(data stored in ACNUC29543 zone)

EMBL: CT978603.AROQ

CT978603.AROQ        Location/Qualifiers
FT   CDS_pept        429420..429863
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="SynRCC307_0456"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27359"
FT                   /db_xref="GOA:A5GR50"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR50"
FT                   /protein_id="CAK27359.1"
FT                   /translation="MRILVLHGPNLNLLGSREPGLYGRDTLSEIDAELQQQAERLGAEL
FT                   VCFQSNHEGALVDQIQQAASEMDGILINAGAFTHTSVAIRDALLAVKLPFVELHLSNVH
FT                   AREEFRHSSYLADKAVGVICGFGPISYYLALEGMVAHLRSSQL"
     atgcggattc tggtgctgca cggccccaat ctgaacttgc tgggtagtcg cgaacccggg        60
     ctctatggcc gcgacaccct ttcggagatt gatgcggaac ttcagcagca ggcggaacgc       120
     cttggtgctg agctggtctg tttccagagc aaccacgagg gggctttggt ggatcagatc       180
     cagcaggctg cctctgagat ggacgggatc ttgatcaatg ctggtgcctt cacccacacc       240
     tccgtggcca ttcgtgatgc gctgctggcg gtgaagctgc cgtttgtgga gcttcatctc       300
     agcaatgtcc atgcccgcga ggagtttcgg cacagctcct atctggctga caaggcagtg       360
     ggtgtgatct gcggctttgg tccgatcagc tactacctcg cccttgaagg gatggtggcc       420
     cacttgcgca gtagccagct gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page