT                   complement(931998..932152),complement(931890..931933),
FT                   complement(931787..931851),complement(931596..931751),
FT                   complement(931517..931560),complement(931349..931447),
FT                   complement(931141..931286),complement(930929..931093),
FT                   complement(930752..930839))
FT                   /codon_start=1
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581887"
FT                   /locus_tag="CNG03300"
FT                   /product="2-nitropropane dioxygenase, putative "
FT                   /function="nitronate monooxygenase activity"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44745.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533360"
FT                   /db_xref="HOGENOM:HBG683237"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000042FF56"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN8"
FT                   /transl_table=1
FT                   /translation="MPIVTEFTRLLGIKYPIVQGGMQWVGTPPLAAAVARAGGLGMLTA
FT                   LTQPSPEDLREAIKETRRLLGDREGKFGVNITLLPSINPPDYAGYTRAALEEGIDIFET
FT                   AGNNPKPLIDYIRTYKADNSKGPTPKRFIIHKCVNIKHAFSGQKMGVDVLSIDGFECAG
FT                   HPGEEDIGGLVLLAKAAKELTIPYIASGGFADGRGLAAALSLGAAGINMGKYTHWLSEL
FT                   ILGTRFMCTVESPIHQNIKDKIVRSTEKDTIHIFRTLGNTARVYRNSVSTRVVELEKRP
FT                   QGAKFEDLRELVAGARGRKVYETGDYDAGICLIERIDQEASDVIKGLCGLIDNQNKAKL
FT                   "
FT   CDS_pept        join(complement(932272..932313),complement(932205..932223),
FT                   complement(931998..932152),complement(931890..931933),
FT                   complement(931787..931851),complement(931596..931751),
FT                   complement(931517..931560),complement(931349..931447),
FT                   complement(930926..931286),complement(930835..930887))
FT                   /codon_start=1
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22581887"
FT                   /locus_tag="CNG03300"
FT                   /product="2-nitropropane dioxygenase, putative "
FT                   /function="nitronate monooxygenase activity"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44746.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0018580"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533360"
FT                   /db_xref="HOGENOM:HBG683237"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00004B4966"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN8"
FT                   /transl_table=1
FT                   /translation="MPIVTEFTRLLGIKYPIVQGGMQWVGTPPLAAAVARAGGLGMLTA
FT                   LTQPSPEDLREAIKETRRLLGDREGKFGVNITLLPSINPPDYAGYTRAALEEGIDIFET
FT                   AGNNPKPLIDYIRTYKADNSKGPTPKRFIIHKCVNIKHAFSGQKMGVDVLSIDGFECAG
FT                   HPGEEDIGGLVLLAKAAKELTIPYIASGGFADGRGLAAALSLGAAGINMGKYTHWLSEL
FT                   ILGTRFMCTVESPIHQNIKDKIVRSTEKDTIHIFRYVCRLNVCDDLNGIVVRWAILLES
FT                   IVIRCRLGLSNWKKDPKAPNLKIFESLLLAPEDAKFTRRGIMMLGYGRLVSPSDLSMTF
FT                   QHVPA"
FT   CDS_pept        join(complement(934656..934712),complement(934576..934586),
FT                   complement(934463..934517),complement(934280..934397),
FT                   complement(934122..934223),complement(933851..934065),
FT                   complement(933624..933794),complement(933548..933568),
FT                   complement(933406..933478),complement(933246..933343),
FT                   complement(933144..933194))
FT                   /codon_start=1
FT                   /gene_family="HOG000159426" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807739"
FT                   /locus_tag="CNG03310"
FT                   /product="Peroxisomal membrane protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44748.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000042C717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN6"
FT                   /transl_table=1
FT                   /translation="MGDSVIHAFAGSVGGCAAMALTYPLVTLSTRAAVQTKKEHITAKE
FT                   ALSKAYGEEGIAGLYSGLGSSLFGIALTNGVYYAFYEEMRSALIRRRSKTPASNGGLTT
FT                   IEGIFAGLVAGSITTIATNPVWTIQTAQATYTADPSSKADGKPDIKPSAAQVAKGIIEK
FT                   EGIKGLWRGIGPALVLVVNPVIQYTTFERLVAALLRYRFLSHGATPVGKTALGRSSLSD
FT                   WDFFILGAASKLVATSCTYPYIVVKSRLQAATHQYKSSLRAILHILRAEGVSGLYAGLT
FT                   LKLLQSVLTAAFMFVAQRRIYELVKYLLSLSVRKRKAVLALG"
FT   CDS_pept        join(935470..935506,935568..936882,936949..938194)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789573"
FT                   /locus_tag="CNG03320"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44750.1"
FT                   /db_xref="HOGENOM:HBG068288"
FT                   /db_xref="HOGENOM:HBG177350"
FT                   /db_xref="UniParc:UPI00004B4967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN5"
FT                   /transl_table=1
FT                   /translation="MLSRIQLAAALIEYDNDDDLVANIPSQPPRNWRDSAIFTPFIQTQ
FT                   QEERRRKILAQPPPVLPGVSCQETGTSNNNEKHPAPRSYKGITEDPEENIADNVDIDVG
FT                   DWGLPSHLVSEPVRPRQRAISQPLSMLSAQRASKPLALKDDNSPSGLRDNSGRRASLDQ
FT                   YRTRQAWAEPQNLDLALGRHTAMGLQDGTTPLPNSSSPIATLRPITARQELDTFKERNI
FT                   PNDSEPNPFALPALGRQTGSRFDPEERHRSSLNSANGLAMGSKLPNGFTLSSTNVPRRW
FT                   SASSKIENSLTEPMPDYSEIPTAKQFGRPLMPPRYSTSAVTQISRRSLRPNVLVMPSPL
FT                   ADSESLHPDVKVPDGFVRGDKPLPAEAKTKGRRPGLPLSLSQKTFRSSLLVDGKREDEE
FT                   YFVGSSEIEGEIGVSSKDITIDAIQRRSGKLYGKSLIDELEARKAMMKGKRRVFTGDFR
FT                   PAMMSRSTMFFEPSSLAPPSSDLIVDPSHSTKSRPSTFHSSKDRPLIQSDTIDGGQHMS
FT                   PSDSNHRDAKGRSVFGVDHVWESEMTKLKSRLDEGAMSGEGETRRVSKDLRKEDKEDDE
FT                   HGAIGTTVDLREDKAHIEDNSLARHQLIPPIASGQEPEEDQSLLQDQSPSPLSDRYSDE
FT                   DVPLSKIARRSTPSKESSSAGNKTEFTPSISPPLTDSEEEVPLSQLALKYSSAPSTKGD
FT                   AASEITAPSRLQPSPSADGYDEDEDDLPLAVRQAQAKGLTPPSRAEIIEDELPLGFKHV
FT                   EAVQRRMAQSHMVGGMWGDIQNDVNRVGTGIGAPNPYMMWGVPGHMPLGLPQPLLNSST
FT                   PSMPNLNVLEGNGVFSSPASNIDNWRQEVRPPSERARTGDDGRDQQVIRHMIS"
FT   CDS_pept        join(939048..939792,939853..939904,939954..941225,
FT                   941283..941453,941512..941576,941633..941922)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807740"
FT                   /locus_tag="CNG03330"
FT                   /product="Mannosyl-oligosaccharide 1,2-alpha-mannosidase,
FT                   putative"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAW44752.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177351"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI000042EC40"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN4"
FT                   /transl_table=1
FT                   /translation="MGRSLSPKPTGRNMPYAPAYPSSYSDPEKGLPSSPSSLARHMLVP
FT                   RKPRWILGGLLICVVILYYMTSNKDETAWGHGGSWDAEGDDSRAGSKPSDDKSESPTYS
FT                   DYIVDAHGNHFVKGWQQPITPMHPDVDLLPRAPSIFPYLNVSESELPEEKIYPDSDLRL
FT                   IISQPPDLPEEHSNSMPEDAWSQKWSGPTVWDQPKGEMKRVQWEGFAGGRDRWESENDR
FT                   KVREERKEAVKRGFKHAWEAYKRHAWGHDEVRPVSLTHSDPFNGWGATIVDSLDTLLLM
FT                   GFSNEYNLCRPHVNQLNFHWVNGRDWNDGYVSEELSGSGEVYALNRDKTVGLAVFETGI
FT                   RYLGGLLGAYDLSGDDLLLERAVDLADILSTAFKTGSGLPAGRMDPGTKDEMIRLGTVS
FT                   LAEVGSMSLELIRLSQITKDRKWFDLAQRAMDYIHERVIPRGTHSPLIPMWFQPDAPLT
FT                   TSMHGGLTFGGLADSYYEYLIKTYKLLGTSEVSQVWRDVYERSIDKAKETLYVDIDIVP
FT                   GRNILAVGKLENGRLIPELEHLTCFIGAMLGLGAKLLDRPGDMRDAERVTASCYWLSAD
FT                   TPTGLQPEVVEWYAPHETSAMYENVSISGGGRHHPLIFSEDESKDRDGMYRDRNGVLRW
FT                   TEDNEPVLYTDREKKKNGQTPIKYAQRLKGTPTGARKVSTRGLNRPETIESIFYMYRIT
FT                   GDRKWQEKGWKMFTSWMNASTVDGGFSSVEDVTKLPVRFGDNMESFALAETFKYHFLLQ
FT                   SEPDVLSLDDYVLNTEAHPFLTNPKLDPKAHTTHTRFWSPPPSQDLGVRGQGTNAQKFA
FT                   RLEVIERASLPFLPAPPQNAPGGGGGRGMGGGGGKPGVIPKLPPEILKKLNQ"
FT   CDS_pept        join(945339..945575,945643..945681,945744..946043,
FT                   946111..946491)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789574"
FT                   /locus_tag="CNG03340"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44754.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG177352"
FT                   /db_xref="HOGENOM:HBG757944"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI00004B4968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN3"
FT                   /transl_table=1
FT                   /translation="MRSLAILPLVTAVAMADRLLNPAPQVFFPDPDDALHPDWPHRQSA
FT                   LGWDTLGRINGDVAIGGGVGSCGGVCVLTPEVMEGPFYLDYHIERSNITEGLPGIPLTL
FT                   VFHVFSVSSHLSDPTLPHSTCEPLPSAWIDIWSCDAVDGVYSGYGKAAEGPGPGGPGGP
FT                   GGPGGPRKGPHGPGGPGDHDRPMHQEPINNSTFLRGFQQTNEDGIATFHTIYPGWYPGR
FT                   TVHLHLKTHPPSWGHHPDSSNATHAHTTQIFFPQEMNDRVAKHPVYAPNGASRVPNDRD
FT                   GLFNEMKGASMAKIEYAGEDLDEGIIAHVGLGIDKWW"
FT   CDS_pept        join(complement(947521..947707),complement(946685..947469))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807741"
FT                   /locus_tag="CNG03350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44756.1"
FT                   /db_xref="HOGENOM:HBG068286"
FT                   /db_xref="HOGENOM:HBG177353"
FT                   /db_xref="InterPro:IPR013900"
FT                   /db_xref="UniParc:UPI00004B4969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN2"
FT                   /transl_table=1
FT                   /translation="MPPQPQPQRDSDGFLMPARPPKRTQLRPANSLPTTADIYAAKHGI
FT                   PLDVQMALQNVGRRGRESVARGHRSFDRTQSVPNLVIGSSAAPPASSFTSTHDAMQHAR
FT                   GVINKELMRARELQPFGSTSSTSSDVDALALEGAEEHKRTRRLVFGPDGEVEEVFQQAS
FT                   LKAKVGFGKGTKSEDATLVPSRKRRSSPAEPDGSDTETDDIDQDEEDELRPSVTFNTVE
FT                   SVFPPVFTSPAITHPELFGPLPGSSSSADVPDVTTTAARPFKGLPVGKRKLGWQKAASA
FT                   PVIGLQRWGDMDVDGEEETKFEAENESLEDGFEFNNWEEVEF"
FT   CDS_pept        join(947706..948028,948074..948193,948248..948310,
FT                   948368..948704)
FT                   /codon_start=1
FT                   /gene_family="HOG000223418" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636908"
FT                   /locus_tag="CNG03360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44758.1"
FT                   /db_xref="HOGENOM:HBG177354"
FT                   /db_xref="HOGENOM:HBG627271"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="UniParc:UPI00004B496A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN1"
FT                   /transl_table=1
FT                   /translation="MAGEGGAGQGGERWRRATAMPGASRRVGRNDTWEARRAGIAAWLW
FT                   EWLMNDRRVVPPVFSLSAAPMSPAALVPICTPLHPIWAFDVLAAHLQHGTPADPPFHNP
FT                   HDSYALFVSWHVAKPGRRHVLRGCIGNFLPMPLAEGLKDYALISALKDHRFSPIKAAEL
FT                   PTLLCDVSLLTPFISIADPLDWTPGEHGIHITFTHPTDHTRSYSATYLPHICPEQGWTK
FT                   EETVLSAISKAGYKGKVKVGDRVWKRLHVKIYGSVKVEASWQDYVEWKQSMSENVNAE"
FT   CDS_pept        join(949161..949403,949476..949593,949657..950756,
FT                   950820..951022,951095..951206,951271..951735,9
FT                   51790..951834)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807742"
FT                   /locus_tag="CNG03370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44760.1"
FT                   /db_xref="HOGENOM:HBG068284"
FT                   /db_xref="HOGENOM:HBG177355"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniParc:UPI00004B496B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDN0"
FT                   /transl_table=1
FT                   /translation="MAIHQPLLEPLNSIVSAYPPQRSKPVPIPASELDTKLSQAWETYS
FT                   NDPSLINGMAKNPDLIRGVLELVGRELVVLSVINGQLSEPDETANEKEKVVFQTALKDR
FT                   LDIILTLYETVHKAFQEIPFLEPGALFIPLLEELVELLSVGTWRSLWSYVESRSKRFTK
FT                   DMPASRGKALPLLRTINAFLRFLPRTPEDLVFRGRIHQFASSVFSVADKSAINMRGDYS
FT                   EVKTVWEEEPEMEKIKVEEKEENKEGKMDERAEEGGKKDGDVEMEDAEKKDEHTEHSSN
FT                   QPADQSMEQPTEDEPPLTPAALQEPDFYSTLWSLQQYFSHPPSLDGPAVGSPPKTPFQT
FT                   FREKSDFVLPQLFEQTRKEKAMAGTDDGLGKKRKRQVMEGQDTGGFFHPRFLTGKRLFE
FT                   YELADSSFRRQILVQYFILFQFLLNLTPAHAGKQAFTGGMPRTFMLEQADEQWVKSKIG
FT                   GIKEELKNIVGGASFEDTVFSIIRQEAHYVQWKNEGCPEGSFEIPALDPDSASEPAQAW
FT                   AKRLNPPAPYNFKVGSRPLSMLWNNGFTNINQLKRREKATTVEALDEEIKRIEEDEEDD
FT                   KAMGQGTPEKLAANKERKTTSTWRALRLASHTSLKFFPSLKEKRDVHLLLSTIKKAQEP
FT                   KGFARKEAGEGEKEGGEGENENPGEGGELEDEDVQELKKEKEGEENEEKEKEDTENAEE
FT                   KGPAELEKVEEEVKEEPIVDGTKVQEVGEEKEEESDDKGSAEDVEMAEKEEQNVESKAY
FT                   DEVEATVV"
FT   CDS_pept        join(complement(954909..955275),complement(952003..954755))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093638"
FT                   /locus_tag="CNG03380"
FT                   /product="Cell wall surface anchor protein, putative "
FT                   /protein_id="AAW44762.1"
FT                   /db_xref="HOGENOM:HBG068283"
FT                   /db_xref="HOGENOM:HBG177356"
FT                   /db_xref="UniParc:UPI00004B496C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM9"
FT                   /transl_table=1
FT                   /translation="MARASLTFTSLAFLIFITPLALAQSSGTINLSSTSVCVIIAQIAS
FT                   LSSPNAISAMMPICPDSGDTAIAWPLTTTGDGASSSIAIYAHTTAINGGVSLGCVMGLS
FT                   QMQAMYLLGRDLTWDDSAGLVLPDPSSNAAGASVWDQTITLTSGAKASGGNNDDVVEST
FT                   VADVTSVAAPASSTILMTSAAAKTSAAPVTSVYRITSAVPETSAAAETSEAPSSTDQLA
FT                   VQTSSPLSPSPSSTINEASQTKAVVTSPKSVISDQLSYSATPSLTAVEPSSVSEVVDVL
FT                   TTSSTTFHEVGSSGSPTSSESDSDQANFESSGQPVAVQTSSPAPQPISDTVQQLSSTQQ
FT                   ETTVEAQISAQPETSAQPQTSGQPQTSAQPQTSDQPQTSGQFQSSAQPSGSSYRSESNE
FT                   QPTRADSSYASDPTSAYQASSSHPEDSTPTLIQSSDSASFSTTDGNDYSSDNGDYDNTS
FT                   VIAVQTSASLKASPSVVQSENQRVTSYDASTYQVATASLSSSAYLTDTAYESSNDDNLS
FT                   DSEEVPQTSPSQSLSAPTSASAAIVSNTYLISSNSSDSSDGGVTVTALDARPSSTAQAS
FT                   SSQTDVNEAGSSSSSASSFESKISPSGSDDNGSPSETDQSQSQYFEPSSSDVSTEQFTT
FT                   PTSSHQPTTYAAFIMPASSSSASSDEPFVFTVGGMTIGQFTEAGADAMIAVQFSSTSTT
FT                   DSPAAENSAWAETAAVENIEGTDATSTSASEVVAASAARTSSAFLADGNNGSWVSSVNE
FT                   SVSPGAPTSSEEARETSDSNRSGEDNYGTYSSASASTEETSKDNNQRSGAGENTASVTV
FT                   DYITTSPTQSSSIVSASYTDQRWSASQAKATVGGESEGSKVSAAPTIFSILSNSTSSND
FT                   SFGRESSDDKRQSLSATSYQANFTITGESAMVSASGHSHHQSDTAVNDMISQIIAVETS
FT                   AISFDSSPLSSVYRFSKGDDTYTKSGSPGAEPTSMSPWAQALSNNRNSSASISEIIRTA
FT                   SSLVSGASYSLESASTQKAVVTGGQSSGKTCARKRKEKARRARALLIEAV"
FT   CDS_pept        join(956190..956288,956399..956442,956501..956609,
FT                   956691..956843)
FT                   /codon_start=1
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636909"
FT                   /locus_tag="CNG03390"
FT                   /product="Yippee-like, putative"
FT                   /protein_id="AAW44764.1"
FT                   /db_xref="HOGENOM:HBG268212"
FT                   /db_xref="HOGENOM:HBG524054"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI00004B496D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM8"
FT                   /transl_table=1
FT                   /translation="MGRTYRIYLAGESVLMCRHCGNHLAVSEGIISKQFTGQHGRAILV
FT                   HTVVNAYSGEAEDREMRTGRHTVRDIYCRVCHTTLGWKYDFAFEHDQKYKEGKYILERE
FT                   MITEKPERRDIISGKPRIEEIPIREILARV"
FT   CDS_pept        join(complement(959095..959255),complement(959018..959048),
