(data stored in ACNUC29543 zone)

EMBL: CT978603.ACCB

CT978603.ACCB        Location/Qualifiers
FT   CDS_pept        33490..33963
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SynRCC307_0032"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26935"
FT                   /db_xref="GOA:A5GPX6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPX6"
FT                   /protein_id="CAK26935.1"
FT                   /translation="MQMDQQALRELLEFLSSSDIQELKLEGDDFRLEVRRNMPAPQAVM
FT                   LPAPAAPMVAEVAAAAPAAAASPPPAAAASRGDLVEVKAPMVGTFYRSPAPGEAPFVEV
FT                   GSKISNGQAVCILEAMKLMNELEAEISGEVVEILVENGTPVEYNQVLMLVRPS"
     atgcaaatgg accaacaggc cctgcgcgag ctgctcgaat ttctgtcaag cagcgatatt        60
     caagagctca agctcgaagg tgatgacttc cgcttggaag tcaggcgcaa catgccagcg       120
     ccccaggcgg tgatgctgcc tgctccagct gcgccaatgg ttgctgaggt tgcagccgcc       180
     gcccctgctg ccgcggcatc accaccgcca gccgctgcgg ccagccgtgg tgatttggtg       240
     gaggtcaaag cgccgatggt gggcaccttc taccggtccc cggctccggg tgaggctccc       300
     tttgtggaag tgggctcgaa gatcagcaac ggccaagccg tttgcatctt ggaggcgatg       360
     aagttgatga acgaactcga ggctgagatc tctggcgaag tggtggaaat ccttgtggaa       420
     aacggcactc cggttgagta caaccaggtg ctgatgctgg tgcgccccag ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page