(data stored in ACNUC29543 zone)

EMBL: CT978603.AHCY

CT978603.AHCY        Location/Qualifiers
FT   CDS_pept        103547..104983
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="SynRCC307_0106"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27009"
FT                   /db_xref="GOA:A5GQ50"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ50"
FT                   /protein_id="CAK27009.1"
FT                   /translation="MVAAPEALSFAGLQATDTYVIADIAQAAFGRKEIAIAETEMPGLV
FT                   ELRNKYGAQQPLKGARICGSLHMTIQTAVLIETLVALGADVRWASCNIFSTQDHAAAAI
FT                   AERGIPVFAYKGETLDEYWAFTHRIMEWSDGGTPNMILDDGGDATGLIMLGSKAEQDIS
FT                   VLDNPSNEEEIALFKSIKARLAVDPTFYSRIKANILGVTEETTTGVARLYQMVETGELP
FT                   FPAINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVMGYGDVGKGSAQSLR
FT                   GLGATVCIAEVDPICALQAAMEGFRVVRLDDVVDQMDIFVTATGNFQVIRHEHLVRMKD
FT                   EAIVCNIGHFDNEIDVASLKQYEWDNIKPQVDHITLPSGNKIILLAEGRLVNLGCATGH
FT                   PSFVMSNSFTNQTLAQIELFTKRDQYENKVYVLPKHLDEMVARLHLDKIGAKLTELTSE
FT                   QAAYINVPVEGPYKVDHYRY"
     atggtcgctg cacctgaagc tctgtcgttt gctggcctgc aagccacaga cacctacgtc        60
     attgccgata tcgctcaggc cgcgtttggc cgcaaggaaa ttgccattgc cgagaccgag       120
     atgcccggtc tggtggagct gcgcaacaag tacggcgccc agcagcccct caagggtgct       180
     cgcatctgcg gcagcctcca catgacgatt cagacggctg ttctgatcga gaccctggtg       240
     gccctgggcg ctgatgtgcg ctgggcctcc tgcaacatct tctccaccca ggatcacgcc       300
     gcggcagcca ttgctgagcg gggcatcccc gtgtttgctt acaagggcga gacccttgat       360
     gagtactggg ctttcaccca ccggatcatg gagtggtctg atggcggcac ccccaacatg       420
     atcctggatg acggtggtga tgccaccggc ctgatcatgc tgggctccaa ggccgagcaa       480
     gacatctcgg tgctggataa cccctccaat gaggaggaga ttgctctctt taagagcatc       540
     aaggcccgtc tggccgttga tccaaccttc tattcccgca tcaaggccaa catccttggc       600
     gtgacggaag aaaccaccac cggtgtggcc cgtctctatc aaatggtgga aaccggtgag       660
     ctgcccttcc cggccatcaa cgtcaacgac tcggtcacca agagcaagtt cgacaacctc       720
     tacggctgcc gtgagtccct ggtcgacagc atcaagcgcg ccaccgatgt gatggtggct       780
     ggcaagcaag ccttggtcat gggctacggc gatgtgggca agggctctgc ccagtccctg       840
     cgcggcctcg gggccaccgt ttgcatcgct gaagtggatc cgatctgcgc tctgcaggcc       900
     gccatggaag gcttccgcgt tgttcgcctc gacgacgtgg tcgatcagat ggacatcttt       960
     gtgacggcga ctggcaactt ccaggtgatt cgccatgagc acctggtgcg catgaaggat      1020
     gaggccatcg tttgcaacat cggccacttc gacaacgaga tcgatgtggc ctccctcaag      1080
     cagtacgagt gggacaacat caagccgcag gtggaccaca tcaccctgcc tagcggcaac      1140
     aagatcatcc ttctggccga gggccgtctg gtgaatctgg gctgcgccac cggccacccc      1200
     agcttcgtga tgagcaactc gttcaccaac cagaccctgg ctcaaatcga gctgttcacc      1260
     aagcgcgatc agtacgagaa caaggtgtat gtgctcccca agcacctcga tgagatggtg      1320
     gctcgcctcc atctcgacaa gatcggcgcc aagctcaccg aactgaccag cgagcaggcc      1380
     gcctacatca acgtgccggt ggaaggccct tacaaggtgg atcactaccg ctactga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page