FT                   complement(958835..958965),complement(958529..958784),
FT                   complement(958072..958481),complement(957814..957925))
FT                   /codon_start=1
FT                   /gene_family="HOG000079046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942710"
FT                   /locus_tag="CNG03400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44718.1"
FT                   /db_xref="HOGENOM:HBG056094"
FT                   /db_xref="HOGENOM:HBG333307"
FT                   /db_xref="UniParc:UPI00004B496E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM7"
FT                   /transl_table=1
FT                   /translation="MSITINPATTKPPTRDNANPPMHLPVAKDEKQHPSKAGGENASVY
FT                   FVGTATTILEWGGIRVLTDPNFLHAGDHVHLGPGVSSTRLTNPSVDLHDLPRIDLVLLS
FT                   HYHADHFDQEVEASLRRDLPIVSTAHAKKALTSKGDDSFTNVHDLEPFQELMVNVKEDA
FT                   VQKQPKIRITGMPGKHVAGVMEVMNEYVSAIPPTNGWMVELGYEHNDAFKTGYRIYISG
FT                   DTLMVNELKEIPKRYPDHPIDLMLIHLGGTTVPSPKMSPLAVMVTMDGKQGVELMRLIK
FT                   PDVTIPIHFDDYDVFASPLEDFQKLVQQEGLGGGVVYLDRGEKYQFCVSPGLSQGPDLL
FT                   QKKHALVAVFAQSLHQSAGLFRKCSF"
FT   CDS_pept        join(complement(963195..963353),complement(962648..963139),
FT                   complement(962340..962583),complement(962074..962256),
FT                   complement(961803..961930))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807743"
FT                   /locus_tag="CNG03420"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="AAW44885.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="HOGENOM:HBG068282"
FT                   /db_xref="HOGENOM:HBG177357"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniParc:UPI00004B496F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM6"
FT                   /transl_table=1
FT                   /translation="MGGGPFPIYLGLKQDLLRKICRFKRLQRLGDIPLGRLHQSWKHGA
FT                   YICACFGTILQLQACVPSLRTVRPCGVDWIYFIATVQLLCNSCSFWTSEHLSFSLLEEK
FT                   GWDVNWKKQVEPLVCLCNDMRHHVNRYRNLPAQREQRRSYRRVPFFDVKLSLLAFEYVA
FT                   TSPIIPNTAISLSLLQFLHTLRQQSPMGIDAFSRALRRFHRARGGVIYARNSMKWIQPG
FT                   RLFWAALVVYRDFLSQEEFIDPTSPPAFARVSVVSAWLDIWHRRLSHLSFPLFVACCPT
FT                   SVSVVALSLGRRLPSAKDLCDMGVQSEGQTRYMLVLVDDWSRYTWAYFVRHKSDVLSCF
FT                   MRWLPLVERSYQTHLVKPICRNVNFALCNLTMVESLSTLRFLSTWPRVGFATRQLLPIA
FT                   NN"
FT   CDS_pept        join(966325..966423,966536..966579,966638..966746,
FT                   966820..966966)
FT                   /codon_start=1
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093639"
FT                   /locus_tag="CNG03440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44721.1"
FT                   /db_xref="HOGENOM:HBG268212"
FT                   /db_xref="HOGENOM:HBG524054"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI000042D4FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM5"
FT                   /transl_table=1
FT                   /translation="MGRTYRIYLAGESVLMCRHCGNHLAVSEGIISKQFTGQHGRAILV
FT                   HTVVNTYSGETEDREMRTGKHTVRDVYCRVCHSTLGWKYDFASEHDQKYKEGKYILERE
FT                   MITEKPERHDIINGKPHIEEIPVREILA"
FT   CDS_pept        join(968724..968952,969003..969737,969794..969915,
FT                   969979..970221)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807744"
FT                   /locus_tag="CNG03450"
FT                   /product="Specific transcriptional repressor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44722.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG068281"
FT                   /db_xref="HOGENOM:HBG177359"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI00004B4970"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM4"
FT                   /transl_table=1
FT                   /translation="MSARQQVPFRELSQEAKMSTSPPLRGIPIDRLSTRSFGREESMSK
FT                   SSDNHKSVLLSPIARSSSSSPVPRPSHKLSEVVEAVEDKGKKTSQSLPAASLPLIFRSS
FT                   PTLPPLNTRNPSRDSSPSSRTGPPPHPTVFHVEHGAFPRKSKEHGHDCPPARPYFPPWY
FT                   SHPLGYPHPHSSSERHYSSLSRIHTHPEEYYSIHMPTDRYYNAPLHPYYDLEDYYPPPS
FT                   PFPAHVYARGKEVYHRIPQPSRPRLHIHPYAFPWSNEGDVRFYSGEGKSNGSQPSHGLG
FT                   QGPVEGSSDRKLSKGTLSSPASATSTSAATVMSFKSPRKRTNDVQLAMLSDVFQRTQYP
FT                   STEERDELARQLGMTSRSVQIWFQNRRRAVKVDQQSAIQRAEAEARAAEATLRGLPAPP
FT                   FLTGSVPGGSGSRRNSDSELEDNTEVDAVMKRERKSPDAGMEG"
FT   CDS_pept        join(complement(971342..971746),complement(971132..971294),
FT                   complement(970984..971084),complement(970859..970937),
FT                   complement(970745..970807),complement(970462..970694))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807745"
FT                   /locus_tag="CNG03460"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="response to stress"
FT                   /protein_id="AAW44724.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG068280"
FT                   /db_xref="HOGENOM:HBG177360"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00004B4971"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM3"
FT                   /transl_table=1
FT                   /translation="MSLPPAILQHGNSTAGTSAHIALADGPATVNDSTVTLPSSQDPTS
FT                   PSASTPNLIHNSTSRVSMQLPEHPPSHQRSHSGSAGYANTTNLPSAMSHHGQFPRTRTN
FT                   SSGQQDGKYRRKVGFEAFEAGPGALFAFTCQSKSGGYKRSRNTRVFAVAVSPDESGETA
FT                   LEWLMSELVEDGDEVVAIRVIEIDEGERHSEKAQEEFREEAQALLKTVLEKNDEIDDLR
FT                   RISVIVEFVAGKSTTTLLKMIALYRPDSLVVGTRAQRSRLQSWGKALGAPGMGSVSRFC
FT                   VSHSPVPVIVVRPERKVKKHLKKRQNDPKRGQYAAIVGPDGLTLSRSRSRERSTGGSAM
FT                   SAGGMSE"
FT   CDS_pept        join(971958..971972,972056..972160,972211..972671,
FT                   972721..973114)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636910"
FT                   /locus_tag="CNG03470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44726.1"
FT                   /db_xref="HOGENOM:HBG068279"
FT                   /db_xref="HOGENOM:HBG177361"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniParc:UPI00004B4972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM2"
FT                   /transl_table=1
FT                   /translation="MTTWAIYSRDAMPVCTACACPADYIYTTYKTKSNIRLAVCPRCNQ
FT                   FVDPLIEHPSLLLLLDLVLLKPRVFLHLLFNRGSLPFSAVSEPASEIERETARRKQLWE
FT                   DFSTLALLSVGAETAVRLLPTLSGSEDSSDIQLSKIFWTISAVLLEGAAQHLTTLGLSI
FT                   LVLKLRGQNCSVSPSDDMHPARQDGRRKFFAPILIPLTLLYTSLLPLLFQLFLFPWYST
FT                   QPTIHEQPPSPSLSLSLLSSLPLPSSFTIPPSWLETERLLSEAWARGDRIWAGTRLLGG
FT                   MSAGYGLRVLLPTKPWETTLIVLAGWMAAAFVGKVVAELPSRS"
FT   CDS_pept        join(975057..975221,975323..975409,975492..975660,
FT                   975716..975758,975814..975961,976017..976032,
FT                   976091..976303,976353..976381)
FT                   /codon_start=1
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636911"
FT                   /locus_tag="CNG03480"
FT                   /product="Succinate dehydrogenase iron-sulfur subunit,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAW44729.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG299101"
FT                   /db_xref="HOGENOM:HBG616382"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI00004B4973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM0"
FT                   /transl_table=1
FT                   /translation="MVRPATVLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQP
FT                   PIKEFKIYRWNPDVPNEKPKLQTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREG
FT                   ICGSCAMNIDGVNTLACLCRIPKDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEP
FT                   YLKNDNPPEKGEFLQSQADRKKLDGMYECILCACCSASCPSYWWNQDEYLGPAVLMQAY
FT                   RWMADSRVSGAPWEPRWDSSPVEFPVANIAAPIGFLRRRAKGEDAERHVSLPMPHHLQL
FT                   LSNMSQGS"
FT   CDS_pept        join(975057..975221,975323..975409,975492..975660,
FT                   975716..975758,975814..975961,976017..976032,
FT                   976091..976149,976229..976303,976353..976433)
FT                   /codon_start=1
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636911"
FT                   /locus_tag="CNG03480"
FT                   /product="Succinate dehydrogenase iron-sulfur subunit,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAW44728.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG299101"
FT                   /db_xref="HOGENOM:HBG616382"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI00004302EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDM0"
FT                   /transl_table=1
FT                   /translation="MVRPATVLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQP
FT                   PIKEFKIYRWNPDVPNEKPKLQTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREG
FT                   ICGSCAMNIDGVNTLACLCRIPKDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEP
FT                   YLKNDNPPEKGEFLQSQADRKKLDGMYECILCACCSASCPSYWWNQDEYLGPAVLMQAY
FT                   RWMADSRDSYGAERKEKMQNAMSLYRCHTIFNCSRTCPKGLNPAAAIAKMKLEMATGE"
FT   CDS_pept        join(976852..976951,977119..977269,977324..977395,
FT                   977450..977465,977532..977949,978009..978222,9
FT                   78278..978323)
FT                   /codon_start=1
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636912"
FT                   /locus_tag="CNG03490"
FT                   /product="Malate dehydrogenase, putative "
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44731.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG242477"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI000042C638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL9"
FT                   /transl_table=1
FT                   /translation="MFARQVAKNSSSLARGFASSARSNRKVAVLGAAGGIGQPMSLLLK
FT                   QNPGVTGLSLYDIRGAPGVAADISHVNTHSTVKGFEKDDIKEALTGAEIVIIPAGVPRK
FT                   PGMTRDDLFNTNASIVRDLAEACAEYCPKAFIGIISNPVNSTVPIFAEVLKKKGVFDEK
FT                   RVFGITTLDVVRASRFLGEIKGKDPKDIKVTVVGGHSGVTIVPLLSQTPEGKDVSGEAY
FT                   KALVNRIQFGGDEVVKAKAGTGSATLSMGYAGARFTDSLIRALNGETGIVEPTFVKSPL
FT                   YESEGVEYFASNVELGPEGVKKINPVGQLSAEEQELLKACLPDLVKNIKKGVDFVKA"
FT   CDS_pept        join(980874..981050,981226..981636,981685..981765)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636913"
FT                   /locus_tag="CNG03500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44733.1"
FT                   /db_xref="HOGENOM:HBG068278"
FT                   /db_xref="HOGENOM:HBG177362"
FT                   /db_xref="UniParc:UPI00004B4974"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL8"
FT                   /transl_table=1
FT                   /translation="MHSAAIIASFLASLALSNAISVESPTKDTVWESGTSSQTVEWEAV
FT                   DTDPTSFEIQLVNQAGYLTNSPVTLVANQSTGDTGTTNSATVTYPDGAWPTGVAFQINL
FT                   VSTDAKNSGILAQSEQFNITSDGDSSSSASSSSSSSASSSSSAASSASSSSTSATVVAT
FT                   TAASSASAATSAASSGSSVSASASGSNSTLPNTSSGASLTASAGVASVVLAVAGVLALA
FT                   "
FT   CDS_pept        join(complement(984589..984594),complement(984145..984541),
FT                   complement(984011..984096),complement(983854..983964),
FT                   complement(983010..983804),complement(982609..982945),
FT                   complement(982450..982538))
FT                   /codon_start=1
FT                   /gene_family="HOG000216468" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807746"
FT                   /locus_tag="CNG03510"
FT                   /product="RNA lariat debranching enzyme, putative "
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="mRNA processing"
FT                   /protein_id="AAW44735.1"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG177363"
FT                   /db_xref="HOGENOM:HBG605012"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="UniParc:UPI00004B4975"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL7"
FT                   /transl_table=1
FT                   /translation="MRIAIQGCSHGSLAQIYDVVNYYSSQTKNPIDLLLLCGDFQALRS
FT                   KHDYASLAVPAKFKQLGSFHQYYSGERVAPVLTIVIGGNHEASNYMWELYHGGWLAPSI
FT                   YYLGAAGSVYVNGLRIVGASGIYKGFDYRKGHFEKVPYNDKELRSIYHIREYDVEKLMH
FT                   LTPSPSTIFLSHDWPTTIAHHGNKNALLKRKPFFRDEIEKNTLGSPPLLRLMNHFQPSY
FT                   WFSAHLHVKFAALYEHQAPSHGPDVDGGAPLPLPAMSTAIAQTGNNPDEIQIDEEMDEG
FT                   NPDEIIVEDEGEEIIVRPRQVNPDEIVMDDEEFDDPPPAVPQPLPITTSSVVNPEEITI
FT                   SDEEFDAPMAVSQSPQPLPPTRANASNPEEIAISDDEFDDPAPVAQPLTAIDESTDLIA
FT                   QSRSNPSHPHVAGTIAPPASDSTAPRVMQEARQEQQKWELHGGKGMEGVTKFLALDKCG
FT                   PGKDHMQFLEIPDPSPPAIPGPPRLTYDPEWLAISRAFHPYLSTSYQPIPLPSPDVLEQ
FT                   MVKDEVTRIKEEGLLVPAVPEKGAVEGQEGLVWEKGKVDVGRVQRFWWTAPPEGHPGGN
FT                   DAAWYTNPQTEAFCGMLGVQNKINPPVNRS"
FT   CDS_pept        join(984951..984996,985076..985257,985429..985500)
FT                   /codon_start=1
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636914"
FT                   /locus_tag="CNG03520"
FT                   /product="Ribosomal protein L29.e, cytosolic, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44737.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG242797"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI00004B4976"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL6"
FT                   /transl_table=1
FT                   /translation="MAKSKNHTAHNQTRKAHRNKIQRPKTNKYHSLKGVDPKVGFFRNA
FT                   KGYVGWAAGKMEGLRDQRDGWARMGIAVEERFRRNARYAAQGSAKAIREAKASA"
FT   CDS_pept        join(complement(987781..987803),complement(985856..987731))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807747"
FT                   /locus_tag="CNG03530"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44739.1"
FT                   /db_xref="HOGENOM:HBG068277"
FT                   /db_xref="HOGENOM:HBG177364"
FT                   /db_xref="UniParc:UPI00004B4977"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL5"
FT                   /transl_table=1
FT                   /translation="MRSMRAVAPAIRRPASLRYIPLIIRPATIPLSRSVSNLPRTPFSS
FT                   PANLTDATTSEYTHSTLYAFSYLSRTIKYVLYSLLAIGGISVATFEGIHLYVEKVCLAA
FT                   PSREDTDEYGWASENQGWTGGPRGGTDPRLGMKARHALRGAWICQEWGAGSSGAVERSV
FT                   HTSAFHPDFVAARGMISMPGDSDESAASRGRLRVDRGYELADEYVDLAIREARKKGLVF
FT                   PPTLPGARPAGPPTEKQMSHGPQGDPAVIDLLLLKAGTLERINTIDSLSHAKDLYEQVL
FT                   CSLNSSMGNEGGPGGRARVMRLAGKVGDLCARTGGRNEAMQWWGWGLNKAGVDIHAHTQ
FT                   TSQIVQEVKQDVNKGWFGKSAAASTPTPVALASKSSTLSPTLPPPVLRATISLLTSASA
FT                   QLATTSSLPAASSLQSLALSYLSKPLLQTQDSLASPSAALHSTWLIHRTSLLKLHLSSV
FT                   LYALSKSSTEALPLVAGAQGQVEGVITELLPLPAAFIQRGSALTAPAKILARDALLTGA
FT                   EIAYTKGTFLERSLPATSSQTGGLLKAKRSETPEEKAMRISTLESALECFERATALSAL
FT                   ESGAGPVKAKGGEEEAVGRGEEWGKYWRGFVRTREKLDEALGIEQVKESEKISDKI"
FT   CDS_pept        join(complement(988733..989067),complement(988654..988674),
FT                   complement(988562..988575),complement(988298..988488),
FT                   complement(988094..988186))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15807748"
FT                   /gene_name="PAM17"
FT                   /locus_tag="CNG03540"
FT                   /product="Presequence translocated-associated motor subunit
