(data stored in ACNUC29543 zone)

EMBL: CT978603.AAT

CT978603.AAT         Location/Qualifiers
FT   CDS_pept        complement(481544..482152)
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="SynRCC307_0544"
FT                   /product="Leu/Phe-tRNA-protein transferase"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27447"
FT                   /db_xref="GOA:A5GRD8"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD8"
FT                   /protein_id="CAK27447.1"
FT                   /translation="MNDLLAAYAAGWFPMAEGPDRALGLFRARNRALIPLDQRFHVPRS
FT                   LRRQLRPGRFELKLNSAFAAVVDGCADRPSTWISLELRAIYQELHRLGWAHSIEAWDAH
FT                   GLAGGQLGLAIGRCWIGESMFHSRPHASNVVLVQLQSALRQGGFELFDVQLSNPHLERF
FT                   GCFELSDADYTSCLAKAVQQPARLQIGSSAVSSGAWMPR"
     gtgaatgacc tactggcggc ctacgccgcc ggttggtttc ccatggccga gggtcccgat        60
     cgggctctcg gcctttttcg tgcccgcaac cgggcactga ttccacttga tcagcgcttc       120
     catgtgcccc gctccctgcg gcgtcagctg cggcccggcc gctttgagct gaagctcaac       180
     agcgcctttg ccgccgtggt ggatggctgc gccgatcgcc ccagcacctg gatcagcctg       240
     gaattaaggg ccatctacca agagctgcat cgcctgggct gggcccacag catcgaagcc       300
     tgggatgcgc acggcctcgc tggcggccag ctggggctgg cgattggccg ctgctggatc       360
     ggtgaatcga tgttccacag ccggccccat gcctccaatg tggtgctggt gcagctgcaa       420
     agcgccctgc gccaaggcgg ctttgagctc tttgatgtgc agctcagcaa tccccatctg       480
     gagcgctttg gctgctttga gctcagcgat gcggactaca ccagctgcct ggccaaagcc       540
     gtgcagcagc cagcccgctt gcagatcggc agcagcgcgg tcagcagcgg ggcctggatg       600
     ccaagatga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page