(data stored in ACNUC29543 zone)

EMBL: CT978603.CHLG

CT978603.CHLG        Location/Qualifiers
FT   CDS_pept        complement(512476..513429)
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="SynRCC307_0577"
FT                   /product="Chlorophyll synthase 33 kD subunit"
FT                   /EC_number="2.5.1.62"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27480"
FT                   /db_xref="GOA:A5GRH1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH1"
FT                   /protein_id="CAK27480.1"
FT                   /translation="MSDARQLLGMKGASGTSSIWKLRLQLMKPVTWIPLIWGVLCGAAA
FT                   SGNFHWQTSDVLASLACMLMSGPLLAGFTQTINDYYDREIDAINEPYRPIPSGAIPLWQ
FT                   VKVQIWVLLIAGIAVSYGLDLWAGHSTPVLLLLALGGSFVSFIYSAPPLKLKQNGWLGN
FT                   YALGASYIALPWWAGQALFGQLSWGIVALTLAYSLAGLGIAVVNDFKSVEGDRKLGLQS
FT                   LPVVFGIERASWISAGMIDVFQIAMVVALVLLGQHFAAVLLTLLIIPQITFQDIWLLRD
FT                   PVAFDVKYQASAQPFLVIGMLVTALALGHSGFSSAG"
     gtgagcgacg cccgtcagct gcttggcatg aaaggtgcca gcggcacctc cagcatttgg        60
     aagctgcgct tgcagctgat gaaaccggtc acctggatcc ccctgatttg gggggtgctg       120
     tgtggcgcgg ccgccagcgg caacttccac tggcaaacca gtgatgtgtt ggcgtcattg       180
     gcctgcatgt tgatgagcgg cccgcttctg gcgggcttca cccaaaccat caacgactac       240
     tacgaccgcg agatcgacgc gatcaatgag ccctaccggc cgatcccctc cggggcgatc       300
     cccttgtggc aggtgaaggt gcagatctgg gtgctgctga tcgccggcat cgccgtgtcc       360
     tatggcctcg atctctgggc tggtcacagc acaccagtgc tgctgctgct ggccttgggc       420
     ggctcctttg tgagcttcat ttattcggcc ccaccgctga agctcaagca aaacggctgg       480
     ctcggcaact acgccctggg cgccagctac atcgccctgc cctggtgggc cgggcaggcc       540
     ctctttggcc agctcagctg gggcatcgtg gcgctcacct tggcctacag cctggcgggc       600
     ctcggcattg ccgtggtcaa cgatttcaag agcgtggagg gcgaccggaa actgggtctg       660
     caatcactgc cggtggtgtt tggcatcgag cgggccagct ggatcagcgc cgggatgatc       720
     gatgtcttcc agatcgccat ggtggtggcc ctggtgctgc tgggtcagca ctttgctgct       780
     gtgctgctga cgctgctgat cattccccag atcaccttcc aagacatctg gctgctacgt       840
     gatccggtgg cctttgacgt gaagtaccaa gccagcgccc aaccgttttt ggtgatcggc       900
     atgctggtca ccgcactggc cctgggccac agcggcttca gcagtgccgg ctag             954
//

If you have problems or comments...

PBIL Back to PBIL home page