(data stored in ACNUC29543 zone)

EMBL: CT978603.CLPP

CT978603.CLPP        Location/Qualifiers
FT   CDS_pept        complement(61775..62398)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SynRCC307_0066"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26969"
FT                   /db_xref="GOA:A5GQ10"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ10"
FT                   /protein_id="CAK26969.1"
FT                   /translation="MIEAISHHPIHSSWQNTLVPTVVEQSGRGERAFDIYSRLLRERII
FT                   FLGTGIDDAIADAVVAQLLYLEAEDPEKEIQIYVNSPGGSVTAGLAIYDTMQQVAPDVV
FT                   TICYGLAASMGAFLLSGGTKGKRLALPNARIMIHQPLGGAQGQAVDIEIQAKEILYLKE
FT                   TLNGLMASHTGQDLAKVSEDTDRDYFLSPDEAVAYGLIDRVVRD"
     gtgatcgaag cgatcagtca ccaccccatc cacagctctt ggcaaaacac gctggtgcca        60
     acggtggtgg agcaatcggg ccgcggcgag cgcgccttcg acatctactc acgcctgctg       120
     cgtgagcgga tcatcttttt gggcaccggc atcgatgacg ccattgccga tgccgtggtg       180
     gctcagctgc tgtatctcga agccgaggac cccgagaagg aaatccagat ttacgtgaac       240
     tctcccgggg gttcggtgac cgctggcttg gccatctacg acaccatgca gcaggtggcc       300
     cccgatgtgg tgaccatctg ttatggactg gccgccagca tgggggcgtt tctgctctct       360
     ggaggcacca aaggcaagcg attggccctg cccaatgcgc ggatcatgat tcaccagccc       420
     cttggcggtg cccaaggcca agccgtcgat atcgagattc aggcgaaaga aatcctttac       480
     ctgaaagaaa ctctcaacgg tttgatggcc tcccacacgg gccaagacct ggccaaagtc       540
     tctgaagaca ctgacaggga ctactttctc tctccggatg aagcagtggc ctacgggctg       600
     atcgatcgcg tcgtgcgcga ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page