(data stored in ACNUC29543 zone)

EMBL: CT978603.AROK

CT978603.AROK        Location/Qualifiers
FT   CDS_pept        complement(288534..289121)
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SynRCC307_0291"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27194"
FT                   /db_xref="GOA:A5GQN5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQN5"
FT                   /protein_id="CAK27194.1"
FT                   /translation="MHPTDPSQPLGERLQGTNLYLVGMMGSGKSTVGPLLAKALGYRFL
FT                   DADAVISQAAGCSIPEIFERDGEEGFRQLERQVLQQLSQWHSLVVATGGGIVTVPANWG
FT                   ELRQGVVIWLDVAEEELMRRLQADPGGRPLLAGDDPAGRLHGLLEKRQPLYGQADLRVS
FT                   AQGEGASDISERILQQLPGLLKAPGAPQTTAP"
     atgcatccta cggatccatc ccagcccctt ggtgaacggc tccagggcac gaacctgtat        60
     ttggtgggaa tgatgggcag cggcaagagc acggtgggac cgttgctggc caaggccctg       120
     ggctatcgct ttcttgatgc cgatgcggtg atcagccaag ccgctggctg cagcatcccc       180
     gagatttttg agcgcgatgg ggaggagggc ttccgccagc tcgagaggca ggtgctgcag       240
     cagctcagcc agtggcattc gctggtggtg gccaccggcg gcggcatcgt caccgtgccg       300
     gcgaactggg gcgaactgcg ccagggcgtg gtgatctggc tggatgtggc tgaagaggag       360
     ctgatgcgcc ggctgcaggc tgatcccggc ggacggccgc tgctggctgg agacgatcca       420
     gcaggacgac tgcacggact cttagaaaaa cgccaacccc tctatgggca agccgatctc       480
     cgcgtgagcg cgcaaggaga gggcgccagc gacatcagcg agcgaattct tcagcagctg       540
     cctggattgc tcaaggctcc aggcgcaccg caaaccactg caccgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page