(data stored in ACNUC29543 zone)

EMBL: CT978603.COBD/CBIB

CT978603.COBD/CBIB   Location/Qualifiers
FT   CDS_pept        complement(527472..528407)
FT                   /transl_table=11
FT                   /gene="cobD/cbiB"
FT                   /locus_tag="SynRCC307_0593"
FT                   /product="Cobalamin biosynthesis protein CobD/CbiB"
FT                   /EC_number="6.3.1.10"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27496"
FT                   /db_xref="GOA:A5GRI7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI7"
FT                   /protein_id="CAK27496.1"
FT                   /translation="MAAACGLDRLIGDPRWCLHPVQVMGAVIAQLRLWVEALGGDRPWA
FT                   LRLGGGLITALLVSGSAAAGWALEQLSLRSPWAMPLLVIALASALAGRSLRLAVEDVIK
FT                   PLSSAPPQLQQARQKLAWIVGRDVDGLPAPELLRALAETASENAVDGLFAPLFWMLIGA
FT                   GLWGLNPALPGPLALAWAFKASSTLDSMLGYRRGRLQWLGTAGARLDDGLTWLPCRLLA
FT                   LSLGQLGPALRDGASDPSPNAGVSQAAYAHALGLRLGGLNRYGGIERAKPLLNEGGRAA
FT                   DEKGVQAILDVSQRSALLWLGLSGVVALLA"
     gtggccgcag cctgcggcct ggatcgactc atcggcgatc cgcgctggtg cctgcacccc        60
     gtgcaggtga tgggcgctgt gattgcgcag ctgcgcctct gggtggaagc ccttggtggt       120
     gatcgcccct gggcgctgcg gcttgggggc ggcctgatca cggctctgct ggtcagcggg       180
     agcgcggccg ccggttgggc cctggagcag ctcagcctgc gcagcccatg ggcaatgccc       240
     ctattggtaa ttgccttggc gagtgccttg gccggacgca gcctgcggct ggccgtggaa       300
     gacgtgatca agcccctcag cagcgcaccg cctcagctgc agcaggcccg gcaaaaactg       360
     gcctggattg tggggcgcga tgtggatggc ttaccggccc cagagctgct gcgggccctg       420
     gcagaaacag cttctgaaaa tgcggtcgac ggcctgtttg cgccgctgtt ttggatgctg       480
     atcggcgctg ggctgtgggg cctcaatcca gcgctgcctg gccctttggc cctggcttgg       540
     gcgtttaaag ccagcagcac gttggattcg atgctcggct accgccgcgg gcggctgcag       600
     tggcttggca ccgccggtgc tcgcttggat gatgggctca cctggctgcc ctgccggctg       660
     ctggccctca gcctggggca attggggcca gctctgcgcg atggcgccag cgatccatcc       720
     cccaatgctg gggtctccca ggccgcctat gcccatgctc ttggtttgcg gcttggcggg       780
     ctgaaccgct atggcggcat tgagcgggcc aaaccgctgc tgaatgaggg cgggcgagcg       840
     gctgatgaga aaggcgttca ggccatcttg gatgtgagcc aacgcagcgc tctgctgtgg       900
     ctaggactga gcggcgtggt ggctctgctg gcttag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page