FT                   PAM17, mitochondrial"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAW44870.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG177365"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniParc:UPI00004B4978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55PU1"
FT                   /transl_table=1
FT                   /translation="MSRSVFSTLRPVIGQKTTLAPFAFSLRHASSSSSPFSTPTEPTSF
FT                   HTQPSHSTPTGPLPLTWPSYLSLRRQRRLWSTLTSVPTTFLGLFLGGGYFASLEADPSQ
FT                   LIFGVEPMFVYGGATLGCMALGYLIGPSVGATLFSLTHPSIARGNPAPLEVMDREFYHR
FT                   IRKNRADPRFQSVQNIVPDFYGEKIVSLSTYRRWLRDQAVYKRKAMHGVPGEDL"
FT   mat_peptide     join(complement(988733..988983),complement(988654..988674),
FT                   complement(988562..988575),complement(988298..988488),
FT                   complement(988097..988186))
FT                   /gene_name="PAM17"
FT                   /locus_tag="CNG03540"
FT                   /product="Presequence translocated-associated motor subunit
FT                   PAM17, mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55PU1 "
FT   transit_peptide complement(988984..989067)
FT                   /gene_name="PAM17"
FT                   /locus_tag="CNG03540"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q55PU1 "
FT   CDS_pept        join(complement(991141..991154),complement(991080..991093),
FT                   complement(990991..991032),complement(990901..990938),
FT                   complement(990649..990847),complement(990428..990593),
FT                   complement(990207..990375),complement(989771..990147),
FT                   complement(989382..989715))
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093640"
FT                   /locus_tag="CNG03550"
FT                   /product="Endopeptidase, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAW44743.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI00004B4979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL3"
FT                   /transl_table=1
FT                   /translation="MAPKADWEKYDKKVTDEKEEKIVALDESDIQILKTYGQGPYSLHL
FT                   KKIENQIKDIQKRVNEKIGVRESDTGLAPANLWDIPADKQRSGRPLQVARCQTIIKAAN
FT                   PPSGDQPLNPQDGAGAGNPEGDRYVISIKQVAKFVVGLGDEVSPTDVEEGMRVGVDQVT
FT                   YKIMLPLPPKIDPSVTMMQVEERPSITYADVGGCKEQIEKLREVVELPLLEPERFVNLG
FT                   IEPPKGVLLYGPPGTGKTLCARAVANRTDSTFIRVIGSELVQKYIGEGARMVRELFEMA
FT                   RSKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVIMATNR
FT                   PDTLDPALLRPGRLDRKVEFSLPDNEGRTHILKIHGKSMSVERDIRYDLIARLCPNATG
FT                   AELKAVATEAGMFAIRARRKVATERDFLDAVEKVIRQGSKFSSTALYAQYN"
FT   CDS_pept        join(991842..992057,992177..993289,993343..994143,
FT                   994221..994634,994694..994954)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807749"
FT                   /locus_tag="CNG03560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44747.1"
FT                   /db_xref="HOGENOM:HBG068275"
FT                   /db_xref="HOGENOM:HBG177366"
FT                   /db_xref="UniParc:UPI00004B497A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL2"
FT                   /transl_table=1
FT                   /translation="MLSAHSQQPPGQIQHASGSETQHVWPTYYPSGGRTYLLDGSGIFV
FT                   DPDTGVGLSLWIDPDLQDILGLIKAIWKEGGHISPSHDSISTQILLISPHKSPTLYTYC
FT                   HPDRLPPGHAHRQSQRRQPPEMGREEPWQVKVMLDRCWVSRCANAGMFLGEDHDWGGCR
FT                   IGGPLEDVKTQRFPPSARLRPVLEKGVEGKKSQEETDGGDSDDDVAMLPMPTRIPASRS
FT                   NGSGTLKINGGNVVWLNGNGKQTQQPSQMFTVNSRGNVKSTNHTAAPLKVQPKVSAQPE
FT                   PPQSQPHSHSQPQSQSLSQVPIQPSPQLQPIHPKPTSSTSSTSSLTSTPGAGPSNSNVN
FT                   ANMNSSSTSISTSRPLSRLHPHYARRSSAIAIAKRPAEVVDTVAENDDTPYTSDGEWPE
FT                   EVQKVVQVDRNSTLGDLAEMFRVEKMMLGPGVREKYLIATFRQKYGTYSLLTWRDLYLS
FT                   WLHQTGQYAYLLTNIDNSHLRPTDLFNETNLQPFQYSGSSPQTKFMDPSTLSWTDVHMI
FT                   FEKESEKISKAGLSNEQAGEYLADKYGVYISVTWASYFARWQKQRLSKRDELQSNTPAA
FT                   LPSIPIRITARVGPPSSSAPNRSIPTTTMTGNTNANAPRPSSSNRPGRRRKSRSPSSIE
FT                   LSDLSSDNSDDEVSPSGGGGGGGGGGGGGTRTAGIAGNAEYMTNEMMCQIFEKGYKGWE
FT                   MKGMSRADIAIELEKTVGVYMQGSWQIYYTNWKTKKGRFAYLAKKEKEKGKRRNKEGER
FT                   AKKDGEKEKEKEREKKNPALFLATRPSGSAAGEFTYSQNLAMTKPPRKRARVLTSKHSF
FT                   TEDEERAMAAHVVNNGLTTVLPSYLTWQTWSENPEGFPKRTPTSYATHCWKFRDRMESF
FT                   VAELKGTPDDKRYHGELMKTHTMRGDKVVSDPNDLDVSSEMADELGSEHAGGDAEEEDW
FT                   FSEE"
FT   CDS_pept        995276..998014
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093641"
FT                   /locus_tag="CNG03570"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44749.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG068274"
FT                   /db_xref="HOGENOM:HBG177367"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00004B497B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL1"
FT                   /transl_table=1
FT                   /translation="MLHASNLPPIPSQAPLHLNTSGLDSAASSPKQSPASLFIQRLHSS
FT                   RPTSYETASNSSGGAESSSQGAAGTADLSRMGSLRGGVSFGEAASNLSPQANPGQVNTN
FT                   TSVGYTPPAASRHPLFSHHALPARPPSFSPAHSISPSFVSDPGPSGPPSPAVSDLSNFS
FT                   SSAFSPASAFLSHFSSSSSALQLAPDAEGARVKDYTLGKLIGRGGFSTVRKVTLRTSGK
FT                   VLACKIVKRDDLSDMSGSLEKFEEEIKTWQNLPPHPSLLPLLDMHRTPSATFLFTPYLP
FT                   GGSLLDMLKREGGSDKTARKWFPGVVSAVSAMHEGFPGFPGGLLHGDLKLDNFLVDHQG
FT                   KVMVCDFYMAQMVGRQEDRTATIPPPLNAGVNRHSTLPSSFSRGSSRIPSPYRSHNSHT
FT                   PHRYPNEHHLHENSHAPSPAHTQSFPSASLPYAPPELLRAPPLGPSLAQDIWAVGIVLH
FT                   ALLTGRLPFFDPYDPRLQMKILRGTWEEPPNLGKEWLECLKGCLDGDRERRWTIVKVKQ
FT                   SDAVLGWKEVQSRSKSRSRSRVRIGRGMGMGDGFMDPMRRDGASQPVPIMSSSSLNPRG
FT                   KKSSSVSRSRDRGHSFQGGVFPGEHGRTPFDHPHTLHLQDPPPPRSRSVSASRSRSSGH
FT                   RPMFTFDAPELSRNLEQVDLNRGRSTHRGLPPGSTWNLSVPPSSSSSSSLSYARTQGTP
FT                   SNQGTPVPVPAADPSYSRAASRSRSQSAHKGGGMPPQPVPVQSSGFKGAMPMGFTESGL
FT                   GTAYSRPAGAAGVAMPVPMMTPNSKSRSRSRHSQQSQASTSPSVSRSRSQARDSPALSA
FT                   GAGGGHMGWGEPPYSPWAETTPAVTPGLGSGTPLTQARRSGSQFERYEYGQGLGAVHEE
FT                   DRGRDRGVRSREPSMNREQRDQSRGRKGRPAYRSGESFGRS"
FT   CDS_pept        join(complement(999679..1000483),
FT                   complement(999520..999619),complement(999140..999469),
FT                   complement(998812..999089),complement(998698..998753),
FT                   complement(998602..998648),complement(998238..998523))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807750"
FT                   /locus_tag="CNG03580"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAW44751.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058554"
FT                   /db_xref="HOGENOM:HBG068273"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00004B497C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDL0"
FT                   /transl_table=1
FT                   /translation="MGEQNQIPSSTKQIDSVDNKTRHSSDTSSEDETLQDELHSKVKHG
FT                   EKVAEEERDGHNEGTLAHPDPMTDNMESAPSSGPERQIQNSQDALSPQSSRVHNPPSTP
FT                   FASLQPTRSQRPYSAFSKSTKLLLVVLGGIAAIFSPISSNIFVPAIPTLADAFNRSESD
FT                   ISQAVTVYLVFQAITPSFFGSMSDSFGRRPLYIATLIVYLGANIGLALMPTTKYWLLLF
FT                   LRALQSTGGSAVISIGYGCISDVAEPRERGKYAAAFQMGAMAGPAFGPLIGGILTQGLG
FT                   WRSIFWFLAIADGVVLIPLIFFLPETLRSLVGDGSIPPPSLSASPVELYQRRKLAKKMA
FT                   ETGEELEPVHRPPPKPYRPFSTFAILLVPEIFLAFFFASLLYLQFYASLTLFSTALKNS
FT                   YGLSELKIGLCYLPSGIGSIISSQLNGRQLDYYFHREERRVGGDYRAKPEEFDIEKTRI
FT                   RCLFPFAVCSCLATVAQGWCLQAKANLGATLVMNFLVGLGSGTIGSVTVYGQDIKSNKG
FT                   GAVSAALNLVRCIFGAIGVASIQSMYNTLGAGWTFVLLTGLVVIASPLPIIVIKKGRGW
FT                   RDKRKEKKEAKNEEKKAKKEAKAEMTEKQVNTSDAETGVKGQIVNKTDVEAGVGTKI"
FT   CDS_pept        join(1000921..1001847,1001899..1002225,1002283..1002318,
FT                   1002372..1002587,1002645..1002944)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20636915"
FT                   /locus_tag="CNG03590"
FT                   /product="Cytoplasm protein, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAW44753.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG068272"
FT                   /db_xref="HOGENOM:HBG177368"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniParc:UPI00004B497D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK9"
FT                   /transl_table=1
FT                   /translation="MIAPKGLQWPGVSSTRYTSSTQSPLSSSDSRWTQLISAPCHFSLP
FT                   VFISTLKTLSLHPEKLFPAVLQGDILPLHQSSTTDRLSKDAEDEIRTTIPGLELIERIR
FT                   TRLVPNQPQRHIKLDQTSSFYRFSQSPEGAPQENSDTTTENDCGLVIFIPEINSIEHIP
FT                   YYYPQANRIAFLWDPSNINDGSEEKSGVRARISVHYLQTKSPSLMSHAPTNAHLPLAHP
FT                   ALGAMISRLNRPKRRSPLATISQESDVDRCQRLGVVDGSQLESGGIARSTKELENDLYK
FT                   QCQHLLEKVCKYGHDHFADSPVLHPRNGVIKPPESFESIYLLLKNRHCHLNPSFSKTDM
FT                   AKHRLTKLQAAPSDEWGIPANNISEWGQRDVAVAAYLMLLWKDMYPERPSANDQGKGEN
FT                   GKEWDTWGRPEGGFIDLGCGNGLLVHILISEGYIGKGYDLRPRPSWNMYPSKTKDALVK
FT                   QSLDLPGWFPRTEDEWELGSWVTREKCVVRDGAFIIGNHCDELTPWLPLLSIIPSPPVP
FT                   YISLPCCLHTLDSIYSHLNFASPSQSSNQCISLPAELDPTKSLYDSYIAWLGWYSLGCG
FT                   WECDIDKVGHGMAIGKGWAIIGKSG"
FT   CDS_pept        join(1003867..1004656,1004853..1005040,1005094..1005206,
FT                   1005255..1005372,1005424..1005714,1005767..1005798,
FT                   1005852..1005941,1006008..1006224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807751"
FT                   /locus_tag="CNG03600"
FT                   /product="Putative uncharacterized protein "
FT                   /function="endonuclease activity"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="AAW44755.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG068271"
FT                   /db_xref="HOGENOM:HBG177369"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniParc:UPI00004B497E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK8"
FT                   /transl_table=1
FT                   /translation="MRFLSLFRPPPLSAITTEATLRRQYPSYLPKSIPTLSHIETSMPP
FT                   RRSARKALQPSSTDMAPFATSPRSLEQSLAPSPPSKPPKATLLAVAMAMDEENLTPPSA
FT                   SDVEDDQVSKVVMNGAADRASIKRKRGSKMAVEEGGKVEIGEISSTKGRKRGRKSNAEL
FT                   AAAKEEAESEEELDFREDMAIPAKGKKNGQRITVESTATAKNGEQERTKKKAVKKSRIA
FT                   KDEPQYDDEGNEIVKRKRKPREYPKKVYEIPDVERKTTTFRDLKTLIQWNEDNKIRFMR
FT                   MSSEMFPFASHAKYGYSLDFADAELKEAGDLAKKYRHRLTMHPGQFTQLGSPKKAVVDA
FT                   SIRELEYHCEIMDRMGLGPDGVMIIHMGGVYGDKESTLARFKENYTTLTSDQVKARLVL
FT                   ENDEICYNVDDLLPVCTELDIPIIFDYHHDALNPSAGPPAELIPKIAEVWNKKGIKMKQ
FT                   HLSEPRPGAESIMERRAHADRCQTLPAELPDDVDLMIEAKDKEQAVFELYRIYGLEDVI
FT                   HDNLRPPDPNPSMQTKGRKSNLKKKTKETVDVDSQAEPVQLSDIEKEGDGGMGDEGIKK
FT                   NGQVVEIDDVGIEVDVDETKKMPKEKGRVKKKAVAE"
FT   CDS_pept        join(1007080..1007138,1007218..1008238,1008291..1009004)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI19789575"
FT                   /gene_name="Cnfkh2"
FT                   /locus_tag="CNG03610"
FT                   /product="Checkpoint supporessor 1, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44757.1"
FT                   /db_xref="EMBL:BAD89573.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG068270"
FT                   /db_xref="HOGENOM:HBG177370"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI00004B497F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK7"
FT                   /transl_table=1
FT                   /translation="MEAHRAAHPESIGVSRPRYPGIPLLRMKPPSPQRKNSWDLHSSGS
FT                   LSSSRASTPPSASSFHAPDPGVEGIPDGPRPLTRPQAPLAFLMGQAILSSSRGGLSLGH
FT                   IYRWIETAYPFFAADTAGWRNSVRHTLSTNKVFEKTDRTTDYPSGKGGIWTIKKGEEWR
FT                   WDGVETFTRTFQADSERVKSRNRTPSQTSETSTSSAAVIEPHSGPEPGTEGIPEGPRPL
FT                   ARPQAPLAFLMGQAILSSSFGGLSLEHIYRWIETAYPFFATDTAGWRNSVRHTLSIHKM
FT                   FAKVERTDKYPRGKGCIWTIVKGEECHWGENETFTKNFPPGHPHYALCRQTVWDKERKG
FT                   EGKKGGKRKKRLSDEDSELNSVPESGRMAPIESISPKVRSAHPLSNVPLPTDVPSVTSM
FT                   HEKRPSLPPLRSFSGPTLPPLSSFNLQSDSSFKGVHRRSESLHSLHSRKYSSEFELPPI
FT                   KRFRVSETLPSIDSPAFSASHDIRPTLPPIRDHLAREQTSASGSVASPPPYLPPIPFGA
FT                   NVASLYERTSLYPQKQISYERYSSSLDDDTPNDVYQYNKFDAAFGKANERMQVVEVDGI
FT                   GEVREDMGRRKPWNGFRFWVP"
FT   CDS_pept        join(complement(1012928..1013183),
FT                   complement(1012761..1012850),complement(1012516..1012701),
FT                   complement(1011819..1012462))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807752"
FT                   /locus_tag="CNG03620"
FT                   /product="Histone acetylation-related protein, putative "
FT                   /protein_id="AAW44759.1"
FT                   /db_xref="HOGENOM:HBG177371"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="UniParc:UPI000042CB65"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK6"
FT                   /transl_table=1
FT                   /translation="MPLKLNPRSPLPPFSFSTSPSPASSPHAQSQAGETPRPPADFLPE
FT                   KDMYMFGTYPLLAGNEEGRGLVKCGRCGKVGMEWAAAEHRRVCNHVLDGAPLVTKKSAK
FT                   IMDTKKRRASEDVSISPSKRARLPSPSSSIIPEEYKGLKKSEIKKLQKDKIRAEKREAK
FT                   ERERLEIAERKRQRANNPINYDRQCGVINDKGHPCARSLTCKTHTVGAKRAVQGRTRPY
FT                   DELYLDWQREHNPNFKEPVKKDKVEKKKEKKKGETEDDEVLAEGEEGRREISELIALTR
FT                   MAGERCKHHISTLGHIPPQPTLAPGVPPPAAPPRPQQRPAKKPPFQPTWRSSSSANDFS
FT                   DVGRMLVQALAARSRPAVGGLTVQVPVPGGGGVPGSSSAGVQGQAVKIPVS"
FT   CDS_pept        join(1013686..1014249,1014299..1014549,1014599..1014675,
FT                   1014725..1017322,1017377..1017559,1017613..1017783,
FT                   1017984..1019275,1019326..1019517,1019598..1019657,
FT                   1019707..1019770,1019827..1020028,1020078..1020231,
FT                   1020285..1020413)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807753"
FT                   /locus_tag="CNG03630"
FT                   /product="Protein binding protein, putative "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /function="calcium ion binding"
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAW44761.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG068268"
FT                   /db_xref="HOGENOM:HBG177372"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00004B4980"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK5"
FT                   /transl_table=1
FT                   /translation="MQSNQWGQYPYSQQQQPSFLNSQPTGFAGAGLQPMQTGFPQQQRP
FT                   QQTGIAGAQPGQNYAFLNQPPSSNFRGNGIAPQMTGFPGGTGMVSQQTGMMPQQTGFNA
FT                   SANAGRMMPQQTGFQGGMMSQPTGMMSQSTGMGLTPQQTGWQGGAGLMSQPTGIGRLQA
FT                   QPTGMPHDPRLQTMMQSFMPSNMSQPFSSGVPQFAQSSQPLQQTFQSLLQNPSVNTPKI
FT                   PWTLSRQEKKDYDQIFRAWDTKGDGFISGDMARNVFGQSGLSQDDLMKIWNLSDVDNRG
FT                   KLNLPEFHVAMGLIYRALNGNQIPDKLPEELVPASMRDIDSTVNFMKDLLKHESISRPG
FT                   TASPAYSTPASASKDALLYKHSDEVPSTYKPSSRHLDRKSVRYGGEDPDAGLKDIRRKL
FT                   ENTSSLLEKSAEKSAEDEELEEEIETLQYRVKRIQEDIEYTSKGRRTAEKDEERRKLER
FT                   ELLYLMHEKLPELERRQERRREEKAMEERAGVRRRDERNKTHGRFDDRDRDRDEYERYR
FT                   GTYDRERDRSRERDRYDYDRDRRDRSRDRSRDRYDRYDKYDRDRRDDRDRYDRPRSPTG
FT                   VRSPPPAPPPPSASATSSSAPPPPPAPTSSSSVPSTKNMTPEERKAYIREQAQRRIQER
FT                   LKALGVSSEDKEEEVDTSVQDRLEKERKEAEEKSRKAEEAQKERDEARKRRLAEAGGAA
FT                   AEPKSEEKPAEPAAPSLKSAMKKPAAPPPAPTPRSKAAPVPPPSRAHPAPAPPAAPTPP
FT                   TPQPPTPKPDEDDPEELELRRREEAAAKAKAERRARLEALQKEEEEERRQEEALLAARK
FT                   NRSLGASPVPPAAETPKKEASSSAAPSPAPPAPPAPPAPPAPPAPPAESAPSYNPFRKP
FT                   GGAPGATPSPAAPAGGFNPFFKPPAAASVSPSPAAESPALAAPPPPAPPPPPADPAFQP
FT                   PRGPRSPPSEPEWEDIAEKQVDESDSSDDEYTTSRAGRQGLAQALFGNIMGGSSPSTSR
FT                   PGSAAPQAPKEPPKALANVGGGNPEQGRGALLSAIQGGARLKKAQTVDKSGPPDIGRVI
FT                   GDAAPPSHIRETPREYAPPSPPAAAPGPVEERAPSPAPPSEDSFISGNPNRQSIDWYAG
FT                   LAADASHPAASVGETSMLEPPQEEEEEKEQHGYEQIEKPRVQIEGEDDLNEFDFATTIR
FT                   VRALYEFVGTRDVDLSFKEDVVIEAHPAKDESSPWWYGTVVKDGSKGWFPKNYVEHIQA
FT                   VRAKALYSYAAGDPDQLPFAEGDILEVVDRSENDWWKVENTGIIFLVPAAYLEIIDANE
FT                   TSRGLSTQVATDENLGISPEPAAPTDIEAQSMSTIPEVTSAMEQLKLPAEGYLEAEISD
FT                   SLQSTEDSRRLSAHSIPPPLRTRPRAISTLSIASTAMSHTPSFITDNEEDEGESSSDDS
FT                   ILSFWSSDESSSESEDETEPEEEPPADDKLAKIEKPRKERRAAPKPPKKEIDAEKEVER
FT                   KKREEQRQAILAATGLQLKREPSGAPAQRLGRVASRRRPAPNVPGRKRRHAPAVPEGKS
FT                   KKLPSPPSKEIQSDRLETGDAYARYEAFLAQSAQVQSQPLPRPEAVRTESRPPSQVLSP
FT                   QHTGPTAGAALSPASTTTSLPISTLSLGKETGGKITGFLKSMMTPHGHEPKRPSISGPT
FT                   ITRVDEPPASPAPGSGIFSSGEELDAGFGKTWSSLVEPSVLETMDKRERKRQEAIFEFV
FT                   ATEIGYNRDLQLIVEVFYTSLLPLLDEKALTVIFANIEDILLFNTGFLSALEERQKAAR
FT                   LYIDRIGDVLGFLNEAGVYMAIKLLQSLREEKPELDVHLKHIQATNSSIRGLDLSHYLL
FT                   IPMQRITRYPLLIKQIIAYTPYDSSDLPSLQSALHAVERIVSRINESVREAEGQERLRV
FT                   LSENLWIGGEGRLDLTAPTAFLGPRKLIKEGPVSKAKSGRKLSMVLCNDILVLLEDKSL
FT                   YRMPLALHEVEVRQTRDSMGFALKADQRRGGDTIALKCVLLFPND"
FT   CDS_pept        join(complement(1021787..1022211),
FT                   complement(1021690..1021732),complement(1021306..1021640),
FT                   complement(1020693..1021248))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15807754"
FT                   /locus_tag="CNG03640"
FT                   /product="DNA-(Apurinic or apyrimidinic site) lyase,
FT                   putative"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="lyase activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="AAW44763.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG177373"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI0000430211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK4"
FT                   /transl_table=1
FT                   /translation="MSRRPNLRSTKLALNQKVSIIPTDAVKAEPPSSKLTYSSLRRPTR
FT                   SSATVEELASPVKKNKLNIAKYEYKGSIPSPRKRPRIDDVVKEEEIETKASPIKSPAKK
FT                   PLPQVALAKPHAAPAKWEEQYRLIEKMRRGIVAPVDDMGCERPRTNTEGDPKTFRFHIL
FT                   ISLMLSSQTKDAVTSAAVTSLHTSLPGGLSAASLAAAPLETIQECINKVGFWRRKAEYI
FT                   QEAAKTLLEQEGDEKGDVPKTVEGLCKLKGVGPKMAFLALQCAWDINAGIGVDVHVHRI
FT                   TNRLKWHRPPTSTPEQTRLNLQSWLPPHLHKPINPLMVGFGQVICLPVGPRCDICLLGQ
FT                   KEICPSRVKGANAKGRKEVTYSFKEEEDELAIGQWRWGQAKGVKSEAKVEIGYEGGLEK
FT                   IKDEEPENSVEVEQMIKEPGMRRPDEVLEVLDQVDGPTDIGAEPVIKTENVDW"
FT   CDS_pept        join(1022421..1022507,1022560..1023437,1023488..1024014,
FT                   1024091..1024461)
FT                   /codon_start=1
FT                   /gene_family="HOG000242486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20636916"
FT                   /gene_name="ROK1"
FT                   /locus_tag="CNG03650"
FT                   /product="ATP-dependent RNA helicase ROK1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAW44765.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00004B4981"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDK3"
FT                   /transl_table=1
FT                   /translation="MASAFSLLTAGGAKFDKNRFKDDFQLFEAKKRKDRKGKSKQIDTL
FT                   ATGSALPSSLDFFGDHPHPQHKPEPEPESESESDFESDSGSSSTSIPAPPPQKITLTGA
FT                   EPLPKSLHTNLPSLVNHESHSLTSAEGGPLLSALSRANIHSLWGVQCAVGGCLLEDRDT
FT                   LCVAPTGSGKTLSYVLPTIVKLREPARKLKGTEEGKGVRALVVVPTHDLAVQIQGVIKA
FT                   VTMGRHWRSMVLTKATEKAVWESAPGEAVKTGEDGDSEIKDGEDSGDEEEDEDDNGSTG
FT                   SVDEFAPKVSGNPEGLGIDMLVATPERLHHLIDSRRISLARTKYVILDESDRLLSSDFL
FT                   PQVEPILSACSNPAVQKCFLSATMPAGAESLAKKWLKDGGVRVVVGVKDSAVTTVDQSL
FT                   LYTGSESGKLLALRNLISSGQLPYPSLIFVQSIDRAEELYKTLVLDGIKVDAVHGGKAK
FT                   TKRDEAIKDFRVGAVWMLVVTEVLARGMDFRGVKVVINYDFPQTVPSYIHRIGRTGRAG
FT                   RPGKAITFFNIEDGPYLRTIANVLRSSGCPVPEYMLDMKKPTKNEKKKLAKAPPKRKAV
FT                   GGGGRDLNREAGKKKKQMVEASKKRKMLERKGKGGNEEKNDDEE"
FT   CDS_pept        join(complement(1027312..1027719),
FT                   complement(1027174..1027258),complement(1027082..1027123),
FT                   complement(1026449..1026867))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093642"
FT                   /locus_tag="CNG03660"
FT                   /product="DNA polymerase epsilon p12 subunit (Dna
FT                   polymerase epsilon subunit 4), putative "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44766.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG068265"
FT                   /db_xref="HOGENOM:HBG177374"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00004B4982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK2"
FT                   /transl_table=1
FT                   /translation="MQVEYESSPAVEQPSFEEGMSFRPGSPQAGGAESEEEQDEEDVDA
FT                   GEGTSLFSFAYDEASFHSSEKGGIRADDASFSGSGAKKPARKRIIKQRQSLAEKQPGTT
FT                   MFPAARVKKIVKADRDIDIMSSEAVFMVSVAAEYFIKHFMEEGYTKARLEKRKLINYRD
FT                   MANVVARSEEFDFLKDVIPTPMPLSEAIEKRKRKVVAEENLDEDAPASSHLNDEDLPPL
FT                   VPSTNPAFPNAIVKKPSNTHAKGASAAKMKADAPTSEKEELRSVVSNAQGTRKSARRST
FT                   MGAEDEADKSYLNELREEGADEEAITSDGDEKMDEE"
FT   CDS_pept        join(1029547..1029612,1029667..1031249,1031300..1033191,
FT                   1033248..1033603,1033658..1033795)
FT                   /codon_start=1
FT                   /gene_family="HOG000208945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808787"
FT                   /locus_tag="CNG03670"
FT                   /product="Adenylate cyclase, putative "
FT                   /function="phosphorus-oxygen lyase activity"
FT                   /biological_process="cyclic nucleotide biosynthetic process"
FT                   /protein_id="AAW44767.1"
FT                   /db_xref="GO:0009190"
FT                   /db_xref="GO:0016849"
FT                   /db_xref="HOGENOM:HBG177375"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="UniParc:UPI00004B4983"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK1"
FT                   /transl_table=1
FT                   /translation="MKPANLVCRFIYQAPILPIMDPEEESSYDSFEFIDIANRDLQTIP
FT                   IFLHLHAHDIIILNISKNPMTDIPLDFIQACTSLKELRMSNMALKRVPISIRASTTLAR
FT                   LDVSCNRIADLESVALHEVETLVSLKVQNNKLTSMPSYFAQMKSLKYLNISNNKFETFP
FT                   SVVCEMSNLVDLDVSFNNIAELPAKMSDLKSLEKLGLYSNDISNFPESFSTLANLRILD
FT                   VRRNKITDLSAVYALPNLATLQADNNNIVTLDAQLGANVRQFSVPHNSVTRFTLAPPPN
FT                   MAVVTYMLTNLDLSHGKISTLADEAFSGLTNLITLNLNFNQFTKLPATLDRLTSLEVFS
FT                   CTDNMLNLVPAGFGKLRRLRVINLHNNNLKSLPEDLWACGALEIFNASSNLLDSFVPPP
FT                   ADIESVVGRVGSGTSQTSNGRKKHSVPPIGLSIRKLFLADNRLNDDIFHWISLMPSLRI
FT                   INLSFNDIYEVPPFTLCKCERLEALYLSGNKLTSLPSEDLEKLQSLKVLHLNGNKLQTL
FT                   PSELGAIKTLQHLDVGSNVLKYNIANWPYDWNWNWNTSLRYLNLSGNKRLEIKPTSAHE
FT                   MNHASSFRKELSDFTALTQLRVLGLMDVTLRIPSLPDESDEKRVRTSFSDINNMAYGIS
FT                   DMLGSIDNLAMFDLVVPHFRGKENECLFGMFGRATTTLQGGKIAKHVQEIFAETLTAHL
FT                   HKLEPGEEPSEALRRTFLWGDRKAFEFFSGKLQLEKERKPSWTSFASFDSMFRGWTPGV
FT                   NSVLRTGASGAVVYLVDKVLHVGSIGDTLVVLSRKGDAELLSKRHDPTDREESARIRKA
FT                   EAWVSTKGFVNDDKDLDISRAFGYWHECPAVNAAPEIRTRRLQESDEFVIIGNHALWQF
FT                   CSYQTAVDIARTERDDPMIAAQKLRDFAISYGAEGNVMVMVVNVSDLFLGKGGRARGPS
FT                   EQTAADASTDVEGYTVAKRQVRRRYDEVGDRTLNRLQQEIEPPVGQVAIVFTDIVNSTH
FT                   LWETNPAMPTAIKMHHNLMRRQLRLDGGYEVKTEGDSFMVSFQSVTAALLWCFNCQIGL
FT                   LQQEWPRELLEAHDGKVVHDSNGTIVQRGLRVRMGVHWGAPECEKDPITRRMDYYGPMV
FT                   NRAARINASADGGQLMASQDVLNEIAPLMEYLNSSDEQVLNDLQGDLKREVMELRRIGL
FT                   EVRDMGDRKLKGLEVPERLHLLYPKTLAGRLEISNEIRAEVEVNDARKSAERQRSVDID
FT                   QVCQLSDIALRLEAVCSYNPTPSSPGDTPTAGVMRLHPPASYLGPSIREDMNDEELWTI
FT                   IESLVGRIENAMSTLYLKNFGEFSTVLAALESATKIDQKLIVHALALMNEAMGNAEENA
FT                   I"
FT   CDS_pept        join(1033961..1034534,1034596..1035657,1035710..1036134,
FT                   1036181..1036378,1036425..1037642,1037695..1037953,
FT                   1038013..1038143,1038195..1038800)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20637153"
FT                   /locus_tag="CNG03680"
FT                   /product="Ubiquitin carboxyl-terminal hydrolase 12,
FT                   putative"
FT                   /EC_number="3.1.2.12"
FT                   /function="S-formylglutathione hydrolase activity "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAW44768.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0018738"
FT                   /db_xref="HOGENOM:HBG068263"
FT                   /db_xref="HOGENOM:HBG177376"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00004B4984"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDK0"
FT                   /transl_table=1
FT                   /translation="MGAGGRVLLVREFSSAALSPAGCRPPTPPRHCLSSFHSISAPSFL
FT                   LFLYPKSARVPTDIPTKGHFENLFMSSQDLPGTLKRPRSTSRPPSPSSGSSPKRAASED
FT                   PFPSSSDSGRVFDHLITDNGGMVAASSPLRQDIGDNESNKSWVELTQQVKLGSDGEEDV
FT                   EGDTTLRTEGRFFLVSQEVWKERNNELLGLLPPPFNHYERYYILPKSIVQKVQLLALGD
FT                   ANDIAVQPEDFAEAMKELVPDHSAESFWVIQSEKTVAGHKLIGKAKKEDVWALGDAEEN
FT                   EDYVFVPETGWQKVLEWFGPYDGPSLPRYCVPPDNIEIIPANLRLFIVLPADAITTAGQ
FT                   PDESIQSVLLAPSTTPIKTFESFAVSVCNQEIDRSKLAGQWATRLWKIEKSGENDESLL
FT                   KSGSLEITPKALISTKCQLIDTSSAEENLAEAILGSSKSQIIAIEFGKIPEGSSTPVWN
FT                   VEVNNDKQAVEKSNKPPPLFSKPAFFSGSGKAASESASTTDAIQTRSQTRERKGKGLVG
FT                   LQNLGNTCFMNSAVQCLSNTKELSQYFLSGVYTEELNRDNPLGMQGQIAEAFGQVVENL
FT                   WAPTSSMHSSYSPRQLKWTTSRFAPQFAGYGQHDTQEFIAFLLDGLHEDLNRILKKPYI
FT                   EKPDWKPGGGDKELAELGKECWDGYKKRNDSVIVDLFQGQLKSTLVCPECHKESITFDP
FT                   FMYLTVPLPIAQNRQFKITFVPRDTEKPPVNVKLLIPQNASFAQVKDKIGSLFDCKGSS
FT                   IVGFDLWNNRPYAWWADSDHNSEAKDTDEAIFYELDPSVSVSVPRGKFGSQPRTTSQDG
FT                   SLTVPVYTFRTVENSRGGYRAGDVPSDLSLKPFFITLTKAEASDPNAVREAIMRGYTRF
FT                   MKPEAKENIYVPASSAQAKAPTPPKSDDGEPGTEIHMSGDQATVVEVPSSRQSPAIGAE
FT                   EPGEGAPMELDSASASTSAVTGIQLSGSTTSLLSTNSIRSSISLSGKLVPRADLFKVYV
FT                   ADPTGDFSFKSFRSNEKKYDAAHLYDKDITSASKSWSLLESRKKKAKKHIVNRLASGIS
FT                   SMVNPSNNSDDEVLSDGSTSTSPNKLEKMKEKLTNSKLAVRPGEGIFCEWSGADFAEWL
FT                   NDNVKGEDVIDPAISKELVKKREGKHIGIEDCLDEFSKEETLGQDDLWYCPVCKKHQAA
FT                   TKKLEIYKAPDILVICIKRFGSSRRMGDKLDNLVHFPIDGLDLEDRIGERQVAKTLKLN
FT                   GEDVEGYGIEDDGEPLLYDLYAVDNHFGGMGGGHYTAFCRNQVDNQWYNYDDSRVSKAD
FT                   VSSVQSRAAYLLFYRRRTNRPIGGESRIKAEEAARNVPSASASPDAGPSTESSTMPSTA
FT                   FVSARTTPTRDLSPATFSDELPSYSQVPSPPTLDTSAPPSPTVSDDSFPVTGTYSQGVD
FT                   IASVGQSIGFGNTAWGSPAKVPESGHSFGTMTRAEWLDPPAQSVDMGRMSTNMDVEEDR
FT                   SDVLTALQGDEGDEGTRGTKDEDVEMELQ"
FT   CDS_pept        join(complement(1040353..1040399),
FT                   complement(1040084..1040291),complement(1039137..1039997))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808788"
FT                   /locus_tag="CNG03690"
FT                   /product="Expressed protein"
FT                   /function="ornithine decarboxylase inhibitor activity "
FT                   /protein_id="AAW44769.1"
FT                   /db_xref="GO:0008073"
FT                   /db_xref="HOGENOM:HBG068262"
FT                   /db_xref="HOGENOM:HBG177377"
FT                   /db_xref="InterPro:IPR002993"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00004B4985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ9"
FT                   /transl_table=1
FT                   /translation="MNPTLSMPINRNLRPAGAVGSVGAGASISTSLLFSPNYHHDTDNA
FT                   YCPPLAIARAGGKGGQIFVYSEDGTTTSGYSSFAGGGRRWDDDIVGQPSENAREPLTSY
FT                   LHQHFSQISCIDHPSTQSFHSHSHGPTSDLITPPSSFTQSVEIPRARIASSSRPSVSLP
FT                   LTPSSTPSVSGQHDSPEQSSASGVSDRGKYANSVSSLIASIFPQHAPTVSLLSHTLEIL
FT                   TPPSHILYGFIVDYPAPYSSGRTVFVYLPPGHGTANQRPEALSPNFSQILRPHDPMFSN
FT                   SPPKDTSPVSNTAYALDIRESLTALLDLAAEALEASHCVLVLNRSESEQEALGEMLHSL
FT                   MYVGGQVIKPGGLEGGWEWDTMEWVLVGMEL"
FT   tRNA            complement(1040648..1040734)
FT                   /gene_name="tRNA-His"
FT   CDS_pept        join(1042039..1042210,1042279..1042495,1042556..1042733,
FT                   1042811..1043105,1043161..1043260,1043316..1043838)
FT                   /codon_start=1
FT                   /gene_family="HOG000089106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20637154"
FT                   /locus_tag="CNG03710"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAW44770.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG057761"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000042FBC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ8"
FT                   /transl_table=1
FT                   /translation="MPAPIPPASPWGPQTLPPTWTLSEWQHTTRQDPLVNHGKDDHLPD
FT                   KVDIVVIGSGLAGAKTAHSLLSSSPEDSRPSLVILEARETCSGASGRNAGHCRPDAFRG
FT                   FTAFSKIHGKDEAAGVLVSESITLDRVKDFVKEHDVDCEFTERMTLDVVLNEEFKDYCQ
FT                   TAMREAKEHGLDVSHIKYFEGEDAKKLTRSPRAIAAYQWPAASLNPSKLCYAVHRVNLS
FT                   LGAKLFTWTPVTNVTEASSSGEDGAYKWKVETSRGSIATKKVVYATNGYTSLILPEMDG
FT                   LIISHKAQAIKLTPPPLGMDAFPRIKDTMSLRYLDRFYSVMQRPDNSIVLAAPRKWPSQ
FT                   DPSTFASLFGTYDDSQPLPERTANAYSEFAKTLPGGGYRVEKDERGVIKEGHGGLDYSW
FT                   SGILGVTPDNVPFLGAMPGKEGQYIIAGFNGHGMARIFHLAPCLAKVIKGEEWDETVPR
FT                   CFEVTQERLEKLKRDAGKSNISVVSELEEKAKGIKI"
FT   CDS_pept        join(complement(1045032..1045093),
FT                   complement(1044794..1044977),complement(1044611..1044715),
FT                   complement(1044333..1044560),complement(1044229..1044276))
FT                   /codon_start=1
FT                   /gene_family="HOG000211544" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15808789"
FT                   /locus_tag="CNG03720"
FT                   /product="40S ribosomal protein S8, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAW44771.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG245558"
FT                   /db_xref="HOGENOM:HBG745393"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI000042DA95"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ7"
FT                   /transl_table=1
FT                   /translation="MGITRDSRHKRAASGARRAHYRKKRKFELGRQPAMTKLDSSKRIH
FT                   EVRTRGGNVKYRALRLDSGNFAWGSESVTRKTRLIQVRYNATNNELLRTQTLVKGAVVD
FT                   IDATPFRQWYESHYAQPASRGAKSAVTEEADKKQSNHVKRILEERKKVAKIDPLLEQQF
FT                   RAGRLLAVISSRPGQSGRADGYILEGKELEFYHHKLQIRKAKHAA"
FT   CDS_pept        join(complement(1048261..1048361),
FT                   complement(1047980..1048208),complement(1047583..1047930))
FT                   /codon_start=1
FT                   /gene_family="HOG000037974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15808790"
FT                   /gene_name="URA5"
FT                   /locus_tag="CNG03730"
FT                   /product="Orotate phosphoribosyltransferase "
FT                   /EC_number="2.4.2.10"
FT                   /function="orotate phosphoribosyltransferase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="AAW44772.1"
FT                   /db_xref="EMBL:AAA33076.1"
FT                   /db_xref="EMBL:AAA99182.1"
FT                   /db_xref="EMBL:AAA99183.1"
FT                   /db_xref="EMBL:AAA99184.1"
FT                   /db_xref="EMBL:AAA99185.1"
FT                   /db_xref="EMBL:AAA99186.1"
FT                   /db_xref="EMBL:AAA99187.1"
FT                   /db_xref="EMBL:AAA99188.1"
FT                   /db_xref="EMBL:AAB17140.1"
FT                   /db_xref="EMBL:AAB17141.1"
FT                   /db_xref="EMBL:AAB17142.1"
FT                   /db_xref="EMBL:AAB17143.1"
FT                   /db_xref="EMBL:AAB17145.1"
FT                   /db_xref="EMBL:AAB17147.1"
FT                   /db_xref="EMBL:AAB17148.1"
FT                   /db_xref="EMBL:AAB86885.1"
FT                   /db_xref="EMBL:AAB86887.1"
FT                   /db_xref="EMBL:AAB86889.1"
FT                   /db_xref="EMBL:AAB86891.1"
FT                   /db_xref="EMBL:CAD88485.1"
FT                   /db_xref="GO:0004588"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG404341"
FT                   /db_xref="HOGENOM:HBG465843"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniParc:UPI0000132CB3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18132"
FT                   /transl_table=1
FT                   /translation="MSSQALDSAKVAFIEAAIEHGVLLFGNFTLKSGRQSPYFFNAGLL
FT                   YSSSLLSTTAQAYAKVLSSSRIPDFDVLFGPAYKGISLAAVSAVSLYQQTGKDIGYCYN
FT                   RKEKKDHGEGGTMVGAPLKGRIVIIDDVLTSGKAIREAIDILKASPEAKLVGIVQLVDR
FT                   QEKGQSGSGKSTVQEVEEEFGVPVEPIIGLDDIVKYLESSGKWEKELQEVRKYRAEYGV
FT                   QRS"
FT   CDS_pept        join(complement(1052709..1052964),
FT                   complement(1052617..1052653),complement(1052412..1052558),
FT                   complement(1052172..1052359),complement(1051851..1052122),
FT                   complement(1051744..1051799),complement(1051554..1051684),
FT                   complement(1051306..1051502))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942991"
FT                   /locus_tag="CNG03750"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAW44773.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG068259"
FT                   /db_xref="HOGENOM:HBG177379"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00004B4986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ5"
FT                   /transl_table=1
FT                   /translation="MAQTTKPVLVIYGATAYTAQQLFTYLEEHPEAGDFDFILAGRNQT
FT                   KLDKLNGSLKIQREVIACELSDEEGVEAMVKRGNVIVNFAGPYRWHNAEAIIRACSKAG
FT                   KHYIDLCGESAWLAKDIIPKYHSIASSTGACIVPSCGFDSVPSDLIVHLANQTLQTVRP
FT                   GSTLADSTSIFKVKGTISGGTVQSMITLTELPKEERRAGEFTLCPGIQLPSTPPALTFS
FT                   LPSTPLTPARFASFFFMYVYNRTVVRRSQFLSGALSTKSGGKVMKYAEGLDIGYGKFGS
FT                   ALATIGMMVFGGLFFGFKCLRNIILRYLPKQGEGAPLEQLKAGHYQVTNLSTEESSAPD
FT                   HKPVKILTRFDGEGDPGYLNTCYLLAESALALVLPAPKGTSRPPLAKAGGLLTPATAMG
FT                   DVLIERLRKSGKFQITSEVLSEEKKKDI"
FT   CDS_pept        join(complement(1058430..1058873),
FT                   complement(1057923..1058346),complement(1057260..1057867))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808791"
FT                   /locus_tag="CNG03760"
FT                   /product="Putative uncharacterized protein "
FT                   /function="RNA binding"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAW44774.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG068494"
FT                   /db_xref="HOGENOM:HBG177380"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniParc:UPI00004B4987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ4"
FT                   /transl_table=1
FT                   /translation="MTPLSDRIAQSSTSLYETLPKHGKPSVRDNGVPEWTILSVISLVV
FT                   RQPSTFDSDHSDVVIPVSLGTGVKVLPHQRLPPLGDAVHDCHGEVVARRGFVRWLIFQA
FT                   ALLDQKENGEIGQGPRALYVERGENGKLKLKDGVDVWLYVSALPCGDASTLYTAMHQPP
FT                   EEASQWTEPPIPQDTPAPSSTSLFASSHPLRGRNTYSTVSTLRTKPGRPDSPPTTSMSC
FT                   SDKIAIWVCVGLQGGLLADLYEKVKLEGLVIGGVEQPPEWTDRKNVWEDKIKAEAARAL
FT                   YGRLESIKSMLPKEYPLHKPQLHFTPMPFSHSKPSISSTYPTAPEPQPSPLSLSFLPWL
FT                   LIPDYKPGKPPKQSEREIISNGTRLGFPWKAPGTTPVRPKGRSRLCKIETLLAYEGLLD
FT                   TRQLKDQKTYWEYKHRSMSAYQTAKSLLRGIPKKVPGTGVWQQLGEVWSTFAPEGLIED
FT                   KQAPPFKGWLVSGKDYESFTSVGELLRGADNIS"
FT   tRNA            complement(1059047..1059118)
FT                   /gene_name="tRNA-His"
FT   CDS_pept        join(1059443..1059699,1059884..1060014,1060065..1061458,
FT                   1061515..1061820)
FT                   /codon_start=1
FT                   /gene_family="HOG000195514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808792"
FT                   /locus_tag="CNG03780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44775.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG737652"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00004B4988"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ3"
FT                   /transl_table=1
FT                   /translation="MSIYDTEFSRRIRSSITVPPSPVSQSPRYDLRSTNPAVASSSRLG
FT                   PAGVEARESKMDVFGSVGMTPTKSSSPRLKGKGITREYGDRFIPTREGSDLHAAYQFME
FT                   GVRGQVKVKTRRKSGQLPSDGDVRREQVQATFTHLLKTELFPSPTSSPRPNNQPAKTRH
FT                   QKLAQPMTFDNSNIPSNPPSYPVSSAGNTPLHHRPPPMALPASGPGNPSGAAMERELSP
FT                   ASTLPPLPMHAPSTPTSGHGRPPGAGPSSSHHRAHQSQVALTASVPRGESNSQSATRRS
FT                   AFSPPPNSSTNGGFSPSTPTKKRILNFGSPSRTAGLSGVTNRAETLEDMSHPAYSLSPV
FT                   GKESQRVLLSPQKGVRAIPKTPFKVLDAPDLADDFYLNLISWSASNVLGVGLNSCVYLW
FT                   SAQSSKVTKLCDLAAGVELGEGGDVIRGLEWTNKGSTLAIGTNNGLVEIWDAEYCKRIR
FT                   VMSGHSGRVGALAWNSHILSSGSRDRTILHRDTRIPDQYIRRLQGHHKQEICGLRWNCD
FT                   TDQLASGGNDNKLFVWGGVDARPTWRFGEHRAAVKAIAWSPHQRGLLASGGGTADKKIR
FT                   FWNSLTGGLVSEIDTGSQVCNLMWSKNSNEIVSTHGYSGGPISNQIHIWKYPSMTQIAT
FT                   LTGHNYRVLYLAMSPDGQTIVTGAGDETLRFWNAFQKAKGEVGYTKGPVGATVGGFGGL
FT                   R"
FT   CDS_pept        join(complement(1063352..1064823),
FT                   complement(1062611..1063294),complement(1062478..1062556))
FT                   /codon_start=1
FT                   /gene_family="HOG000294222" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20637155"
FT                   /gene_name="CCR4"
FT                   /locus_tag="CNG03790"
FT                   /product="Glucose-repressible alcohol dehydrogenase
FT                   transcriptional effector"
FT                   /EC_number="3.1.13.4"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="poly(A)-specific ribonuclease activity "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44776.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004535"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058508"
FT                   /db_xref="HOGENOM:HBG444228"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00004B4989"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDJ2"
FT                   /transl_table=1
FT                   /translation="MFYPHHQSQQSTTTNPSKHHDSQDVRLPGTSSWSRHPSHPSFTPS
FT                   LPMPSPSGYPPLGSGYPPGGHHHPNVNVHSGIHGPHPSFGSGMGGNGGMGHGQGFGMGM
FT                   FQNGVQTSPPRGEPVPMTSHWQTQMMRAEASRSASSPHHRARAAAISSRATNKPSAVPI
FT                   VDPNNRPSSSYGTNGLHRKNASSVFNGEPTGTPPLSDPSLTPAQNPAEPATPAPVAGQT
FT                   ESKDEEKPNEPWTGLDLGGIRLKRLSTALFSFTHVTSLYINHNALTSIPSAISSLRQLT
FT                   LLDATGNELSTIPSEIGVLSKLKDLLLFDNNLTTLPFELGTLYQLDCLGIDGNPMNADY
FT                   RKKLVEDGTRGLITYLRDHAPPPPPPPERQWIDLETDVDTPTSGKQESFSVLTYNILCA
FT                   SFAPATTYSYTPSWALDWDYRKRLLLEEIVTASADVVCLQEIDCKQYADYFYPMLKKEG
FT                   YEGQHYPRSRAKTMSVDEQKLVDGCATFWKEEKFRLVETQVIEFNQLALQKTDMRTEDM
FT                   FNRVMSRDNIAVVAALEFRASGGRLLVANSHIYWDHRYRDVKLVQIGMLMEELEKIVEQ
FT                   FSRYPVKLDTDPEYNNGKPPKYERSEKGRDIPLIMCVDLNSFSGSAVYDYLSSGSIPGD
FT                   HEDFMSHLYGRYTASGLKHHLGLRSACAGIGEMRMTNFTPTFAAAIDYVFYTPRTMKVT
FT                   SVLGDVDKAYLDKTVGFPNAHFPSDHIPVFTQFRIKGHLDPLPLNGDPYH"
FT   CDS_pept        join(1066039..1066277,1066325..1066556,1066620..1066788,
FT                   1066839..1067347,1067395..1067625,1067680..1067830,
FT                   1067886..1068043,1068278..1069669)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942992"
FT                   /locus_tag="CNG03800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44777.1"
FT                   /db_xref="HOGENOM:HBG068493"
FT                   /db_xref="HOGENOM:HBG177381"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00004B498A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDJ1"
FT                   /transl_table=1
FT                   /translation="MTNPPSPTLSCRLTPCIPSSSGLSTPTFGAGSQSGYDGETPHVLQ
FT                   RAIMHGEDVPESPIIDRDAGTDFPDVSGDQGGFAGPSRSFRKAPTPQFLNDPSPQTILP
FT                   LLEEEEVAQELSENVDEDRELRTTLILRHALQWGIERGDVELVNWLVSLNGRWRSILDH
FT                   EIRDLEDEEGWGIVGMAIHHSCGRQDREEIVRAAVSRWGVSAGPRGGRDRRGWTPLHLA
FT                   VLVSTPPLISFLLSHGASPHLLTNRGLTPLDLVADIPGREAITLFLEHAISVPHPSSPR
FT                   TSTIFIPKLPPARQKMLKKRRRRARGHLEKMEEQDRKEKIRIERAKWIVDQIRAVEVPP
FT                   ELVFGKEENSKRKREDVGGSGWSGQDIEEDDVDNEDDDVEEDEMNPASIANMLVFSLVN
FT                   LPEIFDILISNYQPISQPLSKRTLPANMLCYYARFAYHMCDETWLEALIEGAIERIEEG
FT                   VYENVENLAYLAFWAYNSCVLLHHLQADEALQEACDELGLLAILEELINAIHVFVIRIA
FT                   ERRIDTVLDAAILDYETLEDFNDIRFEGEWSLFRSFVSKKKRDTPKLYEVNPALIVQAF
FT                   FQIYFWIACELFNRILTRRKYLCRSKALQIRMNLTFLDDWVRANGLPAQTSTKHFAPLS
FT                   QLLQWLQCLSRITEFDTLIGTMQNMKAINPLQMRRAVREYRYEVNEGRMSDECAQYLVQ
FT                   LQKDWEKRRVQLSMQEAERMRSASEWSEGSYDGTGMSGGSGYEESATLIDALFDGSTML
FT                   ADFVPHSAPESLDELLDSRYMLPFLLPEDNAYLIATPPTDAAYANLHIPSSPFVTDTPT
FT                   KRPLSHTGYSSSRSMGYKIPNMGRLRDLPPDFFKWMKEKEIELKLGREALRVEKKTVPA
FT                   LSHPLGPSQKANVTINTPVRPPPEDKTNLTPTRTPTSNRRKSGNLASPLPIEGAELSTT
FT                   LSMLYPSTTPTKLGAGLPSPGLRSSASINELREKKLAERPFEAIQEEMPSHIRSESYEM
FT                   RMRTTEMLRQNSAESVSSSGSRLSCGSGANDDSGKKR"
FT   CDS_pept        join(1070224..1070632,1070731..1070842,1070898..1070984,
FT                   1071054..1071177,1071242..1071417,1071466..1071569,
FT                   1071618..1071703,1071756..1071863,1071910..1072017,
FT                   1072067..1072258,1072309..1072824,1072877..1073359)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18093905"
FT                   /gene_name="SET2"
FT                   /locus_tag="CNG03810"
FT                   /product="Histone-lysine N-methyltransferase, H3 lysine-36
FT                   specific"
FT                   /EC_number="2.1.1.43"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44778.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG177382"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR013257"
FT                   /db_xref="UniParc:UPI00004B498B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KDJ0"
FT                   /transl_table=1
FT                   /translation="MGDIIEGTKPTLDDLWAGDEDQKPQTPPVSPPRSPSFKHEHKSSF
FT                   PGSTSPPPASPIGEEDLKPRTARASSSTSKVKSRKASPEEFKPVLIDDLPTAWDEAHET
FT                   FEALEKCVYERKDIGLSKENDEMMVCECVYNRHDPDADPCGPDSDCINRALYIECIAGE
FT                   CRAGKHCHNQQFSKRQYANVDVVLTEKKGYGLRASSTIPANTLIYEYIGEVVAEKTFRK
FT                   RMQQYADEGIRHFYFMMLQKEEYIDATKKGGIGRFANHSCNPNCEVQKWVVGRRLRMGI
FT                   FTKRDVIKGEEITFNYNVDRYGHDAQTCYCGEPNCVGTIGGKTQTDIGTMNDLFLDALG
FT                   ITDEVEAMGMKGSKKKKSRQLDEDFVPILRPISAHEVQKVAAAIRQSMENKKMMSRLLQ
FT                   RIQMTDDGAMHRQLMRMHGFSLMYMVLTELADDNEIVLLALESMNKWKLQIRNKIEDSK
FT                   IEEPVKALSQSGDEKICGLAKQLIEYWSTLELSYKIPRVSKIASLDADDEAGTQTIAEA
FT                   NVVSAARRPDAWENTQEIQIDIAPVRPRTLPVSRPRPPPPPPPLPVKKPALNSMSSTDR
FT                   LKLDAIIAMAEQTVQAQAAAAAVEATASPQAGSSRSGSRPAEDEERRKRQKRTHMTEEE
FT                   LAEQKERRLRKLIGAVVVKSMNKYKDMMEHDTFKKYARECTDTLVKKEKKRNPSYQDVK
FT                   HPSLSDDKKAKIKSFTKDYTHKILKHLKEKGKLRNPKSSSSLRTNSNDPRQAASSSTNG
FT                   DTPSISTTPSQGAIQRLRDGELVDDIFGADEDMVMDLDEDTPEMQNDHPAPPSVPPATP
FT                   PLPPVHVEVVDNVSTPTSQWET"
FT   CDS_pept        join(complement(1075029..1075469),
FT                   complement(1073595..1074923))
FT                   /codon_start=1
FT                   /gene_family="HOG000269479" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808793"
FT                   /locus_tag="CNG03820"
FT                   /product="Protoporphyrinogen oxidase, putative "
FT                   /function="oxygen-dependent protoporphyrinogen oxidase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="AAW44780.1"
FT                   /db_xref="GO:0004729"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG193530"
FT                   /db_xref="HOGENOM:HBG450176"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="UniParc:UPI00004B498C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI9"
FT                   /transl_table=1
FT                   /translation="MLCMYLLSTPAGGGGPPLSVSTRDAFSNRRSQRLDRIYFVPITSF
FT                   LLATSFAIPKTMSPPPKHITILGGGLSGLSTAYHLSRVLPASTKISLVEGTSRVGGWID
FT                   SQKHELGFKDQRGQMREGVVGIETGPRSIRPRGSRGAASMLKMLEDLGLENDIMPIPFS
FT                   HPSAQNRFLLDYSTSKLTALPSSLTSFLGRQPPLLKGLLSAGLFEPLKPKAPRKHLTAD
FT                   KDESVDAFFRRRFGDNVADNLASAMVHGIYAASSSQLSLRSAFPSLWEAERKYGSVVIG
FT                   MLLGTKTAAEKAEEKREWEELGEVGKEREKWSLYGIKGGLGTMTDKLLDRISSRGVEII
FT                   LGEPVRKIELSSNQEIAIHTHSHSLSTSHVISALPPRVLARTLSSPLPHLTHNPSTCVG
FT                   VVNVVYPLPPTSIHSAGFGYLVPRPPTNLNPNPSPNPSGVLGVIFDSTALPPNPPELGG
FT                   QVTKLTLMMGGPYWANYSPRISPPSDPEELLPLAIQHLNTIFPHLRNVKPILAVCNIHH
FT                   NCIPTYLPGHGARLREMHEAIESGEWNGKLSLVGSGYGGVGVNDCVLPGVDVARRLAKG
FT                   KEVTGLEAWKDWE"
FT   CDS_pept        join(complement(1076928..1077179),
FT                   complement(1076651..1076855),complement(1075898..1076229))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808794"
FT                   /locus_tag="CNG03830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44782.1"
FT                   /db_xref="HOGENOM:HBG068491"
FT                   /db_xref="HOGENOM:HBG177383"
FT                   /db_xref="UniParc:UPI00004B498D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI8"
FT                   /transl_table=1
FT                   /translation="MQRKRIRLIPRLIPAPTLRSYYPHFTSSISHFFLIFLLNATAMDV
FT                   DKSLDDIIADKRQPKPQQQRRPHGPRHSAGNTPRQTPYARPPPRSTSEKWTHDAYRGPG
FT                   ATRGGRPAVAPSRAPVPLTTGSPVFSRESPRIEIIGLHYEVSAEDLKVGSAWMEYANVQ
FT                   QAKIAINKFDGAMTKGSFRFFLSAVSRLTCAILAGQTISIRFAVPRFPPSAIRGRPGAG
FT                   RGAASGQNLLSRIQGAPGTNVSARVANDRGAKVARGARGG"
FT   CDS_pept        complement(1077537..1078178)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808795"
FT                   /locus_tag="CNG03840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44784.1"
FT                   /db_xref="HOGENOM:HBG068490"
FT                   /db_xref="HOGENOM:HBG177384"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="UniParc:UPI00004B498E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI7"
FT                   /transl_table=1
FT                   /translation="MSYKIGVILGSTRRASNTLGFSNYFASLVSIHFPNLTLETVHLAN
FT                   SPGHPLPLLLEDIPPAGHPKDTLPDAYKDESVRKWSATVLGWDGAIIITPQYNWSLPAP
FT                   LKNALDHLFNEWVDLPVGLITLGGHGGSKVHDQLKTICGGGLDMKVVEKGVEVKIAGEL
FT                   IRGKERMHGDEAWLKEYDGRVKDVVKELVALVEKRRGEKEGDVVAAQVTA"
FT   CDS_pept        join(complement(1082460..1082713),
FT                   complement(1081692..1082412),complement(1081186..1081642),
FT                   complement(1078882..1081136),complement(1078627..1078827))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808796"
FT                   /locus_tag="CNG03850"
FT                   /product="Protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44787.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG177385"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000042D9D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI6"
FT                   /transl_table=1
FT                   /translation="MDSPGTAPTTDFALIESQKENIRPLATGRSAATLSTVFKESSAAD
FT                   KLLQQGHEQHRKAIQEADRRDAADEDMPDGLSDVLDVYNQYILFTVQHHPSSDAHLLPL
FT                   LETTTRRFINDARYTHDIRYLKLWIMYARQIDRREEIWAFLESRDIGTRHSLFYEEWAT
FT                   TLEGMGRRKKADEIYRLGIARKASPLDRLKNRHKQFLERIMAPPSGVVPDDDPALAPAR
FT                   TPSRSVLGQVRTAPSSSLSGATQLAPSLRSTSVNNGRKMEIFADEEGKAEDSPASEWPE
FT                   FGSRDERKKENTIEAGPWKGETLPQSAARGRVAPRTPKVEVFQDGEEGVAPVQTNFEVF
FT                   SRHKQPPTEAELLKSDPLRHYDTTNLSTDIPSLPAPPSARKPPKPSKPTSSAPVSTKPS
FT                   SNANAVRHVMQPWTCPTDGPLIKLANGKEERRMFNWDLVYKDGEEWSFEEIRAKQRGLY
FT                   AKEWRGEVQEWERQWHKPGSSTPPKPKPLEQCKPPSPTVNTKLAEAEVMRMFDQTIHGG
FT                   KIGDSDSESDSEDDDEEDDNPIQVAPTPLPARTGSIQMLAPTPGGFVPPTPTPNAASRL
FT                   FSNNENTKPVVFSDENAVPPSATKKKFNIFSDDPENNPTKTPLGPAPPSATKPRAFGIF
FT                   SDESQTPAKALPLSTQETPGQRQPLGQSNIFDTPAPVVPGRGAPLSRVTEVIEEDGEGD
FT                   ESAAEEQAARQKEIMEPQVEQQEARDDVREITQDVEHVSLNDVQEEDELEDAAPRGMRR
FT                   FNINLMTPITERTCEYTTLTQGTTAGKENFAREEEEEAEEEEEKEEVKEEPPISTTSPE
FT                   YDTTDAGLASGDVDSGFQLPDGFTIHRAEDRLDVHTMVLIDGEGKDEPTGTMTTNRDKS
FT                   VYHTAPAGSLSLNDLPNPCDPTSEQTISALLSAIDPPLSSLPGLIDNRATTSDKLDSLE
FT                   KHTRSKIRRASTSSRTSTSAAGTGDDTCLLELAGKPYEVRDKLGEGGFGVVFLGVDVDV
FT                   RRAQDEADSDDEDGEPVDRSLVALKVERPGAIWEAAMLDRIHRRVNANLRASIILPRNL
FT                   YLFKDESFLILDYCSQGTLLDVVNKSNAIFGGTGQGVDELLAMFFIIELLKLLEGLHSA
FT                   QFIHGDLKIDNCLVRISDLPNSQWSASYSRTGSNGWSAQGLRLIDFGRAIDLSLFPAGE
FT                   QQTFKVSHKVDERDCTEMRKGEAWNFQTDYFGLASVAYCLLFGKYMKTETVDGKVKVDQ
FT                   PLKRYWQAPLWTAFFETLLNPDDQLPITNRLGEIRSDFEGWLEENCQKGGKSLKSLLRK
FT                   IELAATTARKL"
FT   CDS_pept        join(1083088..1083608,1083670..1084125,1084247..1084382,
FT                   1084433..1084602,1084657..1085396,1085448..1086468,
FT                   1086527..1086614)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20637156"
FT                   /locus_tag="CNG03860"
FT                   /product="Nucleus protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44789.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068489"
FT                   /db_xref="HOGENOM:HBG177386"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00004B498F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI5"
FT                   /transl_table=1
FT                   /translation="MGLARCKRGLKTEGDVGFFFRPSSGFILLFCTTSHSSGCPNTMSA
FT                   HQQQLRGPSFPGQQQQHKVTANGDNQHAQEHKPATANASTKKRKASPAPSSTDRRRMST
FT                   GIYPSTDDDAASTSSKPVREPKRTRVHFSCVECHRRKQKCDRKEPCSQCVARRVPHLCR
FT                   PFLNGVEDPNISNNTDVNARLNTIENLLTRLVSSIPQAIASRPFAGDAGSPDVSSLTAS
FT                   GEEIFHPHVTLPDPASRVTMPHKPPPSGLFPSNMSYTTPPSRTGYGWGLREGRRIALSL
FT                   DDNFELRDMLQTLKESGVSQGHLEWLIAGVPGRRMADGLVELYFSWTRYKINKFSFMSR
FT                   YNKFFESIGRNPSCPKVDADTLKWLPLMFILLAIAALSAPHELVPRDEQLGWSRRFYGS
FT                   ARSGLEYAKALQRDNLDVLFAGLLASRYMLLTRRPAEGSAPVTTAFQLGLYRDGSVLNI
FT                   SDKKEVEIRRRAWAMLYHIDRTISLLVGRPPSISDAHTDTQPPANLDDEEVESGDFDPA
FT                   GHPLTTPTSYTYVIVRHKLAEIMGRIAYHTFAIQLPDYGTVVSLDRELLAWRDNLPSFF
FT                   RMENPDTSLDQSHPYLFVQRHLLACEWYYTRITLNRPYLLRRKPQDSRYAYSKTAAIES
FT                   AKADLLCRRAFVMEKGNLVVNSGGYRVLNSYMVLGVTIKLDPDSPQADELRQLLNVVSG
FT                   RLPDSQNRISEPLVKEELAIVEFLTAKNLGKPPRLPPNRNTEASGGAGDDQTPVDLLLN
FT                   LAKTRSGKRAAEEEKRQLRLQAAREKEEQRQAAKRNAGAENISSSPWGYVAPPMPGLDV
FT                   QQPFDNDGKRVPRPLQPPPTRRADGSIPDSTGWSPEMALALSQTPLKPQSSASSAQAQA
FT                   QALANDLQRFDSSNQNRALLSPSQGTGNLDLSPYGGFNSLPSLGDTPGLSGFDGSAGFF
FT                   QSQPPPPLSLSDRATSNRISSNSNTGGPGSQGQGPQDGMLDGNGVQQFGNANFDSFDFN
FT                   DLGLDVRAPGQGGGFNPFALPQTEEGNAENNAPDDETMFLTYILNKFANAQPEI"
FT   CDS_pept        join(complement(1087747..1087855),
FT                   complement(1087195..1087689),complement(1087033..1087136),
FT                   complement(1086860..1086979))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789809"
FT                   /locus_tag="CNG03870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44791.1"
FT                   /db_xref="HOGENOM:HBG068488"
FT                   /db_xref="HOGENOM:HBG177387"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniParc:UPI00004B4990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI4"
FT                   /transl_table=1
FT                   /translation="MSSRGFDRDARYSRDEPSGGRARSQSPTRDRMRDDRGGGYKKDYR
FT                   DRDYKERDRDLPYSSRERERGTDDRRRERDYEGHSSRYDKPREKAYDRDREKEKERDNP
FT                   NSDPNYRPRREDGFERSRGQSAYPPRGGRGGAYSRGGGRDYAERSPAYGWPGGDKGGRE
FT                   RDYQSMDRRTIEEGRRRREEERAMGVVYNEDGRVYDPREEEREREQHSEEPDADDPEAQ
FT                   MAAMMGFGGFNSTKKKGIGQNVEGDASVHKQRTWRQYMNRRGGFNRPLDKVKD"
FT   CDS_pept        join(complement(1093128..1093289),
FT                   complement(1092326..1092997),complement(1091737..1092256),
FT                   complement(1091520..1091665))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808797"
FT                   /locus_tag="CNG03880"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="AAW44793.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="HOGENOM:HBG068486"
FT                   /db_xref="HOGENOM:HBG177388"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00004B4991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI3"
FT                   /transl_table=1
FT                   /translation="MSRPPSAAGSAPGTPTPRATASGGATPIHTIVQNLPNLFQMYEKG
FT                   TLSDTQVTQLRTLMHTHIRQITANALSSGRSNPLYSLPDAINPSLPWKTQPALVSPEQF
FT                   DLMIKTVTKQLIEAATAAAAKRAREKEAGNVASAAVGGSGAGGGVGVGTVGEGQMPGQG
FT                   AGQGSQMGTPAGVGSGVGGAGISRPGTPMSATSSGTSLRASQPSPAPQVQGTVSTPPAI
FT                   GSTGPTTGSTAGPVGAGMAAATPPRPRPHPPGIYSHTELTQLAKLNAETRNAWLAKDPQ
FT                   RQQQFSASLAYWRSQPKSNFQPQSRPSPNVHPAGRPPPSSGNAPGSSSNPIPITTPNPS
FT                   ATTSFATALPDARSFALRPPPNQNQNQNQTQSVRPPAPPVPPPEPEPLRRKRVLHAMLG
FT                   EIAPGLAMEVGMDDALSEVMNKLLEQGFEGAMRLAKHRGADKVELKDMARYIDHAWDMV
FT                   VPGFDAALSHHVHVAPERERKKGKTVVPRAAAKPVVRKDDE"
FT   CDS_pept        join(complement(1094837..1094934),
FT                   complement(1094205..1094756),complement(1093964..1094092),
FT                   complement(1093738..1093828))
FT                   /codon_start=1
FT                   /gene_family="HOG000138260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22582015"
FT                   /locus_tag="CNG03890"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44800.1"
FT                   /db_xref="HOGENOM:HBG068485"
FT                   /db_xref="HOGENOM:HBG177389"
FT                   /db_xref="UniParc:UPI00004B4992"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI2"
FT                   /transl_table=1
FT                   /translation="MSAPWGLWGGGGAGMLPAMGGYWAFPGGLPSSTAFVSNPEGAIRD
FT                   MTEHDTNHTRDVGPDDSRLAWYEEWGKTESYRKIIMEVLKARLELSWPYNYKALMILAK
FT                   MPDPAIVTLHEQLGKLSEAADSVVGAEHIKKIAKPIFERSVKEKKKKEDEEAKKKQEAI
FT                   AAMWGGLWANDGYTAPAIATNGWAGWPYPYPMPPGVAAQMMADWKGKGLEGWQPAPITT
FT                   LPQHYPCSRTGFYGIRQEEEANKMKEKPAAVHVSLGAGKNKSIRKSVTFSLPEVYAKAE
FT                   KDLAARNW"
FT   CDS_pept        join(complement(1094837..1094934),
FT                   complement(1094147..1094756))
FT                   /codon_start=1
FT                   /gene_family="HOG000138260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22582015"
FT                   /locus_tag="CNG03890"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44799.1"
FT                   /db_xref="HOGENOM:HBG068485"
FT                   /db_xref="HOGENOM:HBG177389"
FT                   /db_xref="UniParc:UPI00004B4993"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI2"
FT                   /transl_table=1
FT                   /translation="MSAPWGLWGGGGAGMLPAMGGYWAFPGGLPSSTAFVSNPEGAIRD
FT                   MTEHDTNHTRDVGPDDSRLAWYEEWGKTESYRKIIMEVLKARLELSWPYNYKALMILAK
FT                   MPDPAIVTLHEQLGKLSEAADSVVGAEHIKKIAKPIFERSVKEKKKKEDEEAKKKQEAI
FT                   AAMWGGLWANDGYTAPAIATNGWAGWPYPYPMPPGVAAQMMADWKGKGLEGWQPYVLAG
FT                   HYSPYTLYGWPKT"
FT   CDS_pept        join(1101558..1101928,1102117..1102827,1102880..1103008,
FT                   1103061..1103218,1103272..1103419,1103486..1103674,
FT                   1103720..1104047)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942993"
FT                   /locus_tag="CNG03900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44802.1"
FT                   /db_xref="HOGENOM:HBG068483"
FT                   /db_xref="HOGENOM:HBG177390"
FT                   /db_xref="UniParc:UPI00004B4994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDI0"
FT                   /transl_table=1
FT                   /translation="MNPSPAKRPRTSSPEPGTPVSQGPLRRTSPSLTLPPIQSGALPPS
FT                   YGGPSTWSSAWRGASRASQGVEGSQSPKMEEDDPEPSGTTGGGPSGAAPGSSSSVVFTR
FT                   DVNPRAPRSMMACVRCRRQKPGSPASFYPSGPQPAPPITSRPMNQEYAFRPTSREMPPP
FT                   SATSGMSSFYPGQLHRRTPPPQSVPSAGPSSVYFQPPPPPPQVVHPPPFTVPVQRPPPS
FT                   PSSSDARLRALERTIDSTLRPLAWVPSALSSLQQSVAELRAQVAPRRVLTVSDTTWEHY
FT                   RTRAWPLTPWLIGLRDGVGLPGMVVDFLGRRAEEVEKMAAGQGMGSTTGLEGEARREVG
FT                   RLIGEGKEWGKEEMRALTVLATWTNDTIYAGLAVAHGRMMGLDRQRRTHDDWREWIYIV
FT                   IMDNMCHIPDFLKPITDEGLSAVWRDRLAELPSAEPAIRDRDAKLLAWLEYSELLADVF
FT                   RFRMPPASRDPEYQTPLEAREKRLFDPWREFGRQWEGWANAFGARADPILSLHYTYAVL
FT                   FTVSPVYFADATAWEELAASPDGQPLLEKGREAAIGVIQSICSAEVGRTLPYSFALYRP
FT                   LLGLAVFHLISLAASLPTISTVSSSMNAIKRTLRQAYDVLNAQVPDREALPGPSAGIPG
FT                   VGAGVVLPGGLLAEVVESGRVDVGKRWIGMDVGREAWRRIIG"
FT   tRNA            complement(1104482..1104590)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        join(1105039..1105203,1105266..1105466,1105518..1105577,
FT                   1105630..1105699,1105757..1106119,1106173..1106510,
FT                   1106562..1106716,1106766..1107150)
FT                   /codon_start=1
FT                   /gene_family="HOG000012778" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808799"
FT                   /locus_tag="CNG03920"
FT                   /product="Putative uncharacterized protein "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein thiol-disulfide exchange "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAW44804.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006467"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG354051"
FT                   /db_xref="HOGENOM:HBG521237"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="UniParc:UPI000042E2E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH9"
FT                   /transl_table=1
FT                   /translation="MRLTAKLAVFSLVAAVSAQLDGLGSSSKAAFALKQKPDSRVARNV
FT                   LEGKSEGYCSPSGPIESTHCLYETVESLNQQLFPVLHELVETPFFKHYKVDLYKECPFW
FT                   YENGFCMNRNCGVEEMDENEIPEKWRARALSEVKVSSESDGVSSCYFKEQDFCYVEDDA
FT                   DANGQYVDLTLNPERFTGYAGDSAHNVWRAIYEENCFGLSEASLSEMSKASVGISGLGS
FT                   KGKSELASAVVGAGGVSKPSRGINAAPGWGFSKLSEGWGTEMVKAPLNGEEMCEEKKIY
FT                   YRVISGLHASISIHICADYLDQTTGKWAPNLECFISRLATHPERLSNVYFNAVLLLRAV
FT                   ARAAPYLEAYDISTSPAGLLKEGDKKAKARLGEVLSLAGGQSMEKGFDEADFFAGEDSG
FT                   ILKEQFKSHFRNVSRIMDCVGCDKCRLWGKLQVSGIGTALKILFELDDRALDPKVNPDL
FT                   LQRSEVVALFNTLHRISESLASVEQFRQIYAATQKAETEASRAKALKSARKKHVPSPVA
FT                   PPPAFSLTNMERIGARIWEKLKGNCKGCLEMCLQTLERRKLGELATSFRRWVGSIGQDR
FT                   DL"
FT   CDS_pept        join(complement(1108800..1108839),
FT                   complement(1108706..1108719),complement(1108535..1108648),
FT                   complement(1107959..1108484),complement(1107884..1107911),
FT                   complement(1107342..1107819))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789810"
FT                   /locus_tag="CNG03930"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44806.1"
FT                   /db_xref="HOGENOM:HBG068482"
FT                   /db_xref="HOGENOM:HBG177391"
FT                   /db_xref="UniParc:UPI00004B4995"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH8"
FT                   /transl_table=1
FT                   /translation="MDEDFEDLLRDEDEPEYELEASASASIRPKQTPPSENEIRLCRRV
FT                   LELEEERNSLAAELSALKARFPTHSNPTIPIADPSSSSSISQPDQPIEIPTPLLPLLGI
FT                   LRTHIAELTRDNYALRYTFMGQALPRRGSITQTPTPVFSPISSLPPQENNIDIEMAATT
FT                   GDSGPSTVGLAPPSGSGTAQTRVGAGGLDLERVVERVKQLVIENEELGEMLLQLGQRGD
FT                   EEEWKKTLDDSKAIIESLDSDLSHHLSVVESTRSELKAYKSHFGPLPQNVSDRTTPSAA
FT                   STTRGQPASVGRGSLQDRLNRGLGGDRGGFHGKALKAGSTNAVGSDNSANVQTPVQTQG
FT                   DMRGGPHQGLPRTAGTRRPLNGSGNSNGGSGPFQGHVRGGSFGQGQGARLDERDFKRRR
FT                   "
FT   CDS_pept        join(complement(1114538..1114555),
FT                   complement(1114301..1114486),complement(1113923..1114245),
FT                   complement(1112852..1113872),complement(1112331..1112803),
FT                   complement(1111819..1112281),complement(1111495..1111765),
FT                   complement(1111139..1111443),complement(1110804..1111079),
FT                   complement(1110654..1110747),complement(1110355..1110598),
FT                   complement(1110142..1110298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19789811"
FT                   /locus_tag="CNG03940"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAW44809.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG068480"
FT                   /db_xref="HOGENOM:HBG177392"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00004B4996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH7"
FT                   /transl_table=1
FT                   /translation="MLYIASALTPTPILGSLRTTSLTDNHTSLVVAKPNKIEAWDVTEN
FT                   GLVWRSEIEVWGTVVGIDQVSIEDSRPHVLILLAPPQAHLLLVTFDITTGKLIITSSTS
FT                   LTPPTPTLRQAEFFTGVVAQERVALVSLWIGVLSCLEIELDKGSSGKKKRSSTIPTPEG
FT                   ETRLKIKDNFNINIREHNLLHLSFLPATLNGPVVTLVWLSASNELRLQARSLSLSAHSF
FT                   NPLSKSVDLVSPTSRQSISEDSDFNAVPFSCPAARRVVPIPSELPNGQRTLLVIGDEHS
FT                   VLYTLGENSPQSPKAVRRMSAVSVPASSPRANARRSPQTELSSGNAKRRKSSMGTKTVD
FT                   NQNEELQWDLRPVWRSRQGFGTVIAATVIEDHGSGASVVIGDEYGAFTAFGWEFEKGLG
FT                   AGTDGRVRVLRTYLGASSPPSSITYLDSSHLFVSSAVADSVLLRLPKVESSSSVSSGKG
FT                   KGRAVTSPIGDQADKWEVLYEIGKDRNDTDGGPEILERWMNIAPVKDLCVVKDEGGNLS
FT                   HLVLASGASESNSLRVVRSGVGLEELVTIQGLHDVQKMWPLTDSTAIPRLLLSTSTSTI
FT                   LLQLQPEISAIPITDVIFNSETLAAGILPGAELLAQVTPRGLSLWSDLSVGQLEAQVEV
FT                   DKETEIVCAQVTADWAVVAKKGGSLVVFHVSNTGFSPQGTIDVKEEVSAVAISSSSGSS
FT                   SPIIVISTWMAKTFVYTLSQISNGVDGLSIQSESSATSLQLRSHPFYPAGIQLLSGLDN
FT                   GLLHIYDLNTSDSGEAEGLMVKSSKTTSLGLRPLVLHPCESTHGDEKVISVGLTERMSV
FT                   IFESKDRIEFSSVNIKNVMAATSVDTSSGPVFALFSRTSGLSLVKVNSLKKLHVQTCDT
FT                   GNESISKLTYMDEYKAIACGSTRRTQLRDGDVEEENFVQIRDGTSLEPLSSFSLRGREL
FT                   VTSLRSVFLTGRIYLAVGTAFLPADDGEDSSWDEGNLAVVREGRVLLLEFKEGDAGGGW
FT                   DIKIKAELATVGAVYALEEIHGFLAVAAGSKLTIHRLDHNPVELEETSSWASAYVISSL
FT                   SVLPPSHIRPEGALIVGDGMRSVIVLNVDEGDGMIYDDERNMATHGVTALGLLKDKGDG
FT                   VVISDAYSNLLTYRLNQKLERAATFGLHEEVTRFQSGSLVPTTTAPEIIIPDVLFATRE
FT                   GRLGIIGELGTRSSRTLDDLQRNMSKIWKGPGEVGWSNWRRAGSNLVGKDTAGFVDGDF
FT                   VQKFLDTEFFDDERAQEIIQGTSSHEHVRLGKEEASRADVVRFLEATAGMH"
FT   CDS_pept        1116630..1117610
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808800"
FT                   /locus_tag="CNG03950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44813.1"
FT                   /db_xref="HOGENOM:HBG068479"
FT                   /db_xref="HOGENOM:HBG177393"
FT                   /db_xref="UniParc:UPI00004B4997"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH6"
FT                   /transl_table=1
FT                   /translation="MPPIAIRFLYPPSFGHPGGAKSHTRVTPRIILDRPLPVTSTAIPP
FT                   SPLISSSSTTPSDAGVQTPQTDVSFQSAQNRKRKAATVANGPSPKTRCVTIKPLFRPIL
FT                   ERCAAYDPSVDQSTVKPTHSAGLANGEQQYLHPYSPTSDWGNHRAAKPSREEEIRDERL
FT                   AKVKKMNKDEKKARKEGITRMQELVKEMKAGAKGEVYVPKSSEEIAANNTPSVGTPVPS
FT                   ETPASGIKATKNGKVKKSPASQSNTHMSPTNSHGTRAKSHSPPSKKSALQPEEVVEAPQ
FT                   TVPLASGKIKPGRKKAAVPEASVFLRERSRRYSGSDENDGIRSSL"
FT   CDS_pept        join(1118541..1120704,1120755..1121097,1121146..1121365,
FT                   1121417..1121703,1121752..1122103)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808801"
FT                   /locus_tag="CNG03960"
FT                   /product="MYT1 kinase, putative"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44815.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG068478"
FT                   /db_xref="HOGENOM:HBG177394"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00004B4998"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH5"
FT                   /transl_table=1
FT                   /translation="MTSKSSTSQQTSGSSFRLPRAKGLNKPTTWFGAPSFGKSSTSSSS
FT                   SSTNTSSSAEGSSSAPRGPVAQSPIPNPFTVSSFKSPFPSSKGKHKLSPSPSPKHRDED
FT                   FVMISPVRTDSSPLAGAGAKQSAIPPTSPTPSRFTSLKPHAMAFENYHQSSSSTPETPE
FT                   ESPTPACGMSSATARLRLVDDSPIRRVPGQSRSLRPGAVGSNPAERDESRRNLFLSTGS
FT                   SKSKMASPLKNSLTGMSDEEFSPTLPPTPLLGNGSPAPPPQPLFPSSRSLKSQDGTSPA
FT                   PLFGDGSKISKLSTSHPLRARAGTLTGTGEGPPTLAQTSSLIQKKAISLDHIHSTSTDG
FT                   DALFGSNSHINTHVRKTRPASTFGSSGLEGKASGGSHEGRAHKRINSADRTTTSMSRSF
FT                   GAKSLALSSTPHLGPLPDFSYSNSSLSSLSTTNLTPPATSFSPAEPPIFENVRPLQEVF
FT                   EQQKERSVTHKYKPRDSGISMCDDSSSSRPTSLIVPPSVVKPGQGQSQQSTMHKRPSSM
FT                   GDETPGVGPMMESGWPCNPPSAFEFLGESGVGLGIGVHPSADAKPAMPGTPVKKQAFKS
FT                   GVGHSISQPTLGSGSFNGDVEMSGPLEDSNKTNLPQFQPKPKSTMPPPSTKKPPPSVMK
FT                   RRPGTAELPRLTLTASSSPMATEDEQSPTVRNGDSSGQKLKSLTMAGKADSTADRLSIA
FT                   GAENIVCESEEEDGTPTKGKEPKDALAAVRHNVVTPTPSPKVTLGKALPPSSYNANLMP
FT                   RMSLPAMPPRKPNPNRTLNHRQSHPATGANQLEEEDIFESRFITIDTLGKGAFSTVVKV
FT                   QERNGEGLWAVKKARGMFDGARDRLRHLEEVDILRLLSRKPSPHVIKFQDAWEQNRQLY
FT                   IQTELALGSLAFFLEEYGRVVERLDEGRVWKCIRELSDGIHHIHSNGVIHFDIKPANIL
FT                   ISSTGSLKIGDFGLATRWPRVEPVEILRGAGLGMGNGNIAMLGTGKEKLEREGDRVYMA
FT                   PEMLRGVFVMAADIFSFGLVVLEIATNICVPDGGAPWHALRENDFSVVDLSPLSPALCD
FT                   LIISCMSAEPALRPTIENVVSHPVVQRARKGKDALAPEETGWLMDVLAGGKFNVPVVQA
FT                   AHGDEDVDMGEETA"
FT   CDS_pept        join(complement(1123890..1124107),
FT                   complement(1123796..1123836),complement(1123633..1123655),
FT                   complement(1123482..1123577),complement(1123226..1123425),
FT                   complement(1123045..1123156),complement(1122662..1122912),
FT                   complement(1122506..1122605))
FT                   /codon_start=1
FT                   /gene_family="HOG000085953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808802"
FT                   /locus_tag="CNG03970"
FT                   /product="Putative uncharacterized protein "
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAW44817.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG267174"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI00004B4999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH4"
FT                   /transl_table=1
FT                   /translation="MVRVSIPTLPPAPLVPPNALTLLPTPQAASHLARFLEKGNGKTVI
FT                   LTGAGVSVDSGIRAYRGKEGSYSNPNYKPILFHELVEDTPRDWARSFLGYPPVRDAQPN
FT                   PTHIYIAALLHLGLAPNLITQNVDNLHPKAYRLLSPNTKPPILELHGTLAKVHCMKHRH
FT                   EQSRDEYQEQISRLNPIWDEAAKEAERTGTQPRTNPDGDVDLRGANYNTFNVPSCRICE
FT                   AEGEKPTMGETIPPAVRDESFSLINSASSLLILGTSLATYSAFRLVKLALDQKKPVLMI
FT                   STGPSRADGLPGLEKMDRVAGDVLGVYLDSVVKGNRGKEFDAVRKILHTGVIKPIPQVD
FT                   GPRAEG"
FT   tRNA            1124405..1124493
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(1127064..1129656,1129713..1129854,1129930..1130359,
FT                   1130452..1130454)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808803"
FT                   /locus_tag="CNG03990"
FT                   /product="Sulfite reductase (NADPH), putative "
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAW44819.1"
FT                   /db_xref="GO:0016903"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068477"
FT                   /db_xref="HOGENOM:HBG177395"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI00004B499A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH3"
FT                   /transl_table=1
FT                   /translation="MAPIALTSSATSPPGLPAKKAALAAADVDAGLNLDADGASTPYSA
FT                   TSTAVSVGENNKDSKPASPSALAKALVDSSIPSSVPLPTDDGYYTNLIASSLPVAATKP
FT                   GTAVFASAIDGLEALAVKHSESVWVYDDAELVGFGSRLGGLGKKKVHELQTREGAGLEL
FT                   AGYASKTQGKFTVFASIKTLQYLLPSLEAIEGDVIINLATTSTTDDLEFADALYAPGTV
FT                   KALTSLPEGWEVVFSSGERIVDNASKLYGAEPKKVVHVVESTFTGRETTSFTFPAPQSA
FT                   AIDDLTVHNGSASELYVAPAGYLASSIAAALPASAGLVELNTLSPSPEALYAALTSNDR
FT                   KTVHVVGASKVDAEALKAIVLASVYAASGSSKVALPLVKSLVATSVESISALAQSTTAT
FT                   PGKVVSFYTAPASPLPQLLAHLFLSSPSLSTHIAQFGSASARGVKSVLSLAPAGTSRAA
FT                   LSVEEPTDVTWISDPNVLKSADVFSVAKEGSIVVLALPWSEEEIPVKFTRSEIQTIKSK
FT                   NLRIFSLYLSSSPTTPIQEQVAFLLLYTGAQKLAPGVWKVLDAFHNHQLVRDDVEIAQA
FT                   ALNEIDAKEWEVPELEEGKTEKVKSKWEWDALPGLAGVVAANDEQNSSVGPWELAARHL
FT                   FFREAFAVPEATTTDASQGLPGINALRPSMSEETFLVTVSENRRLTPATYDRNVFHLEL
FT                   DTAGTGLKYEIGEAIGIHGWNDTKEVREFCEWYGLDPDAVVTFPSPTRQGTLETRTVFQ
FT                   LLQQNIDLFGRPGKAFYAALSKIATTKAEAMRLKFISAPEGAELFKRLAEDITVTFADV
FT                   LKMFKSARPGIEELVGLIPEIKPRHYSIASSQKAVGDKVELLIVTVDWINSKGSPRFGQ
FT                   CTRYLAALKPGDKVTVSIKPSVMKLPPDNKQPIIMAGLGTGAAPFRAFMQHRAWQRSQG
FT                   IEVGPLIYYFGSRYRSQEYLYGEDIEAYIASGIISHAGLAFSRDSDSKTYIQHKMSQDK
FT                   SMLARLLKGKGSDAAYFYLCGPTWPVPDVYEALVGSLTREGGMERKEAEEYLEELKEEE
FT                   RYVLEVY"
FT   CDS_pept        join(complement(1132632..1132714),
FT                   complement(1132320..1132585),complement(1132206..1132270),
FT                   complement(1131975..1132151),complement(1131812..1131899),
FT                   complement(1131643..1131750),complement(1131494..1131575),
FT                   complement(1131273..1131395),complement(1131121..1131199),
FT                   complement(1130615..1131040))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093906"
FT                   /locus_tag="CNG04000"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAW44821.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG068476"
FT                   /db_xref="HOGENOM:HBG177396"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00004B499B"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH2"
FT                   /transl_table=1
FT                   /translation="MEADEPPRYPDIQGYYLSREIGGGGFSKVYRAVHRQTRGLAACKV
FT                   INLYVNPAWGLGTPNIKELQKEVQVHKALKNPYILEFLHHETIKIDNPDHYTPGLYMLL
FT                   ELAVGGDLFDKIAPDVGVPEDLAKFYFAQMVAGVEFIHAKGIAHRDLKPENLLLAANGN
FT                   LKITDFGLCAVFRHKGKTRLLSGRCGSLPYVAPELGVPAGQGYAAEPVDIWGMGVVLYT
FT                   LLVGNTPWDEPSESSPEFCAYRTGELFNYDPWTRIRGQALDILKGLLCIDPQQRLTIPG
FT                   IKHHPWCMTQSQLRREQLSEALTQGIRQEGMLAYADPVFRSGESQAYAASRGARLAGDT
FT                   DWLNKEESQFMRGTGNITQSGDLMTITTRFWMALPPNEAFQILAAFLQSDVADANGSVR
FT                   AVAAPSAPGDSFPGSHGTAGGGGGGGGGGGGGVIKLHKAAGHQYVEGKVLVLPSDSLAA
FT                   EGQSLVIMQRAKGSILHWRALWWSVVRANELQDYVIRGDM"
FT   CDS_pept        1132883..1133464
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808804"
FT                   /locus_tag="CNG04010"
FT                   /product="Expressed protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="AAW44823.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG068475"
FT                   /db_xref="HOGENOM:HBG177397"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00004B499C"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH1"
FT                   /transl_table=1
FT                   /translation="MGPSITPTVAITAITPQQTAPLRHLVLWPSIALGSQLDPAYDFAP
FT                   ATIHLGAYLCAPVETQRPPDHLPGTAPAQEPIGIMTLALQPYRPLSPATSPPTPLLAPS
FT                   LTHVQLHKFAVHPDLRGLGIGRTMFAHAVSLLKDKYGEGNVLFHFDARANQTRFYGNCG
FT                   MDVLDPVEFEKRGTTGKEVPVMHIKMGRVI"
FT   CDS_pept        join(1133978..1134422,1134495..1134532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808805"
FT                   /locus_tag="CNG04020"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44825.1"
FT                   /db_xref="HOGENOM:HBG068474"
FT                   /db_xref="HOGENOM:HBG177398"
FT                   /db_xref="InterPro:IPR013219"
FT                   /db_xref="UniParc:UPI00004B499D"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDH0"
FT                   /transl_table=1
FT                   /translation="MPPNLHNLLSSLRSPIFNTISNPTSARMGTKYLRRRLRGPTVASY
FT                   YPQLTNPFPKLSLLNKNIPENPFAGWDGRKLPSVIKTKKGKVLYENIEWQNEGAMLRKD
FT                   EVVERGFEEVARRKGLGWLEDPIEQRRIVRVARKKRFGKGPPKKGQGRRSQMKKKK"
FT   CDS_pept        join(complement(1139062..1139173),
FT                   complement(1138544..1139000),complement(1138005..1138486),
FT                   complement(1137703..1137954),complement(1137584..1137642),
FT                   complement(1136566..1137525))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942994"
FT                   /locus_tag="CNG04030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44872.1"
FT                   /db_xref="HOGENOM:HBG068471"
FT                   /db_xref="HOGENOM:HBG177399"
FT                   /db_xref="UniParc:UPI00004B499E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG9"
FT                   /transl_table=1
FT                   /translation="MIDGSTTGRNNDGWAIAVVISQLLLSRMVVARSAEVFDHLRARAD
FT                   AESLTETVSGFTSVGTSDLVTESLQPAAITRTAANTSQDVSPTNIGQATDIGTIATDTL
FT                   SSNQVAVTSAFTPQTVAASQDATDIPELSVGADGTLYWQQPALVASQQSDASGAAETSV
FT                   EMSNAAPVTSLPATLAVKSTASVQPSVISETAKTPTTSAPQIRTTVVIVATDPDSGNET
FT                   SAVSISDVQLSYSASQTLADGGSLTLQVASRTVLSSAVSSSLTGITSSVASRSAILDFS
FT                   DVSITSRTGAIATSSGSASHLASASNVNNGGVIAVEDDDETSMASFKSTTTAATIKTSA
FT                   SNYKLTGPSSTSAESSESIDESLVSASSSATTPTSADDTVFSLPSDTTIVSDGVTLTGQ
FT                   DAVAALAAEKTSTASAAATTMTTSESSGLSSIAIVGIVGGVLVALIVIYLIWYQWRKKR
FT                   ARKALGEETPDDPDIPDEKYPDRLTRSSFGADEPITPASYKRRRTDHYDDDYDATMYDP
FT                   ETYYDDRMTRAPTDYEGEYDYDGGGRTIAGDKIAPDGRTEYGLTQYGDGMTAVLADSMA
FT                   TGVLPTSRTVQTGQGDNPFVPVPPVPRLPSVYTSPKSTTVRVANDNLSQAPAHTQMAYD
FT                   RDTGYGMSIYDAYGGPDSRPQTQFSEPSTSNLLPWFNKGSQTPAPPVPPVHSQHTNNQA
FT                   AGGPHTLPQPPRPNGENGLGAQQMMGMPMPLKMQMQMQMDEHEPMRAPPRAVMAQTPLP
FT                   VGAPMKFESELDRAPIPTFR"
FT   CDS_pept        join(complement(1139954..1141449),
FT                   complement(1139895..1139904))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20637157"
FT                   /locus_tag="CNG04040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44844.1"
FT                   /db_xref="HOGENOM:HBG068470"
FT                   /db_xref="HOGENOM:HBG177400"
FT                   /db_xref="InterPro:IPR022235"
FT                   /db_xref="UniParc:UPI00004B499F"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG8"
FT                   /transl_table=1
FT                   /translation="MFSWLADRQKGEEGATYAGDKHDKGKQTTSEEEEQLEIDDSAESA
FT                   IEDLVDHSDDSSSEEDVAKPTITVPSTFEGIIGSQRVAMPRKECQSPARLSRSIEVAGR
FT                   TFNSASTSHSIVKGSDNHTVSRAQASDVYIYDITTLAPLASLQSRILEEFSRVSPLTYM
FT                   RLSKTHFKEIIPTVYHTFNVTIDFGKCLYGAHPMTETKRLGFWHVKHLFLGINTGLCFY
FT                   PFPTPFWKAKDFMLAIINLSKPNGHRYIFPNLKGVHVAQPLLESKNEGEMSLHHLFWQA
FT                   LTEYITPPSCPINLHLVRDYNTHKVSHDIPDVILHYLANRNLAFHMYTMNGRAKRWKYY
FT                   WTTFPHQIITFKVAGPRSPFLDQEVLSELMPILLGPDIPQDWRKKHPHSALQIPVKKAT
FT                   MVLNNLVVEAYRRLGQIAQAQRKRKKPLAVPIDRERYVIKVLFHKTQLKGVEMRDQIAK
FT                   EEVTIYGEHRNLLWNMTAHRKRQEQTMEQDQRMKMKKAKTSSD"
FT   CDS_pept        join(1141853..1142353,1142411..1142479,1142537..1142794,
FT                   1142854..1142877)
FT                   /codon_start=1
FT                   /gene_family="HOG000060393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20637158"
FT                   /locus_tag="CNG04050"
FT                   /product="Vacuole protein, putative "
FT                   /protein_id="AAW44846.1"
FT                   /db_xref="HOGENOM:HBG347532"
FT                   /db_xref="HOGENOM:HBG595196"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniParc:UPI000042F063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG7"
FT                   /transl_table=1
FT                   /translation="MSSPPRYTEEPNLRPAPSKAYGTTPADTAATQPLLAAQASTNAQR
FT                   AAEEGWRDDEDNVSDNYKLGVSVSDCDTEIRMLFIRKVYSILLIQLLATAGVSILLSLP
FT                   SAKDFTHTNPWIMWIPLIGSFTSLFFVYWKRHQHPANLILLGLFTLFEATMIGLAVSYY
FT                   ESRIVIQALFITLGVFIGLTLFTFQTKYDFSSFAPILFIGIWGLLTTYLIQIFLPFNAT
FT                   VDLGIACFSTLLFSGFVLYDTQQIMKRLSVDEAIAGALTLYLDFLNLFLSILRILNNSN
FT                   DR"
FT   CDS_pept        join(complement(1150571..1151622),
FT                   complement(1150400..1150520),complement(1150270..1150348),
FT                   complement(1150089..1150215),complement(1149556..1150031),
FT                   complement(1149142..1149501),complement(1148964..1149075),
FT                   complement(1148894..1148914),complement(1148760..1148841),
FT                   complement(1148696..1148701))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808806"
FT                   /locus_tag="CNG04070"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="AAW44848.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG068468"
FT                   /db_xref="HOGENOM:HBG177401"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="UniParc:UPI00004B49A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG6"
FT                   /transl_table=1
FT                   /translation="MAPATPTFRKPRLQPERGTLLSFFKKETTSVRTGFDVSHTQVESG
FT                   VVSVEHTVGPSKDSQARNTSSKQNSIHKGKGKEKQKDHNGSVHDPVVISDDDEDDVLPA
FT                   APPTRSKRRKFSASSNGNQAPQLPSQSPCRPSEAPPMFASYSEFKPPPTWPQVVNTADV
FT                   EENGNDQSMMVADEDDTRTPDPWEGKIEEDDSSVELDDRDRPHSPERQDTQSGNGLTVG
FT                   GMEWEEPDEGMGMEDEVDDADDAQSAISSSIKPSTSKRGRRISPFSFSIPIPEPPSQST
FT                   IKGPNAFSLLMSGHKEHEQWKDAEDDLRRDGKRYAGRRRAPFYKVLTGMPVAVDAFRYG
FT                   AIPGVTAYLLTHAHSDHYTNLSKSWNNGPIYCSQTTANLIIHMLEVDPKWVHGLPNDMP
FT                   FEMPNTGGVTVTPIEANHCPGSSIFLFEGRQTVNAGDSGFASPYVGSKRVFRYLHCGDF
FT                   RANPKMVLHPAIARAPINTCYLDTTYLNPKYCFPPQPLVINACATLARRNVVGESDDAP
FT                   SLEAVQQGSVIGVSGVGSMTYGGGRKVTLKTEDGGEREIEVEIKEEKGEREKQMMQGWL
FT                   VKKEEGVKEEVKEELGGVGKRAKSRTLVVVGTYSIGKERIVKAVAKAIGSKIYCDQRKK
FT                   GILLCQTDPELHSMLTSDPIEAQVHLLPLGNIQLDRLQSYLTLLHPHFDRVLGFRPTGW
FT                   SYSPPAGTDMLPDVNTIIRRDQARRFGEGDLKTMRGSSRNFMMYGVPYSEHSSFFELTC
FT                   FALSLPGADLKMIATVNVGNEKSRAKMKKWFEKWLAEKAKRKEKGLPSTVEYRDETYW"
FT   CDS_pept        join(1152052..1152229,1152336..1152502,1152675..1152941)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808807"
FT                   /locus_tag="CNG04080"
FT                   /product="Cytoplasm protein, putative "
FT                   /protein_id="AAW44849.1"
FT                   /db_xref="HOGENOM:HBG037955"
FT                   /db_xref="HOGENOM:HBG068467"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00004B49A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG5"
FT                   /transl_table=1
FT                   /translation="MSGEKPTEEQIEDVILSARFGDLDDLKTFVDTFGKEVLAEARDER
FT                   GNTVLHMCCGNGHLDVLEYLLPRLPPSLLSVTNETGSPAMHYAVANNHTECVKALVNWP
FT                   EEQGGGLPLLKQKNASGRDAFLESIFAGEGKEEVSGWIEGYLYRVEGGDDEEEGEGEGK
FT                   EIKMSVGDEVVEDEAEVVDELAEKAEALEVKDEKEKKRSN"
FT   CDS_pept        join(complement(1153825..1154700),
FT                   complement(1153448..1153747),complement(1153222..1153346),
FT                   complement(1153051..1153150))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI18942995"
FT                   /gene_name="CMT1"
FT                   /locus_tag="CNG04090"
FT                   /product="Alpha-1,3-mannosyltransferase CMT1 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44851.1"
FT                   /db_xref="EMBL:AAQ86764.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG068466"
FT                   /db_xref="HOGENOM:HBG177403"
FT                   /db_xref="InterPro:IPR021047"
FT                   /db_xref="UniParc:UPI00001D5FEE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6U1Z4"
FT                   /transl_table=1
FT                   /translation="MFRNTLRTFPRPATPSLPTSSHSPIARASLSKSPLFVLSLVLVCI
FT                   FFLSFLSHPDPSARKLQWPGLFPSPSPSVIHTKDLFLERALNATSEAFREICPSAGDPV
FT                   HLDPDLTEAQKKRYLPLKRSKRGRYLLVTNTRQIEAHLPDLLNTLIVLLRYLAPEHLAV
FT                   SILEGPSSDCTQKAIEQVLKPMLDDQGLESAWTRIETGESKIDWGKHNRIEKIAELRNT
FT                   ALAPLWQGEGDQKWEDEIEAVVFFNDVYLHAADILELVYQHVKNGAGITTAMDWWKKRP
FT                   EYYYDVWVGRTIDTGDLFYPIDNPWWSPSSDLFPNSPNSRNAYSRLEPFQVFSSWNALA
FT                   VLSPKPFLPPHNVRFRRGDVEKGECAASECTLIATDFWKAGFGKVAVVPSVQLAYERDV
FT                   AKDIIEDVGKQKEQLGWIDGVPPEHLDDKIEWSTKPPKKVRCHPWPEVNGLSANVWEET
FT                   RWVQPWLE"
FT   CDS_pept        join(1154780..1155205,1155273..1155820,1155873..1156723,
FT                   1156787..1157106,1157182..1157232)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20637159"
FT                   /locus_tag="CNG04100"
FT                   /product="Expressed protein"
FT                   /protein_id="AAW44852.1"
FT                   /db_xref="HOGENOM:HBG068465"
FT                   /db_xref="HOGENOM:HBG177404"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00004B49A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG3"
FT                   /transl_table=1
FT                   /translation="MFFNYNGVQLLRRIPRVKTSTSSLLSSRDLTTLAASLFVTSLSIY
FT                   CQYYLQSSLHFIFLPIRKSIICGMASMLERLMAKTFQKQTPPADEQPDSTPYRPRREPL
FT                   PYEIPDPKGTPWLLKVPDEVLERIFSNVDRVTFVRCHRVCSQINNFLSGNTSMKLRNLL
FT                   QTSSLILNPNALLPDAVNPHLVPPSKAQLLDTLRERLTRFRSFSPKSEETVKFQEYEGR
FT                   LYEFLEGVLVRSVPIPYSRQIGNEIGVYEFGKMGEWEDVKNRPGDGRDGGGKNRDEDDA
FT                   MDEIIDIEEDEEFGNIRRTHKFGFQMLDFAFDPGQDLFVVAEYKPHPQDPTINLHLFTL
FT                   STFQPHPRAKEHILTWPSGTLYGRAPSLGFQICDDGLFVLKNHHRGSKDMLCGWQWTTG
FT                   RLAVTLIAPHTSTFESFICLTPSSFAIPSVSTTLNPDSEILGDLTDPSDLIFSHHLNIY
FT                   AFPPLSSTTVNEHEPVPPPHTATHVTTIDLPEFVIDFENDLPPPRMTIRADPAPRYNLP
FT                   THPIGSPQPFIPDPESGIVVLEFYCQPTEDEEGHLQTTHYVMFVRKKTLLGYLPAPTSP
FT                   LLFSAFPRPAPVVPFANIAPKVRMLGPHQYVPSWVCYVYQDRYVTRSDVESEPCIQLYD
FT                   FDPMRVRQAQFDPELKDGQNAFEVITEEADVPSHQEYRHSTLVKGVKTGAELPCTVAEL
FT                   ELLDDGVHTIIIDAERIIAFDDSEDENDELFMRIMEF"
FT   CDS_pept        join(1157891..1158761,1158831..1159171)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808808"
FT                   /locus_tag="CNG04110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44854.1"
FT                   /db_xref="HOGENOM:HBG068464"
FT                   /db_xref="HOGENOM:HBG177405"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI00004B49A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG2"
FT                   /transl_table=1
FT                   /translation="MYSLVLSTSLNTSEIHHNHIPERVAYFARKSNILNVIFVKRAWAW
FT                   TSAIYLLHLVTSPRNRSRMFSFSTPPNDGRIRRLLVWIAATACWAVFTRWFFGAGLGDR
FT                   IIALTGGNCALPLPPSISPILARHTFGKLFTAGPQGSSGQEKIYIALPYKFCTGVPLTP
FT                   DALPELFALLPGGGKGTAIPPGGGPTASHESLAPLPRPRWHKGFDISGHSFLLTLCIMV
FT                   LGRELAPTWRAWAGGKTAGLRYGRARGWKSKVHGLIALAATGLVGIWMWMVLMTAVYFH
FT                   NPPEKLAGLLLGLLSSGLINLFIPTFSPSPFNPITTTRTPTPPASGSGSCEGEGRPFSH
FT                   SLGDDGEEEEVVDENKARRENVVDSGIIYKVDGEDGKGEEDLKGRVNVKQKEALATKEK
FT                   TKEQ"
FT   CDS_pept        join(complement(1162529..1162699),
FT                   complement(1162345..1162471),complement(1162140..1162277),
FT                   complement(1161958..1162055),complement(1161801..1161912),
FT                   complement(1161290..1161743),complement(1159677..1161234))
FT                   /codon_start=1
FT                   /gene_family="HOG000135934" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18942996"
FT                   /locus_tag="CNG04120"
FT                   /product="Putative uncharacterized protein "
FT                   /function="1-phosphatidylinositol binding"
FT                   /function="clathrin binding"
FT                   /biological_process="clathrin coat assembly"
FT                   /cellular_component="clathrin coat"
FT                   /protein_id="AAW44856.1"
FT                   /db_xref="GO:0005545"
FT                   /db_xref="GO:0030118"
FT                   /db_xref="GO:0030276"
FT                   /db_xref="GO:0048268"
FT                   /db_xref="HOGENOM:HBG068463"
FT                   /db_xref="HOGENOM:HBG177406"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniParc:UPI00004B49A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG1"
FT                   /transl_table=1
FT                   /translation="MTAQSFDKIVKLATKPKNAPPKAKYIDSLIAATYADDSSINEIAI
FT                   VLAQRLRDTNGVVVFKGLLTLHQMIRTGQTEALLDVLARNDVLRLRNIYSQRFQGYVPP
FT                   ASMGAYADYLDNRIRVYRDLKRDLIRVQTESNRRSDGLGAASKARRLRHLPVEKGLLRE
FT                   VKVVQRLLDSLIKCKFYDDDLRDENTVLALRLLVKDLLVLFQAGNEGVCNILEHYFEMS
FT                   KVDATDSFEIYKSFIKQTDKVVDYLSFARKLHHVLNVPVPNLKHAPTGLVKALEEYLND
FT                   PNFEQNRMDYKRSLGVVEGGSRRPSDTEPTRKASPDKSTSTSTKAASPAPEVKPQAPAG
FT                   ASKKIQDFFESIQADQQPTMFGGAPQQINYAQMTVNQHQQFNPFRQSMMMPQQTGFMQP
FT                   QMTGFSHPQQQGFLQPQQTGAMAFGRQSMMPMSTGQPGAGGEFGFIQPPHAQAQQPQMQ
FT                   MQMQPQQTGFLQPQATGFNPFRQSMMLTGNGMGMGGLSGPMSQPSSPSPFAQPSHQTQG
FT                   QGQIQRPGSTPAFSTPPSNGTAASSSSEAKPLTAQTTGSKNPFAPAGGAVPPVPTLRSQ
FT                   HQPPQKKPTMNEMMMGLHTGNSDGAWGQPQAQQQQTQPADQAGQQGSAQGTGMSSIASE
FT                   FASNKNQTNGSANANTGGGGTDFLSQFGSLSVNRPGASSPSTQTASSSNPLSFLSTNPT
FT                   GSTSATSGLTSQTTGANTNSSANGFIQPQPTGYGGSNIKPFKPSSSFGNQLMENLPPLP
FT                   ESGAGSNPGSAVASPSGAHGVGAVQPQSTGFPGLGSLSFQNTGNPAGSSAGTGSGLVPQ
FT                   MTGAPNPFRQSTMLGGSSSNAGRLNPQMTGMGAFSGLSAFGGQNHGQGQGIFGQQQQQQ
FT                   QQPFQQQAQQGSLI"
FT   CDS_pept        join(complement(1167974..1168014),
FT                   complement(1167688..1167924),complement(1167199..1167491),
FT                   complement(1167067..1167111),complement(1166828..1166928))
FT                   /codon_start=1
FT                   /gene_family="HOG000138259" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20637160"
FT                   /locus_tag="CNG04130"
FT                   /product="Sec14 cytosolic factor, putative "
FT                   /protein_id="AAW44858.1"
FT                   /db_xref="HOGENOM:HBG066280"
FT                   /db_xref="HOGENOM:HBG175270"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000042DF0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDG0"
FT                   /transl_table=1
FT                   /translation="MATTDFLSGHPGHLSEAQQSTLEAFRTELLSSGLIPADADKEAFV
FT                   QRIGYDRFDDQTLLRFLRARKFDIPKAKIMWEANEKWRKEFGADDIAANGFDYPEYEKV
FT                   AQYYPQYYHKSDREGRPVYIEQLGKLDIPKLYALTTQERQLKRLVSEYEKFLRDRCPAC
FT                   SEEIGHLVETSCTILDLYNAGISSFYKVKDYVSAASTIGQNNSRDNGPHVHHQRPLPLF
FT                   HRLVPHQTLAGRSYRS"
FT   CDS_pept        join(1168277..1168944,1169017..1169125,1169183..1169189,
FT                   1169245..1169315,1169386..1169624,1169710..1169758,
FT                   1169815..1169844)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18093907"
FT                   /locus_tag="CNG04140"
FT                   /product="Putative uncharacterized protein "
FT                   /function="calcium ion binding"
FT                   /protein_id="AAW44860.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG177407"
FT                   /db_xref="HOGENOM:HBG747897"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000042E7DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDF9"
FT                   /transl_table=1
FT                   /translation="MRDTSSPQPPQQRNPAPRNQYPQPPQQQAQAYGAPVGVPVRGYAA
FT                   SPGSGGRSGMTSPGSGPRSGMVSPIQGSFPLQAPPLQQQQGQGSYQQPQRQYSSPPQQQ
FT                   QAFQPQQYQPRPQYAQPQQVRSLGYGGAPSPISPGTASSHHGYPPNPSSESGYAPMQQQ
FT                   QQQQNYGQASQQHPHYATSTQGRQSQQAQQGQWGPQQHVQTMSSTPTAPSAADNAELRD
FT                   MFVAFDSSRSGHLSAFDLQKLLAKDATMDAREDSVKMLMNIFDTDRSGSINFQEFEGLY
FT                   RYIQDWHGIFHRFDRDSSGLIDRTELHSALMGFGFSLPPEMIRKIEKRFTPPPVPGKDA
FT                   PKGISFDRFLMACVTVKHYTEGFRRVDERKEGKVTFSYESFMEMVLDAPA"
FT   CDS_pept        join(complement(1171494..1171892),
FT                   complement(1171270..1171434),complement(1170399..1171208))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808809"
FT                   /locus_tag="CNG04150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="AAW44862.1"
FT                   /db_xref="HOGENOM:HBG068461"
FT                   /db_xref="HOGENOM:HBG177408"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00004B49A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDF8"
FT                   /transl_table=1
FT                   /translation="MDITAALHEASSQQNQKLRSQAYLSLLQSLLQPPLTSASPLIAFG
FT                   THFTTSNTVIIIVGRRILGAYLVALLSGTTVVQKGTAKVPLDEEGQADEAEWAALGKAA
FT                   FGGEKGEEVRRDVVEGVLAAGSSGWCDEQITVLRHLHSHLLMLEEDWEGAARALMPMQL
FT                   EGGSRVVSDDEKLNVYMQIVRLFLECGEWGQAQTYFTRASLLPRPTDKETRLSMRLSQA
FT                   KLYDFANEFAKASVTYHEVSHDPSIDPSDRLIILSAAVTTSILAPSGPHRSRILATLNR
FT                   DDRVHTELPAGLGTMLKKMLLEYIVKPEEMKEFEGALAPHQRAVVEGGGTVLERAVREH
FT                   NVGACAKVYDNISFSALGAILNLSPSSAETIAQRMIEQSRLRAWIDQPSQLIFFESRPQ
FT                   LDTDADAQGTAGGLGVEKEEKEVEKVGWGVRWDERIRGTSLRVEGIAEAILAKGLIDA"
FT   CDS_pept        join(1172222..1172541,1172593..1172684,1172757..1173049,
FT                   1173107..1173199,1173260..1173484)
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15808810"
FT                   /locus_tag="CNG04160"
FT                   /product="Flavin-adenine dinucleotide transporter, putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAW44871.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00004B49A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDF7"
FT                   /transl_table=1
FT                   /translation="MTSNISAQPSLFGDPSIDHALAGLGAGTVATLVMHPLDLVKVRFQ
FT                   LADSKPHPNSHLPLHKTKPRLGTGVYMALKDAVMIDGWKGLYRGLVPNLVGGASSWGLY
FT                   FLFSYNMIKKQMQGGDPSYRTSSGQHLLAAAEASAITAMLTNPIWVVKTRVFGTAKNDA
FT                   VAYRGLWDGLRSISRTEGIRGLYKGSLLALIGVSNGSIQFATYEEIKRRRTEVKRRKYL
FT                   REGKEWRVEDEKLSNIEYILASGSSKLVAIALTYPYQVIRARIQNFTPTPAIPKLTIPS
FT                   VVSSVWRNEGALAMYKGLGTNALRILPGTCTTFVVYENLVWAFRTLAMKGKGKDEGPLA
FT                   "
FT   CDS_pept        join(1174338..1175011,1175063..1175746,1175801..1176533)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15808811"
FT                   /locus_tag="CNG04170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="AAW44863.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG068460"
FT                   /db_xref="HOGENOM:HBG177409"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00004B49A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDF6"
FT                   /transl_table=1
FT                   /translation="MPIQLTNLYSIIIAIHSPASETKQQEQQRSQGADWRLGDITVDWV
FT                   DFIREKSVEKRDMTRNQHSSLQESKNRLSPQGRSVPGSSTAVSNTKPKRSRSETPTQRK
FT                   TSKDDPDSSSLQPLLAHFPSPAPLSSSYAQGISSLGTGVVHLFRHSPPPSLIADIDNHP
FT                   FGSSSRSAGEASSKEGWSGENAEGEDGSLIAILAVPAWMRPADFLEFIGGWGTCLEGVR
FT                   MIREATTPNRSIVLLKFRDPLQAQDFTVIFTGRAFSTLDSRETCHPIRIHHLVLHKLDQ
FT                   DQTISQKNAVAIPAFPPSVYASRAKQLPELLSGVPTEKRYELPSCPVCLERLDSTVTGL
FT                   VTLPCAHTFDCDCLRKWGDSRCPVCRLSHLLLSSSSSSATPSHSLHGPEITRLTKCSMC
FT                   SSTENNWICVVCGTVGCGRYEPGKGHARRHWEESGHVLAMELETQRVWDYKGDNYVHRL
FT                   IQTKNDGKLVELPSASSLVTSSVPRVMPLGNSQPTSSAPARSSSMDIGSTSEHQAQAQA
FT                   QGHAGPSSNDIDKISTIESITLEYS