(data stored in ACNUC29543 zone)

EMBL: CT978603.CSDB

CT978603.CSDB        Location/Qualifiers
FT   CDS_pept        complement(560767..561921)
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="SynRCC307_0625"
FT                   /product="Selenocysteine lyase"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27528"
FT                   /db_xref="GOA:A5GRL9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL9"
FT                   /protein_id="CAK27528.1"
FT                   /translation="MPAEELRSLLPALGNKHYFNYGGQGPLPTPSLEAMVACWRELQRL
FT                   GPFSRDVWPFVEAETSALRRRLAQLCGVPPHRLSLTENVTSGCVLPLWGLPFEPGDSLL
FT                   LSDAEHPGVVAACQELARRQGLTISWFSARDCRSDAALLESLEAALEPSTRLVVLSHLL
FT                   WNSGLAMPIEAVAARLKQHPRQPWLLVDAAQSMGSLELGGVPAAADIYAFTGHKWCCGP
FT                   EGLGGVALSERVLEQSQPTVIGWRSLRNENSSGSQWHHDGRRFEVATSCIPLGAGLRSS
FT                   LDLLEQLGNAQQRQALICERSARLWNGLQQIPGVQTVVKEAPPASGLVSFTIDHTPAQA
FT                   AVSALADQHFQLRSLEDPLCLRACTHVFSTETEIDQLLEAIGQL"
     atgccagctg aagagctcag atcactgctg ccggccctgg gcaataagca ctacttcaac        60
     tacggcggcc aaggccccct gcccacgcca tcactggagg cgatggtggc ctgctggagg       120
     gaactgcaac ggctggggcc ttttagccgc gatgtgtggc cgtttgtgga agccgaaacc       180
     tcagccctca ggcgacgctt ggcccagctc tgtggcgtgc caccgcaccg gctcagcctc       240
     acggaaaacg tgaccagcgg ctgcgtgttg ccgctgtggg gattgccgtt tgaaccgggc       300
     gacagcttgc tgctcagcga tgcggaacat cccggcgtgg tggccgcttg ccaagagctg       360
     gcgcggcgcc aaggcctcac catttcctgg ttctctgccc gtgattgccg cagtgatgcc       420
     gccctgctcg aatcgctgga agcagccctg gagccgagca cacggttggt ggtgctctcc       480
     cacctgctct ggaacagcgg gcttgcgatg ccgatcgaag cggtggccgc tcgcctcaag       540
     cagcacccgc gccagccctg gctgctggtt gatgcggccc aatcgatggg cagcttggag       600
     ctcggcggcg tgcctgctgc ggccgacatc tatgccttca cgggccacaa gtggtgctgc       660
     ggccctgagg gtctcggcgg tgtggcgctc tctgagcggg tgctcgagca aagccagccc       720
     accgtgatcg gctggcgcag cctgcgcaat gagaacagca gcggcagcca gtggcaccac       780
     gacgggcgcc gctttgaggt ggcgaccagc tgcattccac tgggtgccgg cctgcgcagc       840
     tccttggacc tgctggagca actgggcaac gcccagcaac gacaagcctt gatctgtgag       900
     cgcagtgcgc gcctctggaa tgggttgcag cagatcccag gggtgcaaac cgtggtgaaa       960
     gaggcgccac cagccagcgg gctggtgagt ttcaccatcg atcacacccc agcccaagca      1020
     gccgtgagcg ccctagcgga tcaacacttc cagctgcgca gcctggagga tccgctctgc      1080
     ctaagggcct gcacccatgt gttcagcaca gagaccgaaa tcgatcagct gctggaagcc      1140
     attggccagc tctaